Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AEL301W95794050080.0
Kwal_14.149893993635770.0
YGL167C (PMR1)95094035240.0
CAGL0I04312g95194535120.0
KLLA0A03157g93893834740.0
CAGL0J01870g94693528940.0
Scas_707.48*74174527730.0
CAGL0K12034g108710099861e-117
YDR038C (ENA5)109110239461e-111
YDR039C (ENA2)109110239441e-111
Kwal_23.3160110010119411e-110
YDR040C (ENA1)109110229371e-110
KLLA0F20658g10829999071e-106
KLLA0E14630g108210009031e-105
AGL097C109610008941e-104
Kwal_47.1754712409647961e-89
CAGL0A00517g112210147806e-88
AFL011W12429876795e-74
KLLA0A08910g12808696724e-73
AGL085C9097355761e-61
Scas_688.19137385742e-61
YGL008C (PMA1)9187365653e-60
YPL036W (PMA2)9477505559e-59
Scas_710.419047375531e-58
Kwal_47.175228997365521e-58
KLLA0A09031g8997355423e-57
YGL006W (PMC1)11734685242e-54
CAGL0A00495g9027365113e-53
Scas_569.0d4683083782e-38
Scas_297.18002743849e-38
KLLA0B08217g14398043397e-32
CAGL0M11308g14528463244e-30
AFR567W14498813074e-28
Scas_665.3014398502913e-26
Kwal_26.920714698912904e-26
YOR291W14728822672e-23
KLLA0C08393g11486532252e-18
CAGL0L01419g12146282101e-16
Sklu_2193.111436662072e-16
KLLA0E22352g12066442073e-16
AFR354C12106042046e-16
YIL048W (NEO1)11516531993e-15
KLLA0F07447g9751481965e-15
Scas_583.14*8755161931e-14
YDR270W (CCC2)10045971921e-14
YEL031W (SPF1)12156281893e-14
ADL079C11666751869e-14
Scas_704.3811616921869e-14
ACR086C8101721732e-12
KLLA0D04092g11522371742e-12
Scas_615.99421501724e-12
CAGL0L00715g11446651706e-12
Kwal_23.578911336871681e-11
ADR350W13114701644e-11
Kwal_26.707013155401625e-11
Kwal_55.215759892871618e-11
CAGL0M08602g10121431601e-10
KLLA0A04015g13435461572e-10
CAGL0G06270g13285531545e-10
YAL026C (DRS2)13555941528e-10
AGL041C12331851421e-08
YBR295W (PCA1)12161601188e-06
Scas_89.12711831122e-05
Scas_576.815912001125e-05
AFL191W15751671109e-05
CAGL0L11814g15761701072e-04
YER166W (DNF1)15711941062e-04
KLLA0E01650g15502831063e-04
CAGL0G08085g15781701044e-04
Scas_669.316381921028e-04
YDR093W (DNF2)16122111018e-04
CAGL0H04477g16262341010.001
YMR162C (DNF3)1656220990.002
KLLA0C17644g1576195980.002
AGR120C1547170960.003
Scas_636.161554198960.003
Kwal_23.35561597287910.015
YDL150W (RPC53)42267750.90
Scas_505.41025185741.3
KLLA0E17963g2889148731.8
CAGL0L08778g400111721.9
CAGL0H07579g486120703.2
Scas_706.13156870704.0
Kwal_33.1535321558667.5
ACL130C31633668.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AEL301W
         (940 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...  1933   0.0  
Kwal_14.1498                                                         1382   0.0  
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...  1362   0.0  
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...  1357   0.0  
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....  1342   0.0  
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...  1119   0.0  
Scas_707.48*                                                         1072   0.0  
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...   384   e-117
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...   369   e-111
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...   368   e-111
Kwal_23.3160                                                          367   e-110
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...   365   e-110
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...   353   e-106
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...   352   e-105
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....   348   e-104
Kwal_47.17547                                                         311   1e-89
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...   305   6e-88
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...   266   5e-74
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...   263   4e-73
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...   226   1e-61
Scas_688.1                                                            225   2e-61
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...   222   3e-60
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...   218   9e-59
Scas_710.41                                                           217   1e-58
Kwal_47.17522                                                         217   1e-58
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...   213   3e-57
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...   206   2e-54
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...   201   3e-53
Scas_569.0d                                                           150   2e-38
Scas_297.1                                                            152   9e-38
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...   135   7e-32
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...   129   4e-30
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...   122   4e-28
Scas_665.30                                                           116   3e-26
Kwal_26.9207                                                          116   4e-26
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...   107   2e-23
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...    91   2e-18
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...    86   1e-16
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement          84   2e-16
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...    84   3e-16
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    83   6e-16
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...    81   3e-15
KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...    80   5e-15
Scas_583.14*                                                           79   1e-14
YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transportin...    79   1e-14
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...    77   3e-14
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...    76   9e-14
Scas_704.38                                                            76   9e-14
ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH] (511968..51...    71   2e-12
KLLA0D04092g complement(344666..348124) some similarities with s...    72   2e-12
Scas_615.9                                                             71   4e-12
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...    70   6e-12
Kwal_23.5789                                                           69   1e-11
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...    68   4e-11
Kwal_26.7070                                                           67   5e-11
Kwal_55.21575                                                          67   8e-11
CAGL0M08602g complement(856349..859387) similar to sp|P38995 Sac...    66   1e-10
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...    65   2e-10
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...    64   5e-10
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...    63   8e-10
AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) ...    59   1e-08
YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transpo...    50   8e-06
Scas_89.1                                                              48   2e-05
Scas_576.8                                                             48   5e-05
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...    47   9e-05
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...    46   2e-04
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...    45   2e-04
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...    45   3e-04
CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...    45   4e-04
Scas_669.3                                                             44   8e-04
YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...    44   8e-04
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...    44   0.001
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...    43   0.002
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...    42   0.002
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...    42   0.003
Scas_636.16                                                            42   0.003
Kwal_23.3556                                                           40   0.015
YDL150W (RPC53) [718] chr4 (183344..184612) RNA polymerase III, ...    33   0.90 
Scas_505.4                                                             33   1.3  
KLLA0E17963g complement(1587614..1596283) similar to sp|P19158 S...    33   1.8  
CAGL0L08778g complement(956737..957939) similar to tr|Q12297 Sac...    32   1.9  
CAGL0H07579g 740607..742067 highly similar to sp|P04807 Saccharo...    32   3.2  
Scas_706.13                                                            32   4.0  
Kwal_33.15353                                                          30   7.5  
ACL130C [919] [Homologous to ScYGR208W (SER2) - SH] (124650..125...    30   8.5  

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
           complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score = 1933 bits (5008), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 940/940 (100%), Positives = 940/940 (100%)

Query: 1   MGSVGKMSDNPFDSYLNRSKDDSSMETKSLASEAFLKPNASLEYCTMTVDETLRQLNTDS 60
           MGSVGKMSDNPFDSYLNRSKDDSSMETKSLASEAFLKPNASLEYCTMTVDETLRQLNTDS
Sbjct: 1   MGSVGKMSDNPFDSYLNRSKDDSSMETKSLASEAFLKPNASLEYCTMTVDETLRQLNTDS 60

Query: 61  AKGLCDQQQVRASEQEWGTNEVTVDGEDPVWKRFMSTFVEDPLILLLIGSAVLSFLMGNI 120
           AKGLCDQQQVRASEQEWGTNEVTVDGEDPVWKRFMSTFVEDPLILLLIGSAVLSFLMGNI
Sbjct: 61  AKGLCDQQQVRASEQEWGTNEVTVDGEDPVWKRFMSTFVEDPLILLLIGSAVLSFLMGNI 120

Query: 121 DDAVSITLAVVIVVSVGFVQEYRSEKSLEALHKLVPASCHLIRFGAETHVLASCLVPGDL 180
           DDAVSITLAVVIVVSVGFVQEYRSEKSLEALHKLVPASCHLIRFGAETHVLASCLVPGDL
Sbjct: 121 DDAVSITLAVVIVVSVGFVQEYRSEKSLEALHKLVPASCHLIRFGAETHVLASCLVPGDL 180

Query: 181 VYFKVGDRIPADVRIIESTDLSLDESTLTGETEPVHKSCTPVNSATYSDVPGGIIPIGER 240
           VYFKVGDRIPADVRIIESTDLSLDESTLTGETEPVHKSCTPVNSATYSDVPGGIIPIGER
Sbjct: 181 VYFKVGDRIPADVRIIESTDLSLDESTLTGETEPVHKSCTPVNSATYSDVPGGIIPIGER 240

Query: 241 TSIAYMGTLVREGHGKGIVVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRRDLSYVR 300
           TSIAYMGTLVREGHGKGIVVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRRDLSYVR
Sbjct: 241 TSIAYMGTLVREGHGKGIVVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRRDLSYVR 300

Query: 301 FVLSGIIFLLGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVR 360
           FVLSGIIFLLGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVR
Sbjct: 301 FVLSGIIFLLGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVR 360

Query: 361 RLPSVETLGSVNVICSDKTGTLTANHMTASKIWCLGSMANKNNVLSLEAKSSGGLPGKLP 420
           RLPSVETLGSVNVICSDKTGTLTANHMTASKIWCLGSMANKNNVLSLEAKSSGGLPGKLP
Sbjct: 361 RLPSVETLGSVNVICSDKTGTLTANHMTASKIWCLGSMANKNNVLSLEAKSSGGLPGKLP 420

Query: 421 NLKNYLSDDVKATLRIGSICNNASFSHEHGKYLGNPTDIALLEVLQKFDLVDERPTTTRV 480
           NLKNYLSDDVKATLRIGSICNNASFSHEHGKYLGNPTDIALLEVLQKFDLVDERPTTTRV
Sbjct: 421 NLKNYLSDDVKATLRIGSICNNASFSHEHGKYLGNPTDIALLEVLQKFDLVDERPTTTRV 480

Query: 481 DELTFNSKRKYMAVKVDSPANSGKHIIYVKGAFERILERSASFIGGAGKVEKLSDSHKSL 540
           DELTFNSKRKYMAVKVDSPANSGKHIIYVKGAFERILERSASFIGGAGKVEKLSDSHKSL
Sbjct: 481 DELTFNSKRKYMAVKVDSPANSGKHIIYVKGAFERILERSASFIGGAGKVEKLSDSHKSL 540

Query: 541 INDCAKSLASEGLRTLAFAQLECSTNKPMNDSTIQNLTFVGLIGMKDPPRSTVRPAIEEL 600
           INDCAKSLASEGLRTLAFAQLECSTNKPMNDSTIQNLTFVGLIGMKDPPRSTVRPAIEEL
Sbjct: 541 INDCAKSLASEGLRTLAFAQLECSTNKPMNDSTIQNLTFVGLIGMKDPPRSTVRPAIEEL 600

Query: 601 LQGGVHVIMITGDAENTAVNIARQIGIPVINPEISVLTGDRLDQMTDDQLAGVIDHVNIF 660
           LQGGVHVIMITGDAENTAVNIARQIGIPVINPEISVLTGDRLDQMTDDQLAGVIDHVNIF
Sbjct: 601 LQGGVHVIMITGDAENTAVNIARQIGIPVINPEISVLTGDRLDQMTDDQLAGVIDHVNIF 660

Query: 661 ARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVL 720
           ARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVL
Sbjct: 661 ARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVL 720

Query: 721 TDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALSLVAIATAFKLQNPLNAMQILWI 780
           TDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALSLVAIATAFKLQNPLNAMQILWI
Sbjct: 721 TDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALSLVAIATAFKLQNPLNAMQILWI 780

Query: 781 NILMDGPPAQSLGVEPVDHEVMRKPPRKRSDKILTPQVMRRLLINAAFIIGGTIYVFIKE 840
           NILMDGPPAQSLGVEPVDHEVMRKPPRKRSDKILTPQVMRRLLINAAFIIGGTIYVFIKE
Sbjct: 781 NILMDGPPAQSLGVEPVDHEVMRKPPRKRSDKILTPQVMRRLLINAAFIIGGTIYVFIKE 840

Query: 841 MTEDGQVTARDTTMTFTCFVFFDMFSALACRHATKSIFEIGIFNNKMFNYAVGFSLLGQL 900
           MTEDGQVTARDTTMTFTCFVFFDMFSALACRHATKSIFEIGIFNNKMFNYAVGFSLLGQL
Sbjct: 841 MTEDGQVTARDTTMTFTCFVFFDMFSALACRHATKSIFEIGIFNNKMFNYAVGFSLLGQL 900

Query: 901 CAIYIPFFQNIFKTERLSLGDLIYLIVISSSVFIADEVRK 940
           CAIYIPFFQNIFKTERLSLGDLIYLIVISSSVFIADEVRK
Sbjct: 901 CAIYIPFFQNIFKTERLSLGDLIYLIVISSSVFIADEVRK 940

>Kwal_14.1498
          Length = 939

 Score = 1382 bits (3577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 673/936 (71%), Positives = 795/936 (84%), Gaps = 16/936 (1%)

Query: 7   MSDNPFDSYLNRSKDDSSMETKSLASEAFLKPNASLEYCTMTVDETLRQLNTDSAKGLCD 66
           MSDNPF+SYL+RSKD      ++  +E   +P  SLE+C+++V+ET + L TD+  GL  
Sbjct: 1   MSDNPFNSYLDRSKD-----REASTAEVLSRPQPSLEFCSLSVEETAQSLGTDTQNGLPT 55

Query: 67  QQQVRASEQEWGTNEVTVDGEDPVWKRFMSTFVEDPLILLLIGSAVLSFLMGNIDDAVSI 126
              V     ++G NE++ + ++P+W +F++TFV DPLILLLIGSAV+SF+MGNIDDAVSI
Sbjct: 56  MSVVEERRAQYGKNEISSEEDEPLWWKFVTTFVGDPLILLLIGSAVISFIMGNIDDAVSI 115

Query: 127 TLAVVIVVSVGFVQEYRSEKSLEALHKLVPASCHLIRFGAETHVLASCLVPGDLVYFKVG 186
           TLA+VIVV+VGFVQEYRSEKSLEAL++LVP  CHLIR G E+ +LAS LVPGD+V F+VG
Sbjct: 116 TLAIVIVVTVGFVQEYRSEKSLEALNRLVPDQCHLIRCGQESKLLASVLVPGDVVRFRVG 175

Query: 187 DRIPADVRIIESTDLSLDESTLTGETEPVHKSCTPVNSATYSDVPGGIIPIGERTSIAYM 246
           DRIPAD+RIIE+ DLS++ES LTGE EPVHKS   VN   Y +  G I+P+ ER+ IA+M
Sbjct: 176 DRIPADLRIIEAVDLSIEESNLTGENEPVHKSTATVNKEFYKENLGSIVPVSERSCIAFM 235

Query: 247 GTLVREGHGKGIVVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRRDLSYVRFVLSGI 306
           GTLVREGHG+GIV+ T K+T FG VFEMMN+IEKPKTPLQ AMD L +DLS++ F++ GI
Sbjct: 236 GTLVREGHGRGIVIGTAKNTAFGKVFEMMNAIEKPKTPLQTAMDKLGKDLSFMSFIVIGI 295

Query: 307 IFLLGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRLPSVE 366
           I L+GVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMA R+AI+RRLPSVE
Sbjct: 296 ICLIGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRRAIIRRLPSVE 355

Query: 367 TLGSVNVICSDKTGTLTANHMTASKIWCLGSMANKNNVLSLEAKSSGGLPGKLPNLKNYL 426
           TLGSVNVICSDKTGTLTANHM+ +K+WCLGSM+NK+N+L L+  +SG       + K  L
Sbjct: 356 TLGSVNVICSDKTGTLTANHMSVNKVWCLGSMSNKSNILKLDKATSG-------SFKKNL 408

Query: 427 SDDVKATLRIGSICNNASFSHEHGKYLGNPTDIALLEVLQKFDLVDERPTTTRVDELTFN 486
           ++D++ATLR G++CNN+++SHEH KYLGNPTDIALLEVL KF L DERP  TR DE++FN
Sbjct: 409 TEDLRATLRTGNLCNNSTYSHEHAKYLGNPTDIALLEVLHKFGLEDERPQVTRSDEISFN 468

Query: 487 SKRKYMAVKVDSPANSGKHIIYVKGAFERILERSASFIGGAGKVEKLSDSHKSLINDCAK 546
           SKRK+MAVKV     +GK +++VKGA+E+ILE+S  FI    KV KL  + +  I D A 
Sbjct: 469 SKRKFMAVKVKEA--NGKFVVHVKGAYEKILEKSTHFINAENKVVKLDSNLRQAITDSAD 526

Query: 547 SLASEGLRTLAFAQLECST--NKPMNDSTIQNLTFVGLIGMKDPPRSTVRPAIEELLQGG 604
           +LAS+GLRTLAFAQLE S   +K + +  I  LTF GL+GM DPPR +V+ A+E L +G 
Sbjct: 527 ALASDGLRTLAFAQLELSNGNSKKLTEDDINGLTFAGLLGMNDPPRPSVKAAVERLSEGS 586

Query: 605 VHVIMITGDAENTAVNIARQIGIPVINPEISVLTGDRLDQMTDDQLAGVIDHVNIFARAT 664
           VH+IMITGDAENTAV+IARQIGIPV+NPE +VLTGD+LD M++DQLA +IDHVNIFARAT
Sbjct: 587 VHIIMITGDAENTAVSIARQIGIPVVNPETAVLTGDKLDHMSEDQLASIIDHVNIFARAT 646

Query: 665 PEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVLTDDD 724
           PEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGV+MG MGTDVAKEASDMVLTDDD
Sbjct: 647 PEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVLTDDD 706

Query: 725 FSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALSLVAIATAFKLQNPLNAMQILWINILM 784
           FSTILTAIEEGKGIFNNIQ+FLTFQLSTSVAALSLVAIATAFKL NPLNAMQILWINILM
Sbjct: 707 FSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAIATAFKLPNPLNAMQILWINILM 766

Query: 785 DGPPAQSLGVEPVDHEVMRKPPRKRSDKILTPQVMRRLLINAAFIIGGTIYVFIKEMTED 844
           DGPPAQSLGVEPVDHEVM+KPPRKR+DKILT  V +RLL +AA II GTIYVFIKEM ED
Sbjct: 767 DGPPAQSLGVEPVDHEVMKKPPRKRADKILTKAVFQRLLQSAALIIIGTIYVFIKEMAED 826

Query: 845 GQVTARDTTMTFTCFVFFDMFSALACRHATKSIFEIGIFNNKMFNYAVGFSLLGQLCAIY 904
           G+VTARDTTMTFTCFVFFDMF+ALACRH+TKSIFE+GIF NKMFNYAVG SLLGQ+CAIY
Sbjct: 827 GEVTARDTTMTFTCFVFFDMFNALACRHSTKSIFEVGIFANKMFNYAVGCSLLGQVCAIY 886

Query: 905 IPFFQNIFKTERLSLGDLIYLIVISSSVFIADEVRK 940
           +PFFQ+IFKTERLSLGDL +L+++SS+VFIADE+RK
Sbjct: 887 VPFFQSIFKTERLSLGDLAFLLLLSSTVFIADELRK 922

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
           Ca2+-transporting P-type ATPase of Golgi membrane
           involved in Ca2+ and Mn2+ import into Golgi [2853 bp,
           950 aa]
          Length = 950

 Score = 1362 bits (3524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 668/940 (71%), Positives = 791/940 (84%), Gaps = 13/940 (1%)

Query: 7   MSDNPFDSYLNRSKDDSSMETKSLASEAFLKPNASLEYCTMTVDETLRQLNTDSAKGLCD 66
           MSDNPF++ L     +   E     +EA  KP+ SLEYCT++VDE L +L+TD   GL  
Sbjct: 1   MSDNPFNASLLDEDSNREREILDATAEALSKPSPSLEYCTLSVDEALEKLDTDKNGGLRS 60

Query: 67  QQQVRASEQEWGTNEVTVDGEDPVWKRFMSTFVEDPLILLLIGSAVLSFLMGNIDDAVSI 126
             +       +G NE+TV+ ++ ++K+F+S F+ED +ILLLIGSAV+S  MGNIDDAVSI
Sbjct: 61  SNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVVSLFMGNIDDAVSI 120

Query: 127 TLAVVIVVSVGFVQEYRSEKSLEALHKLVPASCHLIRFGAETHVLASCLVPGDLVYFKVG 186
           TLA+ IVV+VGFVQEYRSEKSLEAL+KLVPA CHL+R G E+HVLAS LVPGDLV+F++G
Sbjct: 121 TLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLMRCGQESHVLASTLVPGDLVHFRIG 180

Query: 187 DRIPADVRIIESTDLSLDESTLTGETEPVHKSCTPVNSATYSDVPGGIIPIGERTSIAYM 246
           DRIPAD+RIIE+ DLS+DES LTGE EPVHK+   +  ++++D P  I+PI ER+ IAYM
Sbjct: 181 DRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYM 240

Query: 247 GTLVREGHGKGIVVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRRDLSYVRFVLSGI 306
           GTLV+EGHGKGIVV TG +T FGAVFEMMN+IEKPKTPLQ+ MD L +DLS V F++ G+
Sbjct: 241 GTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIGM 300

Query: 307 IFLLGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRLPSVE 366
           I L+G+IQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMA RKAIVRRLPSVE
Sbjct: 301 ICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVE 360

Query: 367 TLGSVNVICSDKTGTLTANHMTASKIWCLGSMANKNNVLSLE----AKSSGGLPGKLPNL 422
           TLGSVNVICSDKTGTLT+NHMT SK+WCL SM+NK NVLSL+     K+S G      NL
Sbjct: 361 TLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKKTKNSNG------NL 414

Query: 423 KNYLSDDVKATLRIGSICNNASFSHEHGKYLGNPTDIALLEVLQKFDLVDERPTTTRVDE 482
           KNYL++DV+ TL IG++CNNASFS EH  +LGNPTD+ALLE L  F++ D R T  +V E
Sbjct: 415 KNYLTEDVRETLTIGNLCNNASFSQEHAIFLGNPTDVALLEQLANFEMPDIRNTVQKVQE 474

Query: 483 LTFNSKRKYMAVKVDSPANSGKHIIYVKGAFERILERSASFIGGAGK-VEKLSDSHKSLI 541
           L FNSKRK MA K+ +P ++ K  +YVKGAFERILE S S++   GK  EKL+++ K+ I
Sbjct: 475 LPFNSKRKLMATKILNPVDN-KCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATI 533

Query: 542 NDCAKSLASEGLRTLAFAQLECS-TNKPMNDSTIQNLTFVGLIGMKDPPRSTVRPAIEEL 600
           N+CA S+ASEGLR   FA+L  S ++ P+ +  I++LTF GLIGM DPPR  V+ AIE+L
Sbjct: 534 NECANSMASEGLRVFGFAKLTLSDSSTPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQL 593

Query: 601 LQGGVHVIMITGDAENTAVNIARQIGIPVINPEISVLTGDRLDQMTDDQLAGVIDHVNIF 660
           LQGGVH+IMITGD+ENTAVNIA+QIGIPVI+P++SVL+GD+LD+M+DDQLA VIDHVNIF
Sbjct: 594 LQGGVHIIMITGDSENTAVNIAKQIGIPVIDPKLSVLSGDKLDEMSDDQLANVIDHVNIF 653

Query: 661 ARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVL 720
           ARATPEHKLNIVRAL+KRGD+VAMTGDGVNDAPALKL+DIGV+MG +GTDVAKEASDMVL
Sbjct: 654 ARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVL 713

Query: 721 TDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALSLVAIATAFKLQNPLNAMQILWI 780
           TDDDFSTILTAIEEGKGIFNNIQ+FLTFQLSTSVAALSLVA++TAFKL NPLNAMQILWI
Sbjct: 714 TDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVALSTAFKLPNPLNAMQILWI 773

Query: 781 NILMDGPPAQSLGVEPVDHEVMRKPPRKRSDKILTPQVMRRLLINAAFIIGGTIYVFIKE 840
           NILMDGPPAQSLGVEPVDHEVM+KPPRKR+DKILT  VM+RLL  AA II GT+Y+F+KE
Sbjct: 774 NILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLLTTAACIIVGTVYIFVKE 833

Query: 841 MTEDGQVTARDTTMTFTCFVFFDMFSALACRHATKSIFEIGIFNNKMFNYAVGFSLLGQL 900
           M EDG+VTARDTTMTFTCFVFFDMF+ALACRH TKSIFEIG F NKMFNYAVG SLLGQ+
Sbjct: 834 MAEDGKVTARDTTMTFTCFVFFDMFNALACRHNTKSIFEIGFFTNKMFNYAVGLSLLGQM 893

Query: 901 CAIYIPFFQNIFKTERLSLGDLIYLIVISSSVFIADEVRK 940
           CAIYIPFFQ+IFKTE+L + D++ L++ISSSVFI DE+RK
Sbjct: 894 CAIYIPFFQSIFKTEKLGISDILLLLLISSSVFIVDELRK 933

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 951

 Score = 1357 bits (3512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 670/945 (70%), Positives = 795/945 (84%), Gaps = 22/945 (2%)

Query: 7   MSDNPFDSYLNRSKD--DSSMETKSLASE-------AFLKPNASLEYCTMTVDETLRQLN 57
           MSDNPF +Y ++ KD   SS    S   E       A  KPN SLEYCT++V+ETL +L+
Sbjct: 1   MSDNPF-TYYDKDKDAGGSSASLNSQEKEILEATNAALTKPNPSLEYCTLSVEETLHKLD 59

Query: 58  TDSAKGLCDQQQVRASEQEWGTNEVTVDGEDPVWKRFMSTFVEDPLILLLIGSAVLSFLM 117
           TD+  GL   ++     Q +G NE++VD ++ + K+F+S FVED LILLL+GSA++S  +
Sbjct: 60  TDAKLGLSSVEEATKRRQYYGPNEISVDDDESLVKKFLSNFVEDRLILLLMGSAIISVFL 119

Query: 118 GNIDDAVSITLAVVIVVSVGFVQEYRSEKSLEALHKLVPASCHLIRFGAETHVLASCLVP 177
           GNIDDA+SIT+A+VIVV+VGFVQEYRSEKSLEAL+KLVP  CHLIR G E++VLA+ LVP
Sbjct: 120 GNIDDAISITMAIVIVVTVGFVQEYRSEKSLEALNKLVPQECHLIRGGRESNVLATNLVP 179

Query: 178 GDLVYFKVGDRIPADVRIIESTDLSLDESTLTGETEPVHKSCTPVNSATYSDVPGGIIPI 237
           GDLV F++GDRIPAD+RIIE  DL++DES LTGET+PVHKS   ++  +Y+D P  I+P+
Sbjct: 180 GDLVRFRIGDRIPADIRIIECNDLTIDESNLTGETDPVHKSYKALSRDSYNDQPNSIVPV 239

Query: 238 GERTSIAYMGTLVREGHGKGIVVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRRDLS 297
            ERT+IAYMGTLV+EG+G+GIVV TG+ T FG VFEMM+SIEKPKTPLQ+ MD L +DLS
Sbjct: 240 AERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLGKDLS 299

Query: 298 YVRFVLSGIIFLLGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKA 357
              FV+ GII ++G+IQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMA RKA
Sbjct: 300 LASFVVIGIICVVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKA 359

Query: 358 IVRRLPSVETLGSVNVICSDKTGTLTANHMTASKIWCLGSMANKNNVLSLEAKSSGGLPG 417
           IVRRLPSVETLGSVNVICSDKTGTLT+NHMT SKIWCLGSMANK NVLSL+ K+ GG   
Sbjct: 360 IVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLD-KNKGG--- 415

Query: 418 KLPNLKNYLSDDVKATLRIGSICNNASFSHEHGKYLGNPTDIALLEVLQKFDLVDERPTT 477
              NLKNYL+DDVK TL  G++CNNAS+S EH KYLGNPTD+ALLE LQKF+L D R   
Sbjct: 416 ---NLKNYLTDDVKTTLLCGNLCNNASYSQEHAKYLGNPTDVALLEQLQKFELADVRSEY 472

Query: 478 TRVDELTFNSKRKYMAVKVDSPANSGKHIIYVKGAFERILERSASFIGGAGKVEKLSDSH 537
           T+V EL+FNSKRK MA K+    N  K  +++KGAFERIL++S+S++   GK+EKL+  H
Sbjct: 473 TKVKELSFNSKRKMMATKIQD--NEKKTTLFIKGAFERILDKSSSYLTEKGKIEKLTAGH 530

Query: 538 KSLINDCAKSLASEGLRTLAFAQ--LECSTNKPMNDSTIQNLTFVGLIGMKDPPRSTVRP 595
           +  I DCA +LASEGLR LAFA+  +  S++K + D  I +L F GLIGM DPPRS+V+ 
Sbjct: 531 RETIIDCANTLASEGLRVLAFAKRAMTDSSSKLVEDD-ISDLVFTGLIGMNDPPRSSVKF 589

Query: 596 AIEELLQGGVHVIMITGDAENTAVNIARQIGIPVINPEISVLTGDRLDQMTDDQLAGVID 655
           AI++ LQGG+H+IMITGD+ENTAVNIARQIGIPVI+P++SVL+GD+L++MTDDQLA VID
Sbjct: 590 AIDQFLQGGIHIIMITGDSENTAVNIARQIGIPVIDPKLSVLSGDKLNEMTDDQLANVID 649

Query: 656 HVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEA 715
           HVNIFARATPEHKLNIVRAL++RGD+VAMTGDGVNDAPALKLADIGV+MG MGTDVAKEA
Sbjct: 650 HVNIFARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEA 709

Query: 716 SDMVLTDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALSLVAIATAFKLQNPLNAM 775
           SDM+LTDDDFSTILTAIEEGKGIFNNIQ+FL+FQLSTS+AALSLVA++TAF L NPLNAM
Sbjct: 710 SDMILTDDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPNPLNAM 769

Query: 776 QILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRSDKILTPQVMRRLLINAAFIIGGTIY 835
           QILWINILMDGPPAQSLGVEPVDHEVM+KPPRKR+DKILT ++++RL+  A+ II GT+Y
Sbjct: 770 QILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTAELLKRLIGTASCIILGTVY 829

Query: 836 VFIKEMTEDGQVTARDTTMTFTCFVFFDMFSALACRHATKSIFEIGIFNNKMFNYAVGFS 895
           VF+KEM EDGQVTARDTTMTFTCFVFFDMF+ALACRH TKSIFEIG F NKMFN AVGFS
Sbjct: 830 VFVKEMAEDGQVTARDTTMTFTCFVFFDMFNALACRHTTKSIFEIGFFTNKMFNLAVGFS 889

Query: 896 LLGQLCAIYIPFFQNIFKTERLSLGDLIYLIVISSSVFIADEVRK 940
           LLGQ+CAIYIPFFQ IFKTE L+  DLI+L +ISSSVFI DE+RK
Sbjct: 890 LLGQMCAIYIPFFQAIFKTESLAFSDLIFLAMISSSVFIIDEIRK 934

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
           Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score = 1342 bits (3474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 687/938 (73%), Positives = 789/938 (84%), Gaps = 21/938 (2%)

Query: 7   MSDNPFDSYLNRSKDDSSMETKSLASEAFLKPNASLEYCTMTVDETLRQLNTDSAKGLCD 66
           MSDNPF+SYL R +     +    A +   +PNASLEYCT++V++T+ QL TD   GL +
Sbjct: 1   MSDNPFESYLARDQ-----QPPQPAVDVLSQPNASLEYCTVSVEDTIAQLGTDFDNGLSN 55

Query: 67  QQQVRASEQEWGTNEVTVDGEDPVWKRFMSTFVEDPLILLLIGSAVLSFLMGNIDDAVSI 126
             ++   +  WG+NEV  D +  +WK+F+STF+EDPLILLLIGSAV+SFLMGNIDD++SI
Sbjct: 56  PSEIAYRKSIWGSNEVLPDEKVSLWKKFLSTFIEDPLILLLIGSAVISFLMGNIDDSISI 115

Query: 127 TLAVVIVVSVGFVQEYRSEKSLEALHKLVPASCHLIRFGAETHVLASCLVPGDLVYFKVG 186
            LA++IVV+VGFVQEY+SEKSLEAL+KLVPA CHL R G  +HVLAS LVPGDLV FKVG
Sbjct: 116 ALAIIIVVTVGFVQEYKSEKSLEALNKLVPAECHLTRSGQLSHVLASNLVPGDLVRFKVG 175

Query: 187 DRIPADVRIIESTDLSLDESTLTGETEPVHKSCTPVNSATYSDVPGGIIPIGERTSIAYM 246
           DRIPAD+RI+ES DL +DES LTGE EPVHKS   V+   YS +PG IIP+G+R  I +M
Sbjct: 176 DRIPADLRIVESIDLCVDESNLTGENEPVHKSSGAVDPKNYSHIPGSIIPVGDRNCIGFM 235

Query: 247 GTLVREGHGKGIVVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRRDLSYVRFVLSGI 306
           GTLVREGHGKGIV+ATGKHT+FG+VFEMM+ I+KPKTPLQ AMD L +DLSY+ FVL GI
Sbjct: 236 GTLVREGHGKGIVIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQDLSYMSFVLIGI 295

Query: 307 IFLLGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRLPSVE 366
           I L+G+IQGRSWLEMFQI+VSLAVAAIPEGLPIIVTVTLALGVLRMA RKAIVRRLPSVE
Sbjct: 296 ICLIGIIQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVE 355

Query: 367 TLGSVNVICSDKTGTLTANHMTASKIWCLGSMANKNNVLSLEAKSSGGLPGKLPNLKNYL 426
           TLGSVNVICSDKTGTLTANHMT SKIWCLGSM NK N L+L          K+      +
Sbjct: 356 TLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLAL---------SKVKERPIKM 406

Query: 427 SDDVKATLRIGSICNNASFSHEHGKYLGNPTDIALLEVLQKFDLVDERPTTTRVDELTFN 486
             DV  TLRIG+ICNN ++S EH KYLGNPTDIA+LE LQ F + D R +  +++E+ FN
Sbjct: 407 EQDVATTLRIGNICNNGTYSQEHLKYLGNPTDIAILESLQHFGINDCRNSVNKINEIPFN 466

Query: 487 SKRKYMAVK-VDSPANSGKHIIYVKGAFERILERSASFIGGAGKVEKLSDSHKSLINDCA 545
           SKRK+MAVK +D+   + K ++YVKGAFE+I+E+S ++IG  GKV KL  + K++IND A
Sbjct: 467 SKRKFMAVKTIDA---NDKVVVYVKGAFEKIVEKSINYIGRDGKVHKLKPNDKAIINDAA 523

Query: 546 KSLASEGLRTLAFAQLECST---NKPMNDSTIQNLTFVGLIGMKDPPRSTVRPAIEELLQ 602
            +LASEGLRTLAFA+LE S    +K  N+  ++ LTF GLI M DPPR TVR AIEELLQ
Sbjct: 524 VALASEGLRTLAFAELEVSATHGDKEFNEDMVEGLTFTGLIAMNDPPRPTVRSAIEELLQ 583

Query: 603 GGVHVIMITGDAENTAVNIARQIGIPVINPEISVLTGDRLDQMTDDQLAGVIDHVNIFAR 662
           G VHVIMITGDAENTAV+IARQIGIPVINPE SVL+GD+LDQMTDDQLA VIDHVN+FAR
Sbjct: 584 GSVHVIMITGDAENTAVSIARQIGIPVINPEYSVLSGDKLDQMTDDQLASVIDHVNVFAR 643

Query: 663 ATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVLTD 722
           ATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGV+MG MGTDVAKEASDMVLTD
Sbjct: 644 ATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVLTD 703

Query: 723 DDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALSLVAIATAFKLQNPLNAMQILWINI 782
           DDFSTILTAIEEGKGIFNNIQ+FLTFQLSTSVAALSLVAI+T+ KL NPLNAMQILWINI
Sbjct: 704 DDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAISTSLKLPNPLNAMQILWINI 763

Query: 783 LMDGPPAQSLGVEPVDHEVMRKPPRKRSDKILTPQVMRRLLINAAFIIGGTIYVFIKEMT 842
           LMDGPPAQSLGVEPVDHEVMRKPPRKR+DKILT  V++R+LI+A FII GTIYVF+KEM 
Sbjct: 764 LMDGPPAQSLGVEPVDHEVMRKPPRKRTDKILTDAVLKRVLISACFIIVGTIYVFVKEMA 823

Query: 843 EDGQVTARDTTMTFTCFVFFDMFSALACRHATKSIFEIGIFNNKMFNYAVGFSLLGQLCA 902
           EDGQVT+RDTTMTFTCFVFFDMF+AL+CRHATKSIFEIG F NKMFNYAV  SLLGQLCA
Sbjct: 824 EDGQVTSRDTTMTFTCFVFFDMFNALSCRHATKSIFEIGFFANKMFNYAVSLSLLGQLCA 883

Query: 903 IYIPFFQNIFKTERLSLGDLIYLIVISSSVFIADEVRK 940
           IYIPFFQ IFKTE LSLGDL++L+ +SSSVFI DE+RK
Sbjct: 884 IYIPFFQGIFKTESLSLGDLLFLLTLSSSVFIGDEIRK 921

>CAGL0J01870g 181666..184506 highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1, hypothetical
           start
          Length = 946

 Score = 1119 bits (2894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/935 (60%), Positives = 715/935 (76%), Gaps = 25/935 (2%)

Query: 16  LNRSKDDSSMETKSL----------ASEAFLKPNASLEYCTMTVDETLRQLNTDSAKGLC 65
           +  S DDS  ET  +          A E   +PN SL++CT++V ET+  L TD   GL 
Sbjct: 10  VEESVDDSVEETHEMLPSAPVLDEEAYELLNRPNPSLKFCTLSVGETVENLETDVDNGLS 69

Query: 66  DQQQVRASEQEWGTNEVTVDGEDPVWKRFMSTFVEDPLILLLIGSAVLSFLMGNIDDAVS 125
            +++V    +  G N+   D ++ + K+F+ +FVED LILLLIGSAVLSF +G IDDAVS
Sbjct: 70  SEEEVVKRREIHGRNDFEEDDDESMIKKFLMSFVEDRLILLLIGSAVLSFAIGQIDDAVS 129

Query: 126 ITLAVVIVVSVGFVQEYRSEKSLEALHKLVPASCHLIRFGAETHVLASCLVPGDLVYFKV 185
           I+LA++IVV+VGF+QEYRSEKSLEAL+KLVP  CHLIR+G E++ LAS LVPGDLV FK+
Sbjct: 130 ISLAILIVVTVGFIQEYRSEKSLEALNKLVPTKCHLIRYGRESNTLASELVPGDLVRFKI 189

Query: 186 GDRIPADVRIIESTDLSLDESTLTGETEPVHKSCTPVNSATYSDVPGGIIPIGERTSIAY 245
           GDRIPADVRIIE+ DLS+DES LTGETEP+HK    ++   Y +     +P+ ER+ IAY
Sbjct: 190 GDRIPADVRIIEAVDLSIDESNLTGETEPLHKDAQTIDPEEYDNRN---VPVSERSCIAY 246

Query: 246 MGTLVREGHGKGIVVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRRDLSYVRFVLSG 305
           MGTLV+EGHGKGIV+ TG +T +GA+FEM+NSIEKPKTPLQ  MD L  +LSY+ F +  
Sbjct: 247 MGTLVKEGHGKGIVIGTGTNTSYGAIFEMVNSIEKPKTPLQETMDRLGTELSYISFFIIA 306

Query: 306 IIFLLGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRLPSV 365
           II ++G+I+G S L MFQ+SVSLAVAAIPEGLPIIVTVTLALGVLRM  + AIVRRLPSV
Sbjct: 307 IISIVGIIRGNSLLMMFQVSVSLAVAAIPEGLPIIVTVTLALGVLRMTKQNAIVRRLPSV 366

Query: 366 ETLGSVNVICSDKTGTLTANHMTASKIWCLGSMANKNNVLSLEAKSSGGLPGKLPNLKNY 425
           ETLGSVNVIC+DKTGTLT NHMT SK++CL S     N +S E  S   +          
Sbjct: 367 ETLGSVNVICTDKTGTLTTNHMTVSKLFCLDSSGTYENAISPEEDSEFDVH--------- 417

Query: 426 LSDDVKATLRIGSICNNASFSHEHGKYLGNPTDIALLEVLQKFDLVDERPTTTRVDELTF 485
             +DVK TL I +ICNNA +S EH  Y+GNPTD+AL+EVL KF + D+R +  +++EL+F
Sbjct: 418 -DNDVKETLTIANICNNAKYSEEHNLYIGNPTDVALIEVLTKFGIPDQRDSHEKMEELSF 476

Query: 486 NSKRKYMAVKVDSPANSGKHIIYVKGAFERILERSASFIGGAGKVEKLSDSHKSLINDCA 545
           NSKRKYMA+K  S   SG+H++Y+KGAFERIL++S+ ++  AG+V +  +  K ++ + A
Sbjct: 477 NSKRKYMAIK--SSKESGEHVLYIKGAFERILDKSSYYLDKAGEVREFDEHSKVMVLEAA 534

Query: 546 KSLASEGLRTLAFAQLECSTNKPMNDSTIQNLTFVGLIGMKDPPRSTVRPAIEELLQGGV 605
            S AS+GLRT+A A     ++  +++  I  LTF GL G+ DPPR  V+ +IE+L +GGV
Sbjct: 535 HSCASDGLRTIACAFKPTDSDNVISEDDINGLTFTGLFGLADPPRPNVKASIEKLHRGGV 594

Query: 606 HVIMITGDAENTAVNIARQIGIPVINPEISVLTGDRLDQMTDDQLAGVIDHVNIFARATP 665
           H+IMITGD+ NTAV+IA +IG+ V + E SV+TGD++ ++T+D+L+ VID VNIFARATP
Sbjct: 595 HIIMITGDSVNTAVSIAEKIGLSVQDRESSVMTGDKVSELTEDELSKVIDKVNIFARATP 654

Query: 666 EHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVLTDDDF 725
           E+KLNIV+AL+KRGDIVAMTGDGVNDAPALKLADIG+AMG  GTDVAKE SDM+LTDDDF
Sbjct: 655 ENKLNIVKALRKRGDIVAMTGDGVNDAPALKLADIGIAMGISGTDVAKEVSDMILTDDDF 714

Query: 726 STILTAIEEGKGIFNNIQSFLTFQLSTSVAALSLVAIATAFKLQNPLNAMQILWINILMD 785
           S+ILTAIEEGKGIFNNI++FLTFQLS SVA LSL+AI T  KL  PLN MQILWINI+MD
Sbjct: 715 SSILTAIEEGKGIFNNIRNFLTFQLSISVATLSLIAITTIAKLPAPLNPMQILWINIIMD 774

Query: 786 GPPAQSLGVEPVDHEVMRKPPRKRSDKILTPQVMRRLLINAAFIIGGTIYVFIKEMTEDG 845
           GPPAQSLGVEPVD +VM KPPR R ++IL   ++ RLL  A  I+ GT Y+F+K M E+ 
Sbjct: 775 GPPAQSLGVEPVDSDVMDKPPRSREERILNMNILLRLLYLAICILVGTFYIFLKGMDENQ 834

Query: 846 QVTARDTTMTFTCFVFFDMFSALACRHATKSIFEIGIFNNKMFNYAVGFSLLGQLCAIYI 905
           Q T++D TMTFT FVFF +F+A+ACRH TKSIF+IG+F+N++FN A+  S+ GQ+CA+YI
Sbjct: 835 QTTSKDITMTFTGFVFFAIFNAVACRHTTKSIFQIGLFSNRIFNIAILLSVCGQMCAVYI 894

Query: 906 PFFQNIFKTERLSLGDLIYLIVISSSVFIADEVRK 940
           PFFQ+IFKTE L   DL+ L+++SSSV I DE+RK
Sbjct: 895 PFFQHIFKTENLGFYDLLTLVLVSSSVLIVDEIRK 929

>Scas_707.48*
          Length = 741

 Score = 1072 bits (2773), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/745 (70%), Positives = 621/745 (83%), Gaps = 10/745 (1%)

Query: 7   MSDNPFDSYLNRSKDDSSMETKSLASEAFLKPNASLEYCTMTVDETLRQLNTDSAKGLCD 66
           MS NPFD+ +   +     E   +A EA  +PNASLEYCTM+VDETLR+L TD   GL  
Sbjct: 1   MSANPFDAPIADERSIEERELLEVAKEALSRPNASLEYCTMSVDETLRKLETDPKSGLGS 60

Query: 67  QQQVRASEQEWGTNEVTVDGEDPVWKRFMSTFVEDPLILLLIGSAVLSFLMGNIDDAVSI 126
             +    +  +G NE+ ++ ++ +WK+F+S+FVED LILLLIGSAV+SF+MGNIDDAVSI
Sbjct: 61  IAEASRRKLVYGANEIVIEEDESLWKKFLSSFVEDRLILLLIGSAVVSFIMGNIDDAVSI 120

Query: 127 TLAVVIVVSVGFVQEYRSEKSLEALHKLVPASCHLIRFGAETHVLASCLVPGDLVYFKVG 186
           TLA+VIVVSVGFVQEYRSEKSLEAL+KLVPA CHLIR G E+HVLAS LVPGDLV+FK+G
Sbjct: 121 TLAIVIVVSVGFVQEYRSEKSLEALNKLVPAECHLIRCGQESHVLASGLVPGDLVHFKIG 180

Query: 187 DRIPADVRIIESTDLSLDESTLTGETEPVHKSCTPVNSATYSDVPGGIIPIGERTSIAYM 246
           DRIPAD+RIIE+ DLS+DES LTGE EPVHKS   VN  +++D P  IIPI +RT +AYM
Sbjct: 181 DRIPADLRIIEAVDLSIDESNLTGENEPVHKSAKEVNKDSFNDQPNSIIPISDRTCVAYM 240

Query: 247 GTLVREGHGKGIVVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRRDLSYVRFVLSGI 306
           GTLV+EGHGKGIVV  GK+T FGA+FEM+++IEKPKTPLQ AMD L +DLS   F++ G+
Sbjct: 241 GTLVKEGHGKGIVVGIGKNTSFGAIFEMLSNIEKPKTPLQNAMDKLGKDLSLFSFIVIGL 300

Query: 307 IFLLGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRLPSVE 366
           I L+G++QGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMA RKAIVRRLPSVE
Sbjct: 301 ICLVGILQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVE 360

Query: 367 TLGSVNVICSDKTGTLTANHMTASKIWCLGSMANKNNVLSLEAKSSGGLPGKLPNLKNYL 426
           TLGSVNVICSDKTGTLT+NHMTASKIWCL SMANK NVLSLE   SG       +LKNYL
Sbjct: 361 TLGSVNVICSDKTGTLTSNHMTASKIWCLDSMANKANVLSLEKSKSG-------SLKNYL 413

Query: 427 SDDVKATLRIGSICNNASFSHEHGKYLGNPTDIALLEVLQKFDLVDERPTTTRVDELTFN 486
           ++DVK+TL IG+ICNNASFS EHGKYLGNPTDIALLE L KFDL D RPT  +V E+ FN
Sbjct: 414 TEDVKSTLTIGNICNNASFSQEHGKYLGNPTDIALLEQLSKFDLSDIRPTFKKVQEIPFN 473

Query: 487 SKRKYMAVKVDSPANSGKHIIYVKGAFERILERSASFIGGAGKVEKLSDSHKSLINDCAK 546
           SKRK+MAVK+ +  + GK+ + VKGAFE++L + + ++   GK EKL+   + +I + A 
Sbjct: 474 SKRKFMAVKIVN--SEGKYSLCVKGAFEKVLSQCSHYLNQKGKTEKLTQGQRDVIIETAN 531

Query: 547 SLASEGLRTLAFAQLECSTNKP-MNDSTIQNLTFVGLIGMKDPPRSTVRPAIEELLQGGV 605
           SLASEGLR LAFA+     +   + + ++ +L F GLIGM DPPR TV+PAIE+LLQGGV
Sbjct: 532 SLASEGLRMLAFAKTTLPDSPTLLTEESVGDLIFTGLIGMNDPPRPTVKPAIEQLLQGGV 591

Query: 606 HVIMITGDAENTAVNIARQIGIPVINPEISVLTGDRLDQMTDDQLAGVIDHVNIFARATP 665
           H+IMITGD+ENTAVNIARQIGIPV++P++SVL+GD+L++M+DDQLA VIDHVNIFARATP
Sbjct: 592 HIIMITGDSENTAVNIARQIGIPVLDPKLSVLSGDKLNEMSDDQLANVIDHVNIFARATP 651

Query: 666 EHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVLTDDDF 725
           EHKLNIVRAL+KRGD+VAMTGDGVNDAPALKLADIGV+MG MGTDVAKEASDMVLTDDDF
Sbjct: 652 EHKLNIVRALRKRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMVLTDDDF 711

Query: 726 STILTAIEEGKGIFNNIQSFLTFQL 750
           STILTAIEEGKGIFNNIQ+FLTFQL
Sbjct: 712 STILTAIEEGKGIFNNIQNFLTFQL 736

>CAGL0K12034g complement(1161299..1164562) highly similar to sp|P13587
            Saccharomyces cerevisiae YDR040c ENA1 or sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 or sp|Q12691
            Saccharomyces cerevisiae YDR038c ENA5, hypothetical start
          Length = 1087

 Score =  384 bits (986), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 296/1009 (29%), Positives = 488/1009 (48%), Gaps = 160/1009 (15%)

Query: 43   EYCTMTVDETLRQLNTDSAKGLCDQQQVRASEQEWGTNEVTVDGEDPVWKRFMSTFVEDP 102
            +Y  ++V++T  +L TDS+KG+   ++ +A   + G N +  D +   +K  +   + + 
Sbjct: 12   DYHALSVEDTCARLVTDSSKGI-SPEEFQARLAQCGENSLGDDAKID-YKAMLIHQICNA 69

Query: 103  LILLLIGSAVLSFLMGNIDDAVSITLAVVIVVSVGFVQEYRSEKSLEALHKLVPASCHLI 162
            +IL+LI S ++SF + +      I   + I V +G +QEY++ K++ AL  L   + H+I
Sbjct: 70   MILVLIISMIISFAIRDWITGGVICFVIGINVIIGLIQEYKASKTMNALRALSSPNAHVI 129

Query: 163  RFGAETHVLASCLVPGDLVYFKVGDRIPADVRIIESTDLSLDESTLTGETEPVHKSCTPV 222
            R G    V ++ +VPGDLV  KVGD IPAD+R++   +   DE+ LTGE+ PV K    +
Sbjct: 130  RNGNSEVVDSTDVVPGDLVVVKVGDTIPADLRLVSQQNFETDEALLTGESLPVSKDANEI 189

Query: 223  NSATYSDVPGGIIPIGERTSIAYMGTLVREGHGKGIVVATGKHTMFGAVFEMMN------ 276
                + D      P+G+R ++A+  + V +G  +GI + TG +T  G + + +       
Sbjct: 190  ----FDDE----TPVGDRINLAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNELI 241

Query: 277  SIEKPKTPLQMAMDT----------------LRRDLSYVRFVLSGIIFLLGVIQGRSWLE 320
            S +  KT  Q A  +                L R LS +  +L  I  +  ++   S  +
Sbjct: 242  SRDPAKTWYQNAWISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMAS--Q 299

Query: 321  MFQI-------SVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRLPSVETLGSVNV 373
             F +       +V +A++ IP  L +++T+T+++G   MA+R  I+R+L S+E LG+VN 
Sbjct: 300  KFDVDRGVAIYAVCVALSMIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVND 359

Query: 374  ICSDKTGTLTANHMTASKIWC--LGSM--ANKNNVLSLEAKSSGGLP------------- 416
            ICSDKTGTLT   M A +IW    G++     N  L+ E      +P             
Sbjct: 360  ICSDKTGTLTQGKMIAKQIWVPKFGTLQVVGSNEPLNPEKGDINFIPNLSPYEYSHNETE 419

Query: 417  --GKLPNLKN-YLSDDVKAT---------LRIGSICNNASF----SHEHGKYLGNPTDIA 460
              G + N K+ Y    +            L   S+ N AS       +  K  G+PT+IA
Sbjct: 420  DVGIMQNFKDKYEGKSIPGNCQYQLFDKWLETASLANIASVFTDPETKEWKAHGDPTEIA 479

Query: 461  LLEVLQKFDLVDERPTTTRVD----------------------------ELTFNSKRKYM 492
            +     + DL     T  R D                            E  F+S  K M
Sbjct: 480  IQVFATRMDLPRHVLTGERDDMDEDEIMSSVSLSEKDATAANAKFRHAAEFPFDSTIKRM 539

Query: 493  AVKVDSPANSGKHIIYVKGAFERILERSASFIG-GAGKVEKLSDSHKSLINDCAKSLASE 551
            +   +S  +   + IY KGAFE +L     + G        ++D+    I +   S++SE
Sbjct: 540  SSVYES-RDYKTYEIYTKGAFESVLNCCTHWYGRDPNTATVMTDADVDTIKENIDSMSSE 598

Query: 552  GLRTLAFAQLECSTNKPMNDSTIQN-----------LTFVGLIGMKDPPRSTVRPAIEEL 600
            GLR LAFA  +      +N+  +Q            LTF+GLIG+ DPPR     A+++ 
Sbjct: 599  GLRVLAFAN-KSYPKSDVNEEKLQKILKERDYAETGLTFLGLIGIYDPPREETAGAVKKF 657

Query: 601  LQGGVHVIMITGDAENTAVNIARQIGIPVIN--------PEISVLTGDRLDQMTDDQLAG 652
             Q G++V M+TGD   TA  IA+++GI   N         +I V+TG + D +++D++  
Sbjct: 658  HQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEVVDIMVMTGKQFDNLSEDEIDN 717

Query: 653  VIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVA 712
            +     + AR +P+ K+ ++ AL +R    AMTGDGVND+P+LK+A++G+AMG  G+DVA
Sbjct: 718  LPVLPLVIARCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVA 777

Query: 713  KEASDMVLTDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALSLVAIATAFKLQN-- 770
            K+ASD+VL+DD+F++IL A+EEG+ + +NIQ F+   L+ +VA    + +  AF+ +   
Sbjct: 778  KDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLIVGLAFQDKEGK 837

Query: 771  ---PLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRSDKILTPQVMRRLLINAA 827
               PL  +++LWI ++    PA  LG+E   H++M +PP      I T +++  + +   
Sbjct: 838  SVFPLAPVEVLWIIVVTSCFPAMGLGLEKAAHDLMDRPPNDSKAGIFTWEIIVDMFVYGV 897

Query: 828  FIIGGTIYVFI-----KEMTEDGQVTARD----------------TTMTFTCFVF----F 862
            ++    +  F+     ++    GQ   RD                 TMT+   +      
Sbjct: 898  WMAASCMATFVTIIYGRDHGNLGQNCNRDYSESCHDVFRARSAAFATMTWCALILAWEVI 957

Query: 863  DMFSALACRH-----ATKSIFEIGIFNNKMFNYAVGFSLLGQLCAIYIP 906
            D+  +    H       K  F+  I+ NK   Y+V F        +YIP
Sbjct: 958  DLRRSFFRMHPDTDAPVKQFFK-DIYGNKFLFYSVVFGFASVFPVVYIP 1005

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score =  369 bits (946), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 299/1023 (29%), Positives = 493/1023 (48%), Gaps = 162/1023 (15%)

Query: 32   SEAFLKPNASLE---YCTMTVDETLRQLNTDSAKGLCDQQQVRASEQEWGTNEVTVDGED 88
            SE  +K N + E   Y T+T +E    + T   +GL   + +R  +      E T+  + 
Sbjct: 2    SEGTVKENNNEEFNAYHTLTTEEAAEFIGTSLTEGLTQDESLRRLK---AVGENTLGDDT 58

Query: 89   PV-WKRFMSTFVEDPLILLLIGSAVLSFLMGNIDDAVSITLAVVIVVSVGFVQEYRSEKS 147
             + +K  +   V + +I++L+ S  +SF + +      I+  + + V +G VQEY++ K+
Sbjct: 59   KIDYKAMVLHQVCNAMIMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKT 118

Query: 148  LEALHKLVPASCHLIRFGAETHVLASCLVPGDLVYFKVGDRIPADVRIIESTDLSLDEST 207
            + +L  L   + H+IR G    + +  +VPGD+   KVGD IPAD+R+IE+ +   DES 
Sbjct: 119  MNSLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESL 178

Query: 208  LTGETEPVHKSCTPVNSATYSDVPGGIIPIGERTSIAYMGTLVREGHGKGIVVATGKHTM 267
            LTGE+ PV K    V              +G+R ++A+  + V +G  KGIV+ T  ++ 
Sbjct: 179  LTGESLPVSKDANLVFGKEEE------TSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSE 232

Query: 268  FGAVFEMMN------SIEKPKTPLQMAMDT----------------LRRDLSYVRFVLSG 305
             G + + +       S +  K+ LQ    +                L R LS +  +L  
Sbjct: 233  IGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFW 292

Query: 306  IIFLLGVIQGRSWLEMFQI-------SVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAI 358
            I  L  +I   S  + F +       ++ +A++ IP  L +++T+T+++G   M +R  I
Sbjct: 293  IAVLFAIIVMAS--QKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVI 350

Query: 359  VRRLPSVETLGSVNVICSDKTGTLTANHMTASKIWC--LGSMA----------NKNNVLS 406
            VR+L S+E LG+VN ICSDKTGTLT   M A +IW    G++           N+ NV  
Sbjct: 351  VRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSL 410

Query: 407  LE-------AKSSGGLPGKLPNLKNYLS----------DDVKATLRIGSICNNASFSHEH 449
            +        + +  G  G L N K+ L           D  +  L   ++ N A+   + 
Sbjct: 411  IPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDD 470

Query: 450  G----KYLGNPTDIALLEVLQKFDLV------------------------DERPTTTRVD 481
                 K  G+PT+IA+     K DL                         +E+P + + +
Sbjct: 471  ATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFE 530

Query: 482  ---ELTFNSKRKYMAVKVDSPANSGKHIIYVKGAFERILERSASFIGGAG-KVEKLSDSH 537
               E  F+S  K M+  V    ++  + IY KGAFE I+   +S+ G  G K+  L+D  
Sbjct: 531  HIAEFPFDSTVKRMS-SVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCD 589

Query: 538  KSLINDCAKSLASEGLRTLAFAQLECSTNKPMNDSTIQNLT-----------FVGLIGMK 586
               I     SL++EGLR L FA  +  T   +ND  ++N+T           F+GLIG+ 
Sbjct: 590  VETIRKNVYSLSNEGLRVLGFAS-KSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIY 648

Query: 587  DPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVIN-----PEI---SVLT 638
            DPPR+    A+++  Q G++V M+TGD   TA  IA+++GI   N      EI    V+T
Sbjct: 649  DPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMT 708

Query: 639  GDRLDQMTDDQLAGVIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLA 698
            G + D ++++++  +     + AR +P+ K+ ++ AL +R    AMTGDGVND+P+LK+A
Sbjct: 709  GSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMA 768

Query: 699  DIGVAMGHMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALS 758
            ++G+AMG  G+DV+KEASD+VL+DD+F++IL A+EEG+ + +NIQ F+   L+ +VA   
Sbjct: 769  NVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQAL 828

Query: 759  LVAIATAFKLQN-----PLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRSDKI 813
             + I   F+ +N     PL+ +++LWI ++    PA  LG+E    ++M +PP      I
Sbjct: 829  YLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPNDSEVGI 888

Query: 814  LTPQVMRRLLINAAFIIGGTIYVFIKEMTE----------DGQV--TARD---------T 852
             T +V+         + G  +  F   +            DG    + RD          
Sbjct: 889  FTWEVIIDTFAYGIIMTGSCMASFTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFA 948

Query: 853  TMTFTCFVF----FDMFSALACRH-----ATKSIFEIGIFNNKMFNYAVGFSLLGQLCAI 903
            TMT+   +      DM  +    H       K  F   I+ N+   +++ F  +     +
Sbjct: 949  TMTWCALILAWEVVDMRRSFFRMHPDTDSPVKEFFR-SIWGNQFLFWSIIFGFVSAFPVV 1007

Query: 904  YIP 906
            YIP
Sbjct: 1008 YIP 1010

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score =  368 bits (944), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 299/1023 (29%), Positives = 493/1023 (48%), Gaps = 162/1023 (15%)

Query: 32   SEAFLKPNASLE---YCTMTVDETLRQLNTDSAKGLCDQQQVRASEQEWGTNEVTVDGED 88
            SE  +K N + E   Y T+T +E    + T   +GL   + +R  +      E T+  + 
Sbjct: 2    SEGTVKENNNEEFNAYHTLTTEEAAEFIGTSLTEGLTQDESLRRLK---AVGENTLGDDT 58

Query: 89   PV-WKRFMSTFVEDPLILLLIGSAVLSFLMGNIDDAVSITLAVVIVVSVGFVQEYRSEKS 147
             + +K  +   V + +I++L+ S  +SF + +      I+  + + V +G VQEY++ K+
Sbjct: 59   KIDYKAMVLHQVCNAMIMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKT 118

Query: 148  LEALHKLVPASCHLIRFGAETHVLASCLVPGDLVYFKVGDRIPADVRIIESTDLSLDEST 207
            + +L  L   + H+IR G    + +  +VPGD+   KVGD IPAD+R+IE+ +   DES 
Sbjct: 119  MNSLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESL 178

Query: 208  LTGETEPVHKSCTPVNSATYSDVPGGIIPIGERTSIAYMGTLVREGHGKGIVVATGKHTM 267
            LTGE+ PV K    V              +G+R ++A+  + V +G  KGIV+ T  ++ 
Sbjct: 179  LTGESLPVSKDANLVFGKEEE------TSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSE 232

Query: 268  FGAVFEMMN------SIEKPKTPLQMAMDT----------------LRRDLSYVRFVLSG 305
             G + + +       S +  K+ LQ    +                L R LS +  +L  
Sbjct: 233  IGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFW 292

Query: 306  IIFLLGVIQGRSWLEMFQI-------SVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAI 358
            I  L  +I   S  + F +       ++ +A++ IP  L +++T+T+++G   M +R  I
Sbjct: 293  IAVLFAIIVMAS--QKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVI 350

Query: 359  VRRLPSVETLGSVNVICSDKTGTLTANHMTASKIWC--LGSMA----------NKNNVLS 406
            VR+L S+E LG+VN ICSDKTGTLT   M A +IW    G++           N+ NV  
Sbjct: 351  VRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSL 410

Query: 407  LE-------AKSSGGLPGKLPNLKNYLS----------DDVKATLRIGSICNNASFSHEH 449
            +        + +  G  G L N K+ L           D  +  L   ++ N A+   + 
Sbjct: 411  IPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDD 470

Query: 450  G----KYLGNPTDIALLEVLQKFDLV------------------------DERPTTTRVD 481
                 K  G+PT+IA+     K DL                         +E+P + + +
Sbjct: 471  ATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFE 530

Query: 482  ---ELTFNSKRKYMAVKVDSPANSGKHIIYVKGAFERILERSASFIGGAG-KVEKLSDSH 537
               E  F+S  K M+  V    ++  + IY KGAFE I+   +S+ G  G K+  L+D  
Sbjct: 531  HIAEFPFDSTVKRMS-SVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCD 589

Query: 538  KSLINDCAKSLASEGLRTLAFAQLECSTNKPMNDSTIQNLT-----------FVGLIGMK 586
               I     SL++EGLR L FA  +  T   +ND  ++N+T           F+GLIG+ 
Sbjct: 590  VETIRKNVYSLSNEGLRVLGFAS-KSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIY 648

Query: 587  DPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVIN-----PEI---SVLT 638
            DPPR+    A+++  Q G++V M+TGD   TA  IA+++GI   N      EI    V+T
Sbjct: 649  DPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMT 708

Query: 639  GDRLDQMTDDQLAGVIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLA 698
            G + D ++++++  +     + AR +P+ K+ ++ AL +R    AMTGDGVND+P+LK+A
Sbjct: 709  GSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMA 768

Query: 699  DIGVAMGHMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALS 758
            ++G+AMG  G+DV+KEASD+VL+DD+F++IL A+EEG+ + +NIQ F+   L+ +VA   
Sbjct: 769  NVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQAL 828

Query: 759  LVAIATAFKLQN-----PLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRSDKI 813
             + I   F+ +N     PL+ +++LWI ++    PA  LG+E    ++M +PP      I
Sbjct: 829  YLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGI 888

Query: 814  LTPQVMRRLLINAAFIIGGTIYVFIKEMTE----------DGQV--TARD---------T 852
             T +V+         + G  +  F   +            DG    + RD          
Sbjct: 889  FTWEVIIDTFAYGIIMTGSCMASFTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFA 948

Query: 853  TMTFTCFVF----FDMFSALACRH-----ATKSIFEIGIFNNKMFNYAVGFSLLGQLCAI 903
            TMT+   +      DM  +    H       K  F   I+ N+   +++ F  +     +
Sbjct: 949  TMTWCALILAWEVVDMRRSFFRMHPDTDSPVKEFFR-SIWGNQFLFWSIIFGFVSAFPVV 1007

Query: 904  YIP 906
            YIP
Sbjct: 1008 YIP 1010

>Kwal_23.3160
          Length = 1100

 Score =  367 bits (941), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 283/1011 (27%), Positives = 482/1011 (47%), Gaps = 150/1011 (14%)

Query: 44   YCTMTVDETLRQLNTDSAKGLCDQQQVRASEQEWGTNEVTVDGEDPVWKRFMSTFVEDPL 103
            + T++  +T   L TD   GL    +  A   ++G N +  D +   +K  +   + + +
Sbjct: 23   FHTVSARDTAHVLETDLQAGL-RSAEATARVSQYGENSLGDDSKID-FKSILLHQICNAM 80

Query: 104  ILLLIGSAVLSFLMGNIDDAVSITLAVVIVVSVGFVQEYRSEKSLEALHKLVPASCHLIR 163
            IL+L  S V++  + +      I   V I V++G  QEY++ K++ +L  L   S H+IR
Sbjct: 81   ILVLFISMVITLAIRDWISGGVIAFVVFINVAIGSYQEYKASKTMNSLKSLSTPSAHVIR 140

Query: 164  FGAETHVLASCLVPGDLVYFKVGDRIPADVRIIESTDLSLDESTLTGETEPVHKSCTPVN 223
             G +  + +  LVPGDL   K GD +PAD+R+IE  +   DE+ LTGE+ P+ K  + V 
Sbjct: 141  DGNDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGESLPIAKEASQVY 200

Query: 224  SATYSDVPGGIIPIGERTSIAYMGTLVREGHGKGIVVATGKHTMFGAVFEMMN------S 277
             AT         P+G+R ++A+  + V +G   GIVV TG +T  G + + +       S
Sbjct: 201  PATED------TPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLIS 254

Query: 278  IEKPKTPLQMAMDTL----------------RRDLSYVRFVLS--GIIFLLGVIQGRSWL 319
             ++ KT    A  TL                 R LS +  +L    ++F + V+  + ++
Sbjct: 255  KDENKTFWANAGITLAATIGSFLGTTTGTPLHRKLSKLAVLLFFIAVVFAIVVMATQKFV 314

Query: 320  ---EMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRLPSVETLGSVNVICS 376
               E+   ++ +AV+ IP  L +++T+T+++G   MA R  +VR+L S+E LG+VN +CS
Sbjct: 315  VNKEVAIYAICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCS 374

Query: 377  DKTGTLTANHMTASKIWC--LGSMANKNNVLSLEAKSSGGLP------------------ 416
            DKTGTLT   M   + W    G++   N+    +  + GG+                   
Sbjct: 375  DKTGTLTQGKMIVKQAWVPSFGTITVSNSSNPFDP-TDGGIELIPRFSPHQYKHDSTEDV 433

Query: 417  GKLPNLKN-YLSDDVKATLRIGSICNN------ASFSH-------EHGKYLGNPTDIALL 462
            G + + KN + +D + A L      N       A+ +H       E  K  G+PT+IA+ 
Sbjct: 434  GIITSFKNKFYNDKLPAGLNSKLFLNWLKTAALANIAHVYQDPETEEWKAHGDPTEIAIQ 493

Query: 463  EVLQKFDL--------------VDE-----------RPTTTRVDELTFNSKRKYMAVKVD 497
                K D+               DE            P    + E  F+S  K M+    
Sbjct: 494  VFAHKLDMPRNALTAEDKSDSESDEDAALGEKTSSVEPHYKHIAEFPFDSSIKRMSAVYV 553

Query: 498  SPANSGKHIIYVKGAFERILERSASFI---GGAGKVEKLSDSHKSLINDCAKSLASEGLR 554
            S      H ++ KGAFER+L+    ++         + +++  K  +    ++L+SEGLR
Sbjct: 554  SLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMTEEDKEEVFKNVETLSSEGLR 613

Query: 555  TLAFAQLECSTNKPMN---------DSTIQNLTFVGLIGMKDPPRSTVRPAIEELLQGGV 605
             LAFA    + ++ +          D    +L F GL+G+ DPPR     A+++  + G+
Sbjct: 614  VLAFATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGI 673

Query: 606  HVIMITGDAENTAVNIARQIGI--------PVINPEISVLTGDRLDQMTDDQLAGVIDHV 657
            +V M+TGD   TA  IA+++GI        P    +  V+T  + DQ+TD+++  ++   
Sbjct: 674  NVHMLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMVMTAAQFDQLTDEEIDNLLLLP 733

Query: 658  NIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASD 717
             + AR  P+ K+ ++ AL +R    AMTGDGVND+P+LK A++G+AMG  G+DVAK+ASD
Sbjct: 734  LVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASD 793

Query: 718  MVLTDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALSLVAIATAFKLQN-----PL 772
            +VL+DD+F++IL A+EEG+ + +NIQ F+   L+ +VA    + I   F  ++     PL
Sbjct: 794  IVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMIGLCFLDEDRLSVFPL 853

Query: 773  NAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRSDKILTPQVMRRLLINAAFIIGG 832
            + +++LWI ++    PA  LG+E    ++M K P+     I T +++  +LI   ++   
Sbjct: 854  SPVEVLWIIVVTSCFPAMGLGLEKSAPDIMEKEPQDSKAGIFTWEIILDMLIYGTWMAAC 913

Query: 833  TIYVFI----------------KEMTEDGQVTARDTTMTFTCFVFFDMFSALACRHATKS 876
             +  FI                   +E           TF    +  +  A       +S
Sbjct: 914  CLACFITVIYGKGNGELGINCNNSYSESCDNVYHGRAATFASMTWCALILAWEVIDMRRS 973

Query: 877  IFEI-------------GIFNNKMFNYAVGFSLLGQLCAIYIPFF-QNIFK 913
             F++              I++N+   ++V F  +     +YIP   +++FK
Sbjct: 974  FFKMQPETDTPYTQWMKDIWSNQFLFWSVIFGFVSVFPVVYIPVINKDVFK 1024

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
            involved in Na+ and Li+ efflux, required for Na+
            tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score =  365 bits (937), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 298/1022 (29%), Positives = 490/1022 (47%), Gaps = 162/1022 (15%)

Query: 33   EAFLKPNASLE---YCTMTVDETLRQLNTDSAKGLCDQQQVRASEQEWGTNEVTVDGEDP 89
            E   K N + E   Y T+T +E    + T   +GL   + V   +      E T+  +  
Sbjct: 3    EGTTKENNNAEFNAYHTLTAEEAAEFIGTSLTEGLTQDEFVHRLKT---VGENTLGDDTK 59

Query: 90   V-WKRFMSTFVEDPLILLLIGSAVLSFLMGNIDDAVSITLAVVIVVSVGFVQEYRSEKSL 148
            + +K  +   V + +I++L+ S ++SF M +      I+  + + V +G VQEY++ K++
Sbjct: 60   IDYKAMVLHQVCNAMIMVLLISMIISFAMHDWITGGVISFVIAVNVLIGLVQEYKATKTM 119

Query: 149  EALHKLVPASCHLIRFGAETHVLASCLVPGDLVYFKVGDRIPADVRIIESTDLSLDESTL 208
             +L  L   + H+IR G    + +  +VPGD+   KVGD IPAD+R+IE+ +   DES L
Sbjct: 120  NSLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLL 179

Query: 209  TGETEPVHKSCTPVNSATYSDVPGGIIPIGERTSIAYMGTLVREGHGKGIVVATGKHTMF 268
            TGE+ PV K    V              +G+R ++A+  + V +G  KGIV+ T  ++  
Sbjct: 180  TGESLPVSKDANLVFGKEEE------TSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEI 233

Query: 269  GAVFEMMN------SIEKPKTPLQMAMDT----------------LRRDLSYVRFVLSGI 306
            G + + +       S +  K+ LQ    +                L R LS +  +L  I
Sbjct: 234  GKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWI 293

Query: 307  IFLLGVIQGRSWLEMFQI-------SVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIV 359
              L  +I   S  + F +       ++ +A++ IP  L +++T+T+++G   M +R  IV
Sbjct: 294  AVLFAIIVMAS--QKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIV 351

Query: 360  RRLPSVETLGSVNVICSDKTGTLTANHMTASKIWC--LGSMA----------NKNNVLSL 407
            R+L S+E LG+VN ICSDKTGTLT   M A +IW    G++           N+ NV  +
Sbjct: 352  RKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLI 411

Query: 408  E-------AKSSGGLPGKLPNLKNYLS----------DDVKATLRIGSICNNASFSHEHG 450
                    + +  G  G L N K+ L           D  +  L   ++ N A+   +  
Sbjct: 412  PRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDA 471

Query: 451  ----KYLGNPTDIALLEVLQKFDLV------------------------DERPTTTRVD- 481
                K  G+PT+IA+     K DL                         +E+P + + + 
Sbjct: 472  TDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEH 531

Query: 482  --ELTFNSKRKYMAVKVDSPANSGKHIIYVKGAFERILERSASFIGGAG-KVEKLSDSHK 538
              E  F+S  K M+  V    ++  + IY KGAFE I+   +S+ G  G K+  L+D   
Sbjct: 532  IAEFPFDSTVKRMS-SVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDV 590

Query: 539  SLINDCAKSLASEGLRTLAFAQLECSTNKPMNDSTIQNLT-----------FVGLIGMKD 587
              I     SL++EGLR L FA  +  T   +ND  ++N+T           F+GLIG+ D
Sbjct: 591  ETIRKNVYSLSNEGLRVLGFAS-KSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYD 649

Query: 588  PPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVIN-----PEI---SVLTG 639
            PPR+    A+++  Q G++V M+TGD   TA  IA+++GI   N      EI    V+TG
Sbjct: 650  PPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTG 709

Query: 640  DRLDQMTDDQLAGVIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLAD 699
             + D ++++++  +     + AR +P+ K+ ++ AL +R     MTGDGVND+P+LK+A+
Sbjct: 710  SQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMAN 769

Query: 700  IGVAMGHMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALSL 759
            +G+AMG  G+DV+KEASD+VL+DD+F++IL A+EEG+ + +NIQ F+   L+ +VA    
Sbjct: 770  VGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALY 829

Query: 760  VAIATAFKLQN-----PLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRSDKIL 814
            + I   F+ +N     PL+ +++LWI ++    PA  LG+E    ++M +PP      I 
Sbjct: 830  LIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIF 889

Query: 815  TPQVMRRLLINAAFIIGGTIYVFIKEMTE----------DGQV--TARD---------TT 853
            T +V+         + G  +  F   +            DG    + RD          T
Sbjct: 890  TWEVIIDTFAYGIIMTGSCMASFTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFAT 949

Query: 854  MTFTCFVF----FDMFSALACRH-----ATKSIFEIGIFNNKMFNYAVGFSLLGQLCAIY 904
            MT+   +      DM  +    H       K  F   I+ N+   +++ F  +     +Y
Sbjct: 950  MTWCALILAWEVVDMRRSFFRMHPDTDSPVKEFFR-SIWGNQFLFWSIIFGFVSAFPVVY 1008

Query: 905  IP 906
            IP
Sbjct: 1009 IP 1010

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
           cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
           efflux, start by similarity
          Length = 1082

 Score =  353 bits (907), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 289/999 (28%), Positives = 480/999 (48%), Gaps = 142/999 (14%)

Query: 38  PNASLEYCTMTVDETLRQLNTDSAKGLCDQQQVRASEQEWGTNEVTVDGEDPVWKRFMST 97
           P A  ++  +T  +  + L+T   +GL +  Q+       G N +  D +  + K  + +
Sbjct: 13  PYARNDFHVLTAPQVEKLLSTHINQGL-NNTQIAERLSLVGENTLGDDTKINI-KGILIS 70

Query: 98  FVEDPLILLLIGSAVLSFLMGNIDDAVSITLAVVIVVSVGFVQEYRSEKSLEALHKLVPA 157
            + + +I++LI S V++  + +      +   V I V +G  QEY + K++ +L  L   
Sbjct: 71  QICNAMIMVLIISMVITLAIKDWISGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLSTP 130

Query: 158 SCHLIRFGAETHVLASCLVPGDLVYFKVGDRIPADVRIIESTDLSLDESTLTGETEPVHK 217
           S H+IR G +  + +  LVPGD+   KVGD +PAD+R++ES +L  DE+ LTGE+ PV K
Sbjct: 131 SAHVIRDGNDITIQSKELVPGDICIIKVGDTVPADLRLLESINLETDEALLTGESLPVAK 190

Query: 218 SCTPVNSATYSDVPGGIIPIGERTSIAYMGTLVREGHGKGIVVATGKHTMFGAVFEMMNS 277
           S        +S+V     P+G+R ++A+  + V +G   GIV+ T  +T  G + + + S
Sbjct: 191 S--------HSEVYEKDTPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKS 242

Query: 278 ------IEKPKTPLQMAMDTLR----------------RDLSYVRFVLSGIIFL-----L 310
                  ++ K+  Q    TL+                R LS +  +L  +  +     +
Sbjct: 243 ETSFISKDENKSFGQNLWITLKETIGSFLGTNVGTPLHRKLSQLAILLFVVAVIFAIVVM 302

Query: 311 GVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRLPSVETLGS 370
           G  + R   ++   ++ +A++ IP  L +++T+T++ G   MA R  IVR+L S+E LG+
Sbjct: 303 GTQKYRVNKQVAIYAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGA 362

Query: 371 VNVICSDKTGTLTANHMTASKIWC--LGSMA----------------------------- 399
           VN ICSDKTGTLT   M A ++W    G++                              
Sbjct: 363 VNDICSDKTGTLTQGKMIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYKHD 422

Query: 400 NKNNVLSLEAKSSGGLPGKLPNLKNYLSDDVKATLRIGSICNNASFSH-EHGKYLGNPTD 458
           ++ +V  +    S  L G+L  L   L D    T  + +I      S  +  K  G+PT+
Sbjct: 423 DEEDVGIIPDFKSKYLAGELGPLNVSLFDQWLYTATLANIATVFQDSETQDWKAHGDPTE 482

Query: 459 IALLEVLQKFDL-------------VDERPTTT--RVDELTFNSKRKYMAVKVDSPANSG 503
           IA+     + DL              D R  ++   V E  F+S  K M+    +  +  
Sbjct: 483 IAIQVFATRMDLPRHVLTGEDKDDEKDARANSSFEHVAEFPFDSSVKRMSAIYKNTEDPA 542

Query: 504 KHI--IYVKGAFERILERSASFIGGA-GKVEKLSDSHKSLINDCAKSLASEGLRTLAFA- 559
             I  ++ KGAFER+L+   S+     GK   LS      I     +L+SEGLR LAFA 
Sbjct: 543 TPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAFAK 602

Query: 560 ----QLECSTNKPM----NDSTIQNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMIT 611
               + E + NK       D     LTF+GLIG+ DPPR     A+++  Q G++V M+T
Sbjct: 603 KSFNESEFNANKDKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLT 662

Query: 612 GDAENTAVNIARQIGI----------PVINPEISVLTGDRLDQMTDDQLAGVIDHVNIFA 661
           GD   TA +IA+++GI           V+N    V+     D ++D ++  +     + A
Sbjct: 663 GDFPGTAKSIAQEVGILPHNLYHYPKEVVN--FMVMAATDFDALSDQEIDDLRVLPLVIA 720

Query: 662 RATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVLT 721
           R  P+ K+ ++ AL +R    AMTGDGVND+P+LK+A++G+AMG  G+DVAK+ASD+VL+
Sbjct: 721 RCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLS 780

Query: 722 DDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALSLVAIATAFKLQN-----PLNAMQ 776
           DD+F++IL A+EEG+ + +NIQ F+   L+ +VA    + +   F  +      PL+ ++
Sbjct: 781 DDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFVDKEGFSVFPLSPVE 840

Query: 777 ILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRSDKILTPQVMRRLLINAAFIIGGTIYV 836
           +LWI ++    PA  LG+E    +VM KPP+     + T +V+  +L+    +    +  
Sbjct: 841 VLWIIVVTSCFPAMGLGLEKASVDVMEKPPKDAKAVVFTWEVIIDMLVYGVIMAACCMAC 900

Query: 837 FIKEM--TEDGQV-------------------TARDTTMTFTCFVF----FDMFSALACR 871
           F+  +  T DG +                    A   TMT+   +      DM  +    
Sbjct: 901 FVTVLYGTGDGNLGSDCNDALGETCHLVFRGRAAAFATMTWCALILAWEVVDMRRSFFMM 960

Query: 872 HATKSIFEIGIFNNKMFNYAVGFSLLGQLCA----IYIP 906
           +         +F +   N  + +S++G  C+    +YIP
Sbjct: 961 NPESETPYTQVFKDIWSNQFLFWSIVGGFCSVFPVVYIP 999

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
           Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
           involved in Na+ efflux, hypothetical start
          Length = 1082

 Score =  352 bits (903), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 287/1000 (28%), Positives = 488/1000 (48%), Gaps = 144/1000 (14%)

Query: 38  PNASLEYCTMTVDETLRQLNTDSAKGLCDQQQVRASEQEWGTNEVTVDGEDPVWKRFMST 97
           P A  ++ +++V      L+T   +GL +  Q+       G N +  D +  +   F+S 
Sbjct: 13  PYARDDFHSLSVSRVETLLSTHINQGL-NTTQIAERLGLIGENTLGDDSKINIKGIFISQ 71

Query: 98  FVEDPLILLLIGSAVLSFLMGNIDDAVSITLAVVIVVSVGFVQEYRSEKSLEALHKLVPA 157
              + +I++LI S V+SF + +      I   V I V +G  QEY + K++ +L  L   
Sbjct: 72  IC-NAMIMVLIISMVISFAIKDWISGGVIAFVVFINVVIGAYQEYNASKTMNSLKSLSTP 130

Query: 158 SCHLIRFGAETHVLASCLVPGDLVYFKVGDRIPADVRIIESTDLSLDESTLTGETEPVHK 217
           S H+IR G +  + +  LVPGD+   +VGD +PAD+R+ E+ +L  DE+ LTGE+ PV K
Sbjct: 131 SAHVIRAGNDLTIESKELVPGDICIIRVGDTVPADLRLFEAINLETDEALLTGESLPVAK 190

Query: 218 SCTPVNSATYSDVPGGIIPIGERTSIAYMGTLVREGHGKGIVVATGKHTMFGAVFEMMNS 277
           S        + +V     P+G+R ++A+  + V +G   GIV+ T  +T  G + + + S
Sbjct: 191 S--------HGEVYEQDTPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKS 242

Query: 278 ----IEKPKTP---------LQMAMDT---------LRRDLSYVRFVLSGIIFL-----L 310
               I + K+          L+ ++ T         L R LS +  +L  +  +     +
Sbjct: 243 EASLISRDKSKSFGRNLWITLRESIGTFLGTSVGTPLHRKLSQLAILLFVVAVIFAIVVM 302

Query: 311 GVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRLPSVETLGS 370
           G  + +   ++   ++ +A++ IP  L +++T+T++ G   MA R  I+R+L S+E LG+
Sbjct: 303 GTQKFKVNKQVAIYAICVALSMIPSSLVVVLTITMSAGAKVMATRHVIIRKLDSLEALGA 362

Query: 371 VNVICSDKTGTLTANHMTASKIWC--LGSM--ANKNNVLSLEAKSSGGLP---------- 416
           VN ICSDKTGTLT   M A ++W    G++   N N   +        +P          
Sbjct: 363 VNDICSDKTGTLTQGKMIAKQVWIPQFGTINVQNSNEPFNPTIGEIQLIPKFSPYQYKHD 422

Query: 417 -----GKLPNLKN-YLSDDV--------KATLRIGSICNNASF----SHEHGKYLGNPTD 458
                G + + K+ Y +D++           L   ++ N A+       +  K  G+PT+
Sbjct: 423 DEEDVGMITDFKSKYYADELGPLNVSLFTQWLYTATLANIATVFRDPETQDWKAHGDPTE 482

Query: 459 IALLEVLQKFDLV----------DERP-----TTTRVDELTFNSKRKYMAV---KVDSPA 500
           IA+     + DL           DE+      T   V E  F+S  K M+     V+ P 
Sbjct: 483 IAIQVFATRMDLPRRVLTGEDNDDEKNIHNDITFEHVAEYPFDSSVKRMSAIYKNVEEP- 541

Query: 501 NSGKHIIYVKGAFERILERSASFIGGA-GKVEKLSDSHKSLINDCAKSLASEGLRTLAFA 559
            +  + ++ KGAFER+L+   S+     G  + L++     +     +L+SEGLR LAFA
Sbjct: 542 KAPIYEVFTKGAFERVLQCCNSWYTTPDGSPQPLTEEDLETVQKNVDTLSSEGLRVLAFA 601

Query: 560 -------QLECSTNKPMN--DSTIQNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMI 610
                  Q   + +K +   D    NLTF+GL+G+ DPPR     A+++    G++V M+
Sbjct: 602 KKTFNESQFTINKDKLLKERDFVENNLTFLGLVGIYDPPRRESLAAVKKCHLAGINVHML 661

Query: 611 TGDAENTAVNIARQIGI----------PVINPEISVLTGDRLDQMTDDQLAGVIDHVNIF 660
           TGD   TA +IA+++GI           V+N    V+T    D ++D ++  +     + 
Sbjct: 662 TGDFPGTAKSIAQEVGILPHNLYHYPKEVVN--FMVMTATDFDALSDKEIDELPVLPLVI 719

Query: 661 ARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVL 720
           AR  P+ K+ ++ AL +R    AMTGDGVND+P+LK+A++G+AMG  G+DVAK+ASD+VL
Sbjct: 720 ARCAPQTKVRMIEALHRRNRFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVL 779

Query: 721 TDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALSLVAIATAFKLQN-----PLNAM 775
           +DD+F++IL A+EEG+ + +NIQ F+   L+ +VA    + +   F  +      PL+ +
Sbjct: 780 SDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFLDEEGFSVFPLSPV 839

Query: 776 QILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRSDKILTPQVMRRLLINAAFIIGGTIY 835
           ++LW+ ++    PA  LG+E  + +VM KPP+     I T +V+  +L+    I    + 
Sbjct: 840 EVLWVIVVTSCFPAMGLGLEKANVDVMEKPPKDAKAVIFTWEVIVDMLVYGVIIAACCMA 899

Query: 836 VFIKEM--TEDGQV-------------------TARDTTMTFTCFVF----FDMFSALAC 870
            F+  +  T DG +                    A   TMT+   +      DM  +   
Sbjct: 900 CFVTVIYGTGDGNLGRGCNNGFDDSCRLVFKGRAAAFATMTWCALILAWEVVDMRRSFFM 959

Query: 871 RHATKSIFEIGIFNNKMFNYAVGFSLLGQLCA----IYIP 906
            +         +F +   N  + +S++G  C+    +YIP
Sbjct: 960 MNPETETPYTQVFKDVWSNQFLFWSIVGGFCSVFPVVYIP 999

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
            (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score =  348 bits (894), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 291/1000 (29%), Positives = 482/1000 (48%), Gaps = 150/1000 (15%)

Query: 43   EYCTMTVDETLRQLNTDSAKGLCDQQQVRASEQEWGTNEVTVDGEDPVWKR-FMSTFVED 101
            ++  +   E  R L TD  +GL   ++ RA  +  G N  T+  E+ +  R  +   + +
Sbjct: 20   DFHALPAHEVARLLGTDLRRGLT-AEEARARLEVVGDN--TLGEEEGINVRAILLKQMCN 76

Query: 102  PLILLLIGSAVLSFLMGNIDDAVSITLAVVIVVSVGFVQEYRSEKSLEALHKLVPASCHL 161
             +IL+LI S V++  + +      I   V + VS+G  QEY + K++ +L  L   S  +
Sbjct: 77   AMILVLIISMVIALAIKDWISGGVIAFVVALNVSIGAYQEYNACKTMNSLKDLSTPSARV 136

Query: 162  IRFGAETHVLASCLVPGDLVYFKVGDRIPADVRIIESTDLSLDESTLTGETEPVHKSCTP 221
            IR G +  + ++ +VPGD+V  +VGD +PAD+R++E+ +L  DE+ LTGE  PV K    
Sbjct: 137  IRNGEDVVMASAQVVPGDIVQVRVGDTVPADLRLVEALNLETDEALLTGEALPVAKDPAA 196

Query: 222  VNSATYSDVPGGIIPIGERTSIAYMGTLVREGHGKGIVVATGKHTMFGAVFEMMN----- 276
            V             P+G+R ++A+  + V +G   GIVV TG  +  G + E +      
Sbjct: 197  VFEQD--------TPVGDRLNLAFASSTVSKGRATGIVVRTGLRSEIGKIAESLQGKQSL 248

Query: 277  -SIEKPKTPLQMAMDT----------------LRRDLSYVRFVLSGI--IFLLGVIQGRS 317
             S ++ K+ LQ  + T                L R L+ +  +L  I  +F L V+  + 
Sbjct: 249  ISRDENKSGLQNTVLTVKASVGSFLGTNVGTPLHRKLAKLALILFAIAVLFALIVMATQK 308

Query: 318  WL---EMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRLPSVETLGSVNVI 374
            ++   E+   ++ +A++ IP  L +++T+T++ G   M+ R  IVRRL S+E LG+VN I
Sbjct: 309  FIVNREVAIYAICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGAVNDI 368

Query: 375  CSDKTGTLTANHMTASKIWC--LGSMA-NKNNV--------LSL---------------- 407
            CSDKTGTLT   M   ++W    G++  N++NV        +SL                
Sbjct: 369  CSDKTGTLTQGKMILKQLWVPEFGTVVVNRSNVPFDPTVGDVSLIPRFSPWEYQHDEEED 428

Query: 408  --------EAKSSGGLPGKLPNLKNYLSDDVKATLRIGSICNNASFSHEHGKYLGNPTDI 459
                    +   S  LP  L N + + S    ATL   +     S S E   + G+PT+I
Sbjct: 429  VGIIANFKQRWQSNSLPKGL-NPRKFESWLHTATLANIATVFKDSDSKEWRAH-GDPTEI 486

Query: 460  ALLEVLQKFDLVDERPTTTRVDE-------------------LTFNSKRKYM-AVKVDSP 499
            A+     + D      TT + +E                     F+S  K M AV ++  
Sbjct: 487  AIQVFATRMDHPHHALTTEQDEEDSDSSQQNDAARIYEHAAEFPFDSSIKRMSAVYINLR 546

Query: 500  ANSGKHIIYVKGAFERILERSASFI--GGAGKVEKLSDSHKSLINDCAKSLASEGLRTLA 557
              + +H+ + KGAFER+L+    +    G G    L++    +I     +L++EGLR LA
Sbjct: 547  DKNTRHV-FTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEIIQKNVDTLSNEGLRVLA 605

Query: 558  FA-------QLECSTNKPMNDSTI--QNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVI 608
            FA       + E    +   D      +L F GL+G+ DPPR     A+++  + G++V 
Sbjct: 606  FATKTIPAEEAESLGERLTKDRDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVH 665

Query: 609  MITGDAENTAVNIARQIGI--------PVINPEISVLTGDRLDQMTDDQLAGVIDHVNIF 660
            M+TGD   TA  IA+++GI        P    +I V+T  + D +TD++L  +     + 
Sbjct: 666  MLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVDIMVMTATQFDSLTDEELDQLPVLPLVI 725

Query: 661  ARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVL 720
            AR  P+ K+ ++ AL +R    AMTGDGVND+P+LK A++G+AMG  G+DVAK+ASD+VL
Sbjct: 726  ARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVL 785

Query: 721  TDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALSLVAIATAFKLQN-----PLNAM 775
            +DD+F++IL A+EEG+ + +NIQ F+   L+ +VA    + +   F  ++     PL+ +
Sbjct: 786  SDDNFASILNAVEEGRRMSDNIQKFVLQLLAANVAQAIYLMLGLTFLDEDKLSVFPLSPV 845

Query: 776  QILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRSDKILTPQVMRRLLINAAFIIGGTIY 835
            ++LWI ++    PA  LG+E    ++M KPP      I T +V+  +++    +    + 
Sbjct: 846  EVLWIIVVTSCLPAMGLGLEKAAPDIMEKPPNDSKAGIFTWEVIVDMIVYGLVMAVCCLG 905

Query: 836  VFIKEMTEDGQ--------VTARDT--------TMTFTCFVFFDMFSALACRHATKSIFE 879
             F+  + +DG         V   D+          TF    +  +  A       +S F 
Sbjct: 906  CFVSIIYKDGHGNLGTNCNVEYSDSCKSVFSGRAATFATMTWCALILAWEVIDMRRSFFA 965

Query: 880  I-------------GIFNNKMFNYAVGFSLLGQLCAIYIP 906
            +              I++NK   ++V F        +YIP
Sbjct: 966  MKPETDTPYTQVFKDIWSNKFLFWSVIFGFTSVFPVVYIP 1005

>Kwal_47.17547
          Length = 1240

 Score =  311 bits (796), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 269/964 (27%), Positives = 444/964 (46%), Gaps = 170/964 (17%)

Query: 100  EDPLILLLIGSAVLSFLMG-------------------NID--DAVSITLAVVIVVSVGF 138
            +D +++LL  +AV+SF +G                    +D  + V+I +AV++V+ VG 
Sbjct: 107  QDRIMILLTVAAVVSFALGLYEVLGQPPEHDAEGKKITKVDWVEGVAIMIAVLVVILVGS 166

Query: 139  VQEYRSEKSLEALH-KLVPASCHLIRFGAETHVLASCLVPGDLVYFKVGDRIPADVRIIE 197
              +Y+ E     L+ K       ++R G E  +    ++ GD++  + GD +PAD  +++
Sbjct: 167  ANDYQKELQFSKLNDKKNDREVIVLRNGDEHLISIHDILVGDILSLQTGDVVPADCILVK 226

Query: 198  STDLSLDESTLTGETEPVHKSCTPVNSATYSDVPG--GIIPIG----ERTSIAYM--GTL 249
             +    DES LTGE+  + K+   V    Y  +      I IG    E+     +  G+ 
Sbjct: 227  GS-CECDESALTGESATIKKAAIDVCYEKYKQLSATDAAIDIGTPGAEKVPDPMLISGSK 285

Query: 250  VREGHGKGIVVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRRDLS------------ 297
            +  G G+ +V + G ++M G    M   +E   TPLQ  +D+L   +S            
Sbjct: 286  LLSGLGRAVVTSVGVNSMHGRTL-MALKVEAETTPLQERLDSLANSISVYGSAAALLLFF 344

Query: 298  --YVRFVLS----GIIFLLGVIQ-GRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVL 350
              ++RF+ +    G +  L   Q G  ++ +F + +++ V A+PEGLP+ VT+ LA    
Sbjct: 345  ILFMRFLANLKKGGELHDLTPAQKGSRFMNIFIVGITVIVVAVPEGLPLAVTLALAFATT 404

Query: 351  RMANRKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTASKIWCLGS------------- 397
            RMA    +VR L + ET+GS   +CSDKTGTLT N MT  K + LGS             
Sbjct: 405  RMAKDGNLVRVLRACETMGSATAVCSDKTGTLTENRMTVVKGF-LGSTFFDEAESVGPSD 463

Query: 398  --------MAN------KNNVLS--------------LEAKSSGGLPGKLPNLKNY---L 426
                    +AN      K +VL+               E K S   P   P    +    
Sbjct: 464  SETDVDLAIANECSEELKKDVLTNITLNSTAFENKENEEDKVSNENPFHKPRKSLFPWSR 523

Query: 427  SDDVKATLRIGSICNNASFSHEHGKYLGNPTDIALLEVLQK------FDLVDERPTTTRV 480
            ++  K       +  NA+       +LG+ T+ ALL   QK           + P    +
Sbjct: 524  NNKSKKPATAKELVENAAADQPKEPFLGSKTETALLAFAQKNLGMQNLHHYRDEPDCLGI 583

Query: 481  DELT----FNSKRKYMAVKVDSPANSGKHIIYVKGAFERILERSASFIGGAGKVEKLSDS 536
            +++     F S RK+  + V     +G H  Y+KGA E +L R         K+  +S  
Sbjct: 584  EKIVQIIPFESSRKWGGIVVKY--KNGLHRFYIKGAAELLLRRCMQKRASDSKLTLISQK 641

Query: 537  HKSLINDCAKSLASEGLRTLAFAQLE---CSTNKP-----------------------MN 570
                 +    +LA+E LR ++ A  +   C    P                        +
Sbjct: 642  DFDEESQTITNLAAEALRAISLAHRDYPNCPNWPPSELQDEVEPEAASPDLLFGDEVSRS 701

Query: 571  DST-------IQNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIAR 623
            DS        +  +   G++G++DP R  VR ++E+  + GV V M+TGD   TA  IA+
Sbjct: 702  DSVSEPAQELVSPMVLDGIVGIQDPLRKGVRKSVEQCQKAGVTVRMVTGDNILTATAIAK 761

Query: 624  QIGI----PVINPEISVLTGDRLDQMTDDQLAGVIDHVNIFARATPEHKLNIVRALQKRG 679
            +  I       NPE S + G R  ++++ +   ++ ++ + AR++PE K  +V  L+K G
Sbjct: 762  KCSILSEEQAENPE-SSMEGPRFRKLSNKERVRILPNLRVLARSSPEDKRILVETLKKMG 820

Query: 680  DIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIF 739
            D+VA+TGDG NDAPALKLAD+G +MG  GT+VA+EASD++L  DDFS I+ AI+ G+ + 
Sbjct: 821  DVVAVTGDGTNDAPALKLADVGFSMGIAGTEVAREASDIILMTDDFSAIVNAIKWGRCVS 880

Query: 740  NNIQSFLTFQLSTSVAA--LSLVAIATAFKLQNPLNAMQILWINILMDGPPAQSLGVEPV 797
             +I+ F+ FQL+ +V A  L+ V+   + +  + L A+Q+LW+N++MD   A +L  +  
Sbjct: 881  TSIKKFIQFQLTVNVTAVVLTFVSAVASSEEASVLTAVQLLWVNLIMDTLAALALATDKP 940

Query: 798  DHEVMRKPPRKRSD--------KILTPQVMRRLLINAAFIIGGTIYVFIKEMTEDGQVTA 849
            D  ++ + P+ R          K++  Q   +L++       G    F  + T  G    
Sbjct: 941  DENILERKPKGREAVLITVSTWKMILGQSTLQLIVTFILHFAGKQIFFPGKATITGHEQQ 1000

Query: 850  RDTTMTFTCFVFFDMFSALACRHATKSIFEIGIFNNKMFNYAVGFSLLGQLCAIYIPFFQ 909
            +   MTF  FV+   F  +  R   ++    GI N K            ++ A  + FFQ
Sbjct: 1001 QLNAMTFNAFVWLQFFKLIVTRKLDEA---DGISNVK-----------DRITASNLNFFQ 1046

Query: 910  NIFK 913
            ++F+
Sbjct: 1047 DLFR 1050

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
            cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score =  305 bits (780), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 291/1014 (28%), Positives = 468/1014 (46%), Gaps = 177/1014 (17%)

Query: 54   RQLNTDSAKGLCDQQQVR----ASEQEWGTNEVTVDGEDPVWKRFMSTFVEDPLILLLIG 109
            R+L+TD A G+   +            +G+N +        W      F +D  +LLL G
Sbjct: 29   RRLSTDLANGIATDKDAELPPLKRRDAYGSNRLPERAPKSFWALVREAF-QDRTMLLLTG 87

Query: 110  SAVLSFLMG-------------------NID--DAVSITLAVVIVVSVGFVQEYRSEKSL 148
            +AV+SF +G                    +D  + ++I +AV++VV V    +Y+ E   
Sbjct: 88   AAVVSFTLGIYEVLTQPPELDPEGNPITQVDWIEGLAIMMAVLVVVLVSAANDYQKELQF 147

Query: 149  EALH-KLVPASCHLIRFGAETHVLASCLVPGDLVYFKVGDRIPADVRIIESTDLSLDEST 207
            + L+ K       ++R  AE+ +    L+ GDL+  + GD +PAD  ++   +   DES 
Sbjct: 148  QQLNRKREDRQVVVVRDAAESLISIHNLLVGDLLKLQTGDVVPADCVLVRG-ECETDESA 206

Query: 208  LTGETEPVHKSCTPVNSA-TYSDVPGGIIPIGERTS---------------IAYMGTLVR 251
            LTGE+  + K   P+  A  Y    GG   IG+ ++               +   G+ V 
Sbjct: 207  LTGESNTIKK--LPLADALEYHSAHGGR-DIGDTSASGASGAADDSRCPDCMLISGSRVL 263

Query: 252  EGHGKGIVVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRRDLS-------------- 297
             G    IV   G +++ G     +   +   TPLQM +  L  ++S              
Sbjct: 264  SGLASAIVTNVGVNSVHGKTMASLKE-DSEDTPLQMRLSQLTDNISVYGCVAAITLFVVL 322

Query: 298  ---YVRFVL-SGIIF--LLGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLR 351
               Y+ ++L SG  +  L    +G  ++++F  ++++ V A+PEGLP+ VT+ LA    R
Sbjct: 323  FARYLSYILPSGGKYHDLPPAEKGSKFMDIFITAITVIVVAVPEGLPLAVTLALAFATTR 382

Query: 352  MANRKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTASK-------IWCLGSMANKNNV 404
            M     +VR L S ET+GS   +CSDKTGTLT N MT  +          +G+  +K+N 
Sbjct: 383  MTKDGNLVRVLRSCETMGSATAVCSDKTGTLTENIMTVVRGTLGRAGFDDIGADPSKSN- 441

Query: 405  LSLEAKSSGGLPG------------------KLPNLKNYLSDDVKATL--RIGSICNNAS 444
            L  + K S  L                    K PN  N + D     L  RI        
Sbjct: 442  LVFKKKCSDLLRTVIYDNIVLNSTAFENKDYKDPNNYNSIDDSQPRRLIRRITQTLQKKK 501

Query: 445  FSHEHG-----------KYLGNPTDIALLEV-----------LQKFDLVDER-PTT-TRV 480
               E              Y+G+ T+ ALL +           LQ F    E+ PT  T V
Sbjct: 502  PDDEENLLAHAAEGRQEPYIGSKTETALLSLARKSFGLKFGALQSFRGHPEKLPTVETIV 561

Query: 481  DELTFNSKRKYMA--VKVDS-PANSGKHI-IYVKGAFERILERSASFIGGAGK-VEKLSD 535
              + F S RK+ A  VK++S   N GK   +YVKGA E I+ ++ +      + + ++  
Sbjct: 562  QIIPFESSRKWSAIVVKLNSNKENEGKKFRLYVKGAAE-IVAKACTLKNVCNEGISEIDQ 620

Query: 536  SHKSLINDCAKSLASEGLRTLAFAQLECSTNK--------PMNDST-------------I 574
              K  I +   SLA + LR ++ A ++   N+        P N                +
Sbjct: 621  KSKDDIEEQIFSLAKDALRAISLAHMDFDVNEWPPKELADPENSHEALAVKLIDPKKPHL 680

Query: 575  QNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGI---PVIN 631
            + LT   ++G++DP R  V+ ++ +  + GV V M+TGD   TA  IAR  GI     +N
Sbjct: 681  EGLTLDAIVGIQDPLRENVKNSVAQCQKAGVTVRMVTGDNLLTAKAIARNCGILSSKSLN 740

Query: 632  PEISVLTGDRLDQMTDDQLAGVIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVND 691
                 + G    +++D +   ++  + + AR++PE K  +VRAL++ G++VA+TGDG ND
Sbjct: 741  DSACAMEGPAFRKLSDSERKRILPKLRVLARSSPEDKKILVRALKEMGEVVAVTGDGTND 800

Query: 692  APALKLADIGVAMGHMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQSFLTFQLS 751
            APALKLAD+G +MG  GT+VA+EASD++L  DDFS I+ AI+ G+ +  +I+ F+ FQL 
Sbjct: 801  APALKLADVGFSMGITGTEVAREASDIILMTDDFSAIVNAIKWGRCVAASIKKFIQFQLI 860

Query: 752  TSVAA--LSLVAIATAFKLQNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKR 809
             +V A  L+ V    +  +++ L A+Q+LW+N++MD   A +L  +  D  +M + P+ R
Sbjct: 861  VNVTAVLLTFVTSVISSDVKSVLTAVQLLWVNLIMDTLAALALATDKPDPNIMDRKPKGR 920

Query: 810  SDKILTP--------QVMRRLLINAAFIIGGTIYVFIKEMTED--GQVTARDTTMTFTCF 859
            S  ++TP        Q + +L +       G  Y F K   ED  G    +   M F  F
Sbjct: 921  STPLITPSTWKMIIGQAILQLSVTFTLYSHGAQYFFGKP-KEDLPGHEHQQINAMIFNTF 979

Query: 860  VFFDMFSALACRHATKSIFEIGIFNNKMFNYAVGFSLLGQLCAIYIPFFQNIFK 913
            V+   F+ L  R   ++    GI + +            +L A  + FFQ++F+
Sbjct: 980  VWLQWFTLLVSRKLDEA---DGIKDWRK-----------RLTASNLNFFQDLFR 1019

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
            complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score =  266 bits (679), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 269/987 (27%), Positives = 445/987 (45%), Gaps = 165/987 (16%)

Query: 38   PNASLEYCTM---TVDETLRQLNTDSAKGLC-DQQQVR--ASEQEWGTNEV---TVDGED 88
            P +   YC +   + +     L TD   GL    ++VR  A  + +G N V   T  G  
Sbjct: 37   PKSLAAYCALFGHSENGLCDALKTDKKNGLALADEEVRETARCRRFGANRVPERTARG-- 94

Query: 89   PVWKRFMSTFVEDPLILLLIGSAVLSFLMG---------NIDD------------AVSIT 127
              + R M    +D  +++L+ +AV+SF +G          +DD             ++I 
Sbjct: 95   --FLRLMWEAFKDKTMIVLMVAAVISFSLGLYEAIGQPPELDDDGTPMAQVDYVEGLAIM 152

Query: 128  LAVVIVVSVGFVQEYRSEKSLEALHKLVPASCHLIRFGAETHVLA-SCLVPGDLVYFKVG 186
             AV +VV V    +Y+ E+    L++    +  ++    + HV++   L+ GDL+  + G
Sbjct: 153  AAVAVVVLVTAANDYQKERQFARLNRKKEDTEVVVVRNGDKHVISVHDLLVGDLLSLQTG 212

Query: 187  DRIPADVRIIESTDLSLDESTLTGETEPVHKSCTPVNSATY----SDVPGGIIPIGER-- 240
            D +P D  ++E      DES +TGE++ + K    ++   Y    +D P   I   +   
Sbjct: 213  DVVPVDCILVEGK-CECDESGITGESDTIKKVSLAMSLQVYRTVAADNPSADIGSSDNGH 271

Query: 241  ----TSIAYMGTLVREGHGKGIVVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRRDL 296
                  +   G+ +  G G  +V A G H++ G +   + S E   TPLQ  ++TL  D+
Sbjct: 272  SLVPDPMLISGSKLLSGIGHAVVTAVGPHSVHGKMMLALKS-EPETTPLQERLNTLADDI 330

Query: 297  S-------YVRFVLSGIIFLLGVIQGR------------SWLEMFQISVSLAVAAIPEGL 337
            S       ++ FV+  + FL  + +GR             ++++F  +V++ V A+PEGL
Sbjct: 331  SIYGSVAAFLLFVVLFLRFLSYLPKGRLYHDLPSARKGSRFMDIFITAVTVIVVAVPEGL 390

Query: 338  PIIVTVTLALGVLRMANRKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTASKIW---- 393
            P+ VT+ LA    RM     +VR L + ET+GS   +CSDKTGTLT N M   K +    
Sbjct: 391  PLAVTLALAFATTRMTKDGNLVRVLRACETMGSATTVCSDKTGTLTQNKMVVVKGFLGSS 450

Query: 394  ----------CLGSMANK--------NNVLSLEAKSSGGLPGKL---PNLKNYLSDDVKA 432
                      C  S A +        N++L+  A +S     K    P +        + 
Sbjct: 451  HFDDISEDSNCAQSDALRQDMSQHTLNDILANIALNSTAFENKQVADPVITENPYHKPRR 510

Query: 433  TLRIGSICNNASFSHEHGK-------YLGNPTDIALLEV------LQKFDLVDERP---- 475
            +L   S  N   +             ++G+ T+ ALL +      L+    + + P    
Sbjct: 511  SLFPWSRNNKPKYPAPKDSSVQSAEFFIGSKTEAALLSLAKGSLGLESLQALRDDPHHIG 570

Query: 476  TTTRVDELTFNSKRKYMAVKVDSPANSGKHIIYVKGAFERILERSASFIGGAGKVEKLSD 535
              + V  + F S RK+  + V      G +  ++KGA E I +           V KLS 
Sbjct: 571  IASIVQMIPFESSRKWAGLVVR--LVDGNYRFFIKGASETIFKSCHYMRSSNDDVIKLSP 628

Query: 536  SHKSLINDCAKSLASEGLRTLAFAQ---------------------------------LE 562
                 I     +LAS+ LRT++ A                                  + 
Sbjct: 629  QKHGEIFGLINNLASDALRTISLAHKDFTDISSWPPAELRDASDPSTASPDLLLGDEYVP 688

Query: 563  CSTNKPMNDSTIQN----LTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTA 618
             +T++P   S I N    L   G++G+ DP R  V+ +++   Q GV V MITGD   T 
Sbjct: 689  TATDRP---SIITNNNSGLILDGVVGIHDPLRPGVKESVKNCQQSGVTVRMITGDNITTG 745

Query: 619  VNIARQIGIPVINPEIS----VLTGDRLDQMTDDQLAGVIDHVNIFARATPEHKLNIVRA 674
              IAR  GI +   E +     + G    +++  Q+      + + AR++PE K   V  
Sbjct: 746  RAIARACGI-LSESEYADHECAMEGPVFRKLSRRQMMDAAPKLKVLARSSPEDKRIFVDI 804

Query: 675  LQKRGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVLTDDDFSTILTAIEE 734
            L+K  ++VA+TGDG NDAPAL LAD+G +MG  GT VA+EASD++L  DDF++I+ AI+ 
Sbjct: 805  LKKMNEVVAVTGDGTNDAPALTLADVGFSMGISGTGVAREASDIILMTDDFTSIVNAIKW 864

Query: 735  GKGIFNNIQSFLTFQLSTSVAALSLVAI-ATAFKLQNP-LNAMQILWINILMDGPPAQSL 792
            G+ +  +I+ F+ FQL+ ++ A++L  + A     +NP L A+Q+LW+N++MD   A +L
Sbjct: 865  GRCVSLSIKKFIQFQLTVNITAVTLTCVTAVTSTEENPVLTAVQLLWVNLIMDTLAALAL 924

Query: 793  GVEPVDHEVMRKPPRKRSD--------KILTPQVMRRLLINAAFIIGGTIYVFIKEMTED 844
              +  D  ++ + P  R          K++  Q + +L+I      GG    +  ++   
Sbjct: 925  ATDKPDPHILERIPTGRDSPLIAVSTWKMILGQAVLQLIIAFVLHYGGRKLFYPHQVPFT 984

Query: 845  GQVTARDTTMTFTCFVFFDMFSALACR 871
            G+   R  T+TF  FV+   F  +  R
Sbjct: 985  GRDQKRLDTLTFNTFVWLQFFKLIVTR 1011

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
            Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 1280

 Score =  263 bits (672), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 246/869 (28%), Positives = 401/869 (46%), Gaps = 140/869 (16%)

Query: 161  LIRFGAETHVLASCLVPGDLVYFKVGDRIPADVRIIESTDLSLDESTLTGETEPVHKSCT 220
            +IR G E  +    L+ GD++  + GD +PAD  +I S     DES LTGE++ + K   
Sbjct: 243  VIRNGDEHLISIHDLLVGDVISLQTGDVVPADAVLI-SGSCECDESALTGESDTIKKVAL 301

Query: 221  PVNSATYSDV----PG---GIIPIGERTSIAYM--GTLVREGHGKGIVVATGKHTMFGAV 271
                  Y  +    P    G   +GE+     +  G+ +  G G  ++ + G++++ G +
Sbjct: 302  KPALEKYKQIFEKDPTIDIGSHGVGEKVPDPLLISGSKLLSGIGNAVITSVGENSVNGRI 361

Query: 272  FEMMNSIEKPKTPLQMAMDTLRRDLS-------YVRFVLSGIIFLLGVIQGRSW------ 318
              M    E   TPLQ  +  L  ++S        V F++  I FL  +  G+ +      
Sbjct: 362  M-MALKTESESTPLQERLSNLADNISIYGCMAALVLFIILFIRFLTYLPNGKKYHDLPPA 420

Query: 319  ------LEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRLPSVETLGSVN 372
                  + +F  +V++ V A+PEGLP+ VT+ LA    RM     +VR L + ET+GS  
Sbjct: 421  QKGSKFMNIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRACETMGSAT 480

Query: 373  VICSDKTGTLTANHMTASKIWC--LG-----SMANKN-----------------NVLSLE 408
             ICSDKTGTLT N MT  K +   LG        NK                  ++LS  
Sbjct: 481  AICSDKTGTLTENRMTVVKGFAGNLGFDDTTHAENKEIKSAVVLRSNCDASLLTDILSNI 540

Query: 409  AKSSGGLPGKLPNLKNYLSDD-----VKATLRIGSICNNAS------FSHEHGKYLGNPT 457
            + +S     K    K+   D+      + +L   S  N  S            ++LG+ T
Sbjct: 541  SLNSTAFENKESQHKDKDVDENPYHKSRKSLFPWSRNNRTSQLIADAMKENDEQFLGSKT 600

Query: 458  DIALLEVLQK------FDLVDERPTTTRVDELT----FNSKRKYMAVKVDSPANSGKHII 507
            + ALL   QK         +  +P+   +D++     F S RK+ A+ V    N G +  
Sbjct: 601  ETALLAFAQKSLGMKDVHKLRTKPSDLGIDKVVQVIPFESSRKWGAIAVQLADNKG-YRF 659

Query: 508  YVKGAFERILERSASFIGGAGKV----EKLSDSHKSLINDCAKSLASEGLRTLAFAQLEC 563
            Y KGA E +L+  ++       +    + L D     I D    +AS  LRT++    + 
Sbjct: 660  YAKGAAEILLKVCSNQRNSDNSIVPMNQDLYDESFKKIQD----MASHALRTISLVHRDF 715

Query: 564  STNKPMN--DST---------------------IQNLTFVGLIGMKDPPRSTVRPAIEEL 600
                P    DST                      + +T   ++G++DP R  V+ ++E+ 
Sbjct: 716  KEWPPKEFADSTDPSIASPDLVMGHELDHKNLSSEGMTLDAMVGLQDPLREGVKESVEQC 775

Query: 601  LQGGVHVIMITGDAENTAVNIARQIGI----PVINPEISVLTGDRLDQMTDDQLAGVIDH 656
             + GV V M+TGD   TA  I+R   I       +PE + + G    ++   ++  VI  
Sbjct: 776  QRAGVTVRMVTGDNILTARAISRNCNILSEEGYNDPECA-MEGPTFRKLPYKKMLRVIPK 834

Query: 657  VNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEAS 716
            + + AR++PE K  +V  L+K G++VA+TGDG NDAPALKLAD+G +MG  GT+VA+EAS
Sbjct: 835  LRVLARSSPEDKRILVETLKKMGEVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREAS 894

Query: 717  DMVLTDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAA--LSLVAIATAFKLQNPLNA 774
            D++L  DDF+ I+ AI+ G+ +  +I+ F+ FQL+ ++ A  L+ V+   + +  + L A
Sbjct: 895  DIILMTDDFTAIVNAIKWGRCVSVSIKKFIQFQLTVNITAVILTFVSAVASAEETSVLTA 954

Query: 775  MQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRSDKILTPQVMRRLLINAA------F 828
            +Q+LW+N++MD   A +L  +  D  ++ + P+ R   ++     + +L  AA      F
Sbjct: 955  VQLLWVNLIMDTLAALALATDKPDEFILDRKPKGRDAPLIAVSTWKMILGQAALQLTVTF 1014

Query: 829  II---GGTIYVFIKEMTEDGQVTARDTTMTFTCFVFFDMFSALACRHATKSIFEIGIFNN 885
            ++   G  I+ F  + T       +   MTF  FV+   F  +  R              
Sbjct: 1015 VLHFRGKEIF-FPNKRTITAHEQEQLNAMTFNTFVWLQFFKLIVTRK------------- 1060

Query: 886  KMFNYAVGFS-LLGQLCAIYIPFFQNIFK 913
               + A G S    +L A  + FFQ++F+
Sbjct: 1061 --LDEADGISKFKDRLTANNLNFFQHLFR 1087

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score =  226 bits (576), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 201/735 (27%), Positives = 339/735 (46%), Gaps = 89/735 (12%)

Query: 56  LNTDSAKGLCDQQQVRASEQEWGTNEVTVDGEDPVWKRFMSTFVEDPLILLLIGSAVLSF 115
           L TD + GL   +  R   +++G N+++   E  + K  M  F   P+  ++  +A+L+ 
Sbjct: 61  LQTDPSYGLTSDEVSR-RRKKYGLNQMSEANESMILKFVM--FFVGPIQFVMEAAAILAA 117

Query: 116 LMGNIDDAVSITLAVVIVVSVGFVQEYRSEKSLEALHKLVPASCHLIRFGAETHVLASCL 175
            +    D   I   +++  +VGF+QE+++   +E L K +  S  +IR G+   + A+ +
Sbjct: 118 GLEEWIDFGIICALLLLNAAVGFIQEFQAGSIVEELKKTLANSAVVIRDGSLVEIPANEV 177

Query: 176 VPGDLVYFKVGDRIPADVRII-ESTDLSLDESTLTGETEPVHKSCTPVNSATYSDVPGGI 234
           VPGD++  + G  IPAD RI+ E   + +D+S +TGE+  V K       AT+S      
Sbjct: 178 VPGDILQLEDGVIIPADGRIVTEGCFVQIDQSAITGESLAVDKR---YGDATFSS----- 229

Query: 235 IPIGERTSIAYMGTLVREGHGKGIVVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRR 294
                        + V+ G G  IV ATG  T  G    ++N            ++ +  
Sbjct: 230 -------------STVKRGEGFMIVTATGDSTFVGRAAALVNKASAGSGHFTEVLNGIGT 276

Query: 295 DLSYVRFVLSGIIFLLGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAN 354
            L  +  +   ++++    +    + + + ++++ V  +P GLP +VT T+A+G   +A 
Sbjct: 277 ILLILVILTLLVVYVACFYRSIDIVTILRYTLAITVVGVPVGLPAVVTTTMAVGAAYLAK 336

Query: 355 RKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTASKIWCLGSMANKNNVLSLEAKSSGG 414
           +KAIV++L ++E+L  V ++CSDKTGTLT N +         S+     V  +EA     
Sbjct: 337 KKAIVQKLSAIESLAGVEILCSDKTGTLTKNKL---------SLHEPYTVEGVEA----- 382

Query: 415 LPGKLPNLKNYLSDDVKATLRIGSICNNASFSHEHGKYLGNPTDIALLEVLQKFDLVDER 474
                        DD+  T         A  +    K   +  D A L+ L  +      
Sbjct: 383 -------------DDLMLT---------ACLAASRKKKGLDAIDKAFLKSLINYPRAKAA 420

Query: 475 PTTTRVDEL-TFNSKRKYMAVKVDSPANSGKHIIYVKGAFERILERSASFIGGAGKVEK- 532
            T  +V E   F+   K +   V+SP   G+ I+ VKGA   +L+           VE+ 
Sbjct: 421 LTKYKVLEFHPFDPVSKKVTAIVESP--EGERIVCVKGAPLFVLK----------TVEEN 468

Query: 533 --LSDSHKSLINDCAKSLASEGLRTLAFAQLECSTNKPMNDSTIQNLTFVGLIGMKDPPR 590
             + +  K    +    LAS G R L  A+               +   +G++   DPPR
Sbjct: 469 HLIPEDVKENYENKVAELASRGYRALGVARKRGEG----------HWEILGVMPCMDPPR 518

Query: 591 STVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVINPEISVLTGDRLDQMTDDQL 650
                 + E    G+ V M+TGDA   A    RQ+G+         L       M   +L
Sbjct: 519 DDTAQTVNEARHLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSEL 578

Query: 651 AGVIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAMGHMGTD 710
           A  +++ + FA   P+HK N+V  LQ+RG +VAMTGDGVNDAP+LK AD G+A+    TD
Sbjct: 579 ADFVENADGFAEVFPQHKYNVVEILQQRGYLVAMTGDGVNDAPSLKKADTGIAV-EGATD 637

Query: 711 VAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALSLVAIATAFKLQN 770
            A+ A+D+V      S I+ A++  + IF+ + S++ ++++ S+     + +  A  L  
Sbjct: 638 AARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEIFLGLWIAI-LNQ 696

Query: 771 PLNAMQILWINILMD 785
            LN   +++I I  D
Sbjct: 697 SLNVHLVVFIAIFAD 711

>Scas_688.1
          Length = 913

 Score =  225 bits (574), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 202/738 (27%), Positives = 347/738 (47%), Gaps = 95/738 (12%)

Query: 56  LNTDSAKGLCDQQQVRASEQEWGTNEVTVDGEDPVWKRFMSTFVEDPLILLLIGSAVLSF 115
           L TD A GL   +  R   +++G N+++ + E  V K  M  F   P+  ++  +A+L+ 
Sbjct: 75  LQTDPAYGLSSDEVAR-RRKKYGLNQMSEENESLVVKFIM--FFVGPIQFVMEAAAILAA 131

Query: 116 LMGNIDDAVSITLAVVIVVSVGFVQEYRSEKSLEALHKLVPASCHLIRFGAETHVLASCL 175
            + +  D   I   +++   VGFVQE+++   +E L K +  S  +IR G    V A+ +
Sbjct: 132 GLSDWVDFGVICGLLLLNAGVGFVQEFQAGSIVEELKKTLANSAIVIRDGQLVEVPANEV 191

Query: 176 VPGDLVYFKVGDRIPADVRII-ESTDLSLDESTLTGETEPVHKSCTPVNSATYSDVPGGI 234
           VPGD++  + G  IPAD RI+ E   + +D+S +TGE+    K                 
Sbjct: 192 VPGDILQLEDGVIIPADGRIVTEDCFVQIDQSAITGESLAADKH---------------- 235

Query: 235 IPIGERTSIAYMGTLVREGHGKGIVVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRR 294
              G++T   +  + V+ G    ++ ATG +T  G    ++N     +      ++ +  
Sbjct: 236 --YGDQT---FSSSTVKRGEAFMVITATGDNTFVGRAAALVNKASGGQGHFTEVLNGIGI 290

Query: 295 DLSYVRFVLSGIIFLLGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAN 354
            L  +  V   +++     +    + + + ++ + +  +P GLP +VT T+A+G   +A 
Sbjct: 291 ILLVLVIVTLLLVWTASFYRTDGIVRILRYTLGITIVGVPVGLPAVVTTTMAVGAAYLAK 350

Query: 355 RKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTASKIWCLGSMANKNNVLSLEAKSSGG 414
           ++AIV++L ++E+L  V ++CSDKTGTLT N ++  + + +  ++               
Sbjct: 351 KQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVS--------------- 395

Query: 415 LPGKLPNLKNYLSDDVKATLRIGSICNNASFSHEHGKYLGNPTDIALLEVLQKFDLVDER 474
                       +DD+  T         A  +    K   +  D A L+ L ++      
Sbjct: 396 ------------ADDLMLT---------ACLAASRKKKGLDAIDKAFLKSLAQYPAAKNA 434

Query: 475 PTTTRVDEL-TFNSKRKYMAVKVDSPANSGKHIIYVKGAFERILERSASFIGGAGKVEK- 532
            T  +V E   F+   K +   V+SP   G+ II VKGA   +L+           VE+ 
Sbjct: 435 LTKYKVLEFHPFDPVSKKVTAVVESP--EGERIICVKGAPLFVLK----------TVEED 482

Query: 533 ---LSDSHKSLINDCAKSLASEGLRTLAFAQLECSTNKPMNDSTIQNLTFVGLIGMKDPP 589
                D H++  N  A+ LAS G R L  A+               +   +G++   DPP
Sbjct: 483 HPIPEDIHENYENKVAE-LASRGFRALGVARKRGEG----------HWEILGVMPCMDPP 531

Query: 590 RSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIP--VINPEISVLTGDRLDQMTD 647
           R      + E  + G+ V M+TGDA   A    RQ+G+   V N E   L+G     M  
Sbjct: 532 RDDTGETVAEARRLGLRVKMLTGDAVGIAKETCRQLGLGTNVYNAERLGLSGG--GDMPG 589

Query: 648 DQLAGVIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAMGHM 707
            +LA  +++ + FA   P+ K  +V  LQ RG +VAMTGDGVNDAP+LK AD G+A+   
Sbjct: 590 SELADFVENADGFAEVFPQDKYRVVEILQTRGYLVAMTGDGVNDAPSLKKADTGIAV-EG 648

Query: 708 GTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALSLVAIATAFK 767
            TD A+ A+D+V      S I+ A++  + IF+ + S++ ++++ S+     + +  A  
Sbjct: 649 ATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSIHLEIFLGLWIAI- 707

Query: 768 LQNPLNAMQILWINILMD 785
           L N L+   I++I I  D
Sbjct: 708 LNNSLDINLIVFIAIFAD 725

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score =  222 bits (565), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 196/736 (26%), Positives = 342/736 (46%), Gaps = 91/736 (12%)

Query: 56  LNTDSAKGLCDQQQVRASEQEWGTNEVTVDGEDPVWKRFMSTFVEDPLILLLIGSAVLSF 115
           L TD + GL    +V    +++G N++  + E  V K  M  F   P+  ++  +A+L+ 
Sbjct: 80  LQTDPSYGLT-SDEVLKRRKKYGLNQMADEKESLVVKFVM--FFVGPIQFVMEAAAILAA 136

Query: 116 LMGNIDDAVSITLAVVIVVSVGFVQEYRSEKSLEALHKLVPASCHLIRFGAETHVLASCL 175
            + +  D   I   +++   VGFVQE+++   ++ L K +  +  +IR G    + A+ +
Sbjct: 137 GLSDWVDFGVICGLLMLNAGVGFVQEFQAGSIVDELKKTLANTAVVIRDGQLVEIPANEV 196

Query: 176 VPGDLVYFKVGDRIPADVRII-ESTDLSLDESTLTGETEPVHKSCTPVNSATYSDVPGGI 234
           VPGD++  + G  IP D RI+ E   L +D+S +TGE+  V K                 
Sbjct: 197 VPGDILQLEDGTVIPTDGRIVTEDCFLQIDQSAITGESLAVDKH---------------- 240

Query: 235 IPIGERTSIAYMGTLVREGHGKGIVVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRR 294
              G++T   +  + V+ G G  +V ATG +T  G    ++N     +      ++ +  
Sbjct: 241 --YGDQT---FSSSTVKRGEGFMVVTATGDNTFVGRAAALVNKAAGGQGHFTEVLNGIGI 295

Query: 295 DLSYVRFVLSGIIFLLGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAN 354
            L  +      +++     +    + + + ++ + +  +P GLP +VT T+A+G   +A 
Sbjct: 296 ILLVLVIATLLLVWTACFYRTNGIVRILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAK 355

Query: 355 RKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTASKIWCLGSMANKNNVLSLEAKSSGG 414
           ++AIV++L ++E+L  V ++CSDKTGTLT N ++  + + +  ++               
Sbjct: 356 KQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVS--------------- 400

Query: 415 LPGKLPNLKNYLSDDVKATLRIGSICNNASFSHEHGKYLGNPTDIALLEVLQKFDLVDER 474
                        DD+  T         A  +    K   +  D A L+ L+++    + 
Sbjct: 401 ------------PDDLMLT---------ACLAASRKKKGLDAIDKAFLKSLKQYPKAKDA 439

Query: 475 PTTTRVDEL-TFNSKRKYMAVKVDSPANSGKHIIYVKGAFERILERSASFIGGAGKVEK- 532
            T  +V E   F+   K +   V+SP   G+ I+ VKGA   +L+           VE+ 
Sbjct: 440 LTKYKVLEFHPFDPVSKKVTAVVESP--EGERIVCVKGAPLFVLK----------TVEED 487

Query: 533 ---LSDSHKSLINDCAKSLASEGLRTLAFAQLECSTNKPMNDSTIQNLTFVGLIGMKDPP 589
                D H++  N  A+ LAS G R L  A+     +             +G++   DPP
Sbjct: 488 HPIPEDVHENYENKVAE-LASRGFRALGVARKRGEGH----------WEILGVMPCMDPP 536

Query: 590 RSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVINPEISVLTGDRLDQMTDDQ 649
           R      + E    G+ V M+TGDA   A    RQ+G+         L       M   +
Sbjct: 537 RDDTAQTVSEARHLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSE 596

Query: 650 LAGVIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAMGHMGT 709
           LA  +++ + FA   P+HK  +V  LQ RG +VAMTGDGVNDAP+LK AD G+A+    T
Sbjct: 597 LADFVENADGFAEVFPQHKYRVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAV-EGAT 655

Query: 710 DVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALSLVAIATAFKLQ 769
           D A+ A+D+V      S I+ A++  + IF+ + S++ ++++ S+     + +  A  L 
Sbjct: 656 DAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEIFLGLWIAI-LD 714

Query: 770 NPLNAMQILWINILMD 785
           N L+   I++I I  D
Sbjct: 715 NSLDIDLIVFIAIFAD 730

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score =  218 bits (555), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 199/750 (26%), Positives = 341/750 (45%), Gaps = 115/750 (15%)

Query: 54  RQLNTDSAKGLCDQQQVRASEQEWGTNEVTVDGEDPVWKRFMSTFVEDPLILLLIGSAVL 113
           + L+TD A GL   +  R   +++G N++  + E  + K  M  F   P+  ++  +A+L
Sbjct: 107 KDLSTDPAYGLTSDEVAR-RRKKYGLNQMAEENESLIVKFLM--FFVGPIQFVMEAAAIL 163

Query: 114 SFLMGNIDDAVSITLAVVIVVSVGFVQEYRSEKSLEALHKLVPASCHLIRFGAETHVLAS 173
           +  + +  D   I   +++  SVGF+QE+++   ++ L K +  +  +IR G    + A+
Sbjct: 164 AAGLSDWVDVGVICALLLLNASVGFIQEFQAGSIVDELKKTLANTATVIRDGQLIEIPAN 223

Query: 174 CLVPGDLVYFKVGDRIPADVRII-ESTDLSLDESTLTGETEPVHKSCTPVNSATYSDVPG 232
            +VPG+++  + G   PAD RI+ E   L +D+S +TGE+    K         Y D   
Sbjct: 224 EVVPGEILQLESGTIAPADGRIVTEDCFLQIDQSAITGESLAAEKH--------YGDE-- 273

Query: 233 GIIPIGERTSIAYMGTLVREGHGKGIVVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTL 292
                       +  + V+ G    +V ATG +T  G    ++      +      ++ +
Sbjct: 274 -----------VFSSSTVKTGEAFMVVTATGDNTFVGRAAALVGQASGVEGHFTEVLNGI 322

Query: 293 RRDLSYVRFVLSGIIFLLGVIQGR--SWLEMF----------QISVSLAVAAIPEGLPII 340
                       GII L+ VI      W   F          + ++ + +  +P GLP +
Sbjct: 323 ------------GIILLVLVIATLLLVWTACFYRTVGIVSILRYTLGITIIGVPVGLPAV 370

Query: 341 VTVTLALGVLRMANRKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTASKIWCLGSMAN 400
           VT T+A+G   +A ++AIV++L ++E+L  V ++CSDKTGTLT N ++  + + +  ++ 
Sbjct: 371 VTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVS- 429

Query: 401 KNNVLSLEAKSSGGLPGKLPNLKNYLSDDVKATLRIGSICNNASFSHEHGKYLGNPTDIA 460
                                      DD+  T         A  +    K   +  D A
Sbjct: 430 --------------------------PDDLMLT---------ACLAASRKKKGLDAIDKA 454

Query: 461 LLEVLQKFDLVDERPTTTRVDEL-TFNSKRKYMAVKVDSPANSGKHIIYVKGAFERILER 519
            L+ L ++    +  T  +V E   F+   K +   V+SP   G+ I+ VKGA   +L+ 
Sbjct: 455 FLKSLIEYPKAKDALTKYKVLEFHPFDPVSKKVTAVVESP--EGERIVCVKGAPLFVLK- 511

Query: 520 SASFIGGAGKVEK----LSDSHKSLINDCAKSLASEGLRTLAFAQLECSTNKPMNDSTIQ 575
                     VE+      D H++  N  A+ LAS G R L  A+     +  +      
Sbjct: 512 ---------TVEEDHPIPEDVHENYENKVAE-LASRGFRALGVARKRGEGHWEI------ 555

Query: 576 NLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVINPEIS 635
               +G++   DPPR      I E    G+ + M+TGDA   A    RQ+G+        
Sbjct: 556 ----LGVMPCMDPPRDDTAQTINEARNLGLRIKMLTGDAVGIAKETCRQLGLGTNIYNAE 611

Query: 636 VLTGDRLDQMTDDQLAGVIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPAL 695
            L       M   +LA  +++ + FA   P+HK  +V  LQ RG +VAMTGDGVNDAP+L
Sbjct: 612 RLGLGGGGDMPGSELADFVENADGFAEVFPQHKYRVVEILQNRGYLVAMTGDGVNDAPSL 671

Query: 696 KLADIGVAMGHMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVA 755
           K AD G+A+    TD A+ A+D+V      S I+ A++  + IF+ + S++ ++++ S+ 
Sbjct: 672 KKADTGIAV-EGATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLH 730

Query: 756 ALSLVAIATAFKLQNPLNAMQILWINILMD 785
               + +  A  L N L+   I++I I  D
Sbjct: 731 LEIFLGLWIAI-LNNSLDINLIVFIAIFAD 759

>Scas_710.41
          Length = 904

 Score =  217 bits (553), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 197/737 (26%), Positives = 344/737 (46%), Gaps = 91/737 (12%)

Query: 55  QLNTDSAKGLCDQQQVRASEQEWGTNEVTVDGEDPVWKRFMSTFVEDPLILLLIGSAVLS 114
           QL TD   GL   + VR   +++G N++  + E+ + K F+  FV  P+  ++  +A+L+
Sbjct: 66  QLKTDPGIGLTTDEVVR-RRKKYGLNQMKEENENFIVK-FLMYFV-GPIQFVMEAAAILA 122

Query: 115 FLMGNIDDAVSITLAVVIVVSVGFVQEYRSEKSLEALHKLVPASCHLIRFGAETHVLASC 174
             + +  D   I   +++  SVGF+QE+++   +E L K +  +  +IR G    + A+ 
Sbjct: 123 AGLSDWVDFGVICGLLMLNASVGFIQEFQAGSIVEELKKTLANTARVIRDGTLQEIPANE 182

Query: 175 LVPGDLVYFKVGDRIPADVRII-ESTDLSLDESTLTGETEPVHKSCTPVNSATYSDVPGG 233
           +VPGD++    G  IPAD R++ E+  L +D+S +TGE+  V K+        Y DV   
Sbjct: 183 IVPGDILELDEGTIIPADGRLVTENRFLQVDQSAITGESLAVDKN--------YGDV--- 231

Query: 234 IIPIGERTSIAYMGTLVREGHGKGIVVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLR 293
                      +  + V+ G    +V ATG +T  G    ++      +      ++ + 
Sbjct: 232 ----------TFSSSTVKTGTSVMVVTATGDNTFVGRAAALVGEASGGQGHFTDILNDIG 281

Query: 294 RDLSYVRFVLSGIIFLLGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMA 353
             L  +  +   +++     +    + + + ++ + +  +P GLP +VT T+A+G   +A
Sbjct: 282 TILLVLVIITLLLVWTACFYRTDGIVMILRFTLGITIIGVPVGLPAVVTTTMAVGAAYLA 341

Query: 354 NRKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTASKIWCLGSMANKNNVLSLEAKSSG 413
            ++AIV++L ++E+L  V ++CSDKTGTLT N ++  + + +  ++              
Sbjct: 342 KKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVS-------------- 387

Query: 414 GLPGKLPNLKNYLSDDVKATLRIGSICNNASFSHEHGKYLGNPTDIALLEVLQKF-DLVD 472
                        +DD+  T         A  +    K   +  D A L+ L ++   ++
Sbjct: 388 -------------ADDLMLT---------ACLAATRKKKGLDAIDRAFLKSLNQYPKAMN 425

Query: 473 ERPTTTRVDELTFNSKRKYMAVKVDSPANSGKHIIYVKGAFERILERSASFIGGAGKVEK 532
             P    ++   F+   K +   V SP   G+ I  VKGA   +L+           VE+
Sbjct: 426 ALPKYKILEFHPFDPVSKKVTAVVKSP--EGETITCVKGAPLFVLK----------TVEE 473

Query: 533 ----LSDSHKSLINDCAKSLASEGLRTLAFAQLECSTNKPMNDSTIQNLTFVGLIGMKDP 588
                 D H++  N  A+ LAS G R+L  A+                   +G++   DP
Sbjct: 474 DHPVPEDVHENYENKVAE-LASRGFRSLGVARKRGEG----------YWEILGVMPCMDP 522

Query: 589 PRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVINPEISVLTGDRLDQMTDD 648
           PR      I E    G+ V M+TGDA   A   +RQ+G+ V       L       M   
Sbjct: 523 PRDDTARTIAEARTLGLRVKMLTGDAVGIAKETSRQLGLGVNIYNAEKLGLGGGGDMPGS 582

Query: 649 QLAGVIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAMGHMG 708
           +LA  +++ + FA   P+HK  +V  LQ RG +VAMTGDGVNDAP+LK AD G+A+    
Sbjct: 583 ELADFVENADGFAEVFPQHKYKVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAV-EGA 641

Query: 709 TDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALSLVAIATAFKL 768
           TD A+ A+D+V      S I+  ++  + IF+ + S++ ++++ S+       +  A  L
Sbjct: 642 TDAARSAADIVFLAPGLSAIIDGLKTSRQIFHRMYSYVVYRIALSLHLEIFFGLWIAI-L 700

Query: 769 QNPLNAMQILWINILMD 785
              LN   I++I I  D
Sbjct: 701 NRSLNIELIVFIAIFAD 717

>Kwal_47.17522
          Length = 899

 Score =  217 bits (552), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 201/736 (27%), Positives = 339/736 (46%), Gaps = 91/736 (12%)

Query: 56  LNTDSAKGLCDQQQVRASEQEWGTNEVTVDGEDPVWKRFMSTFVEDPLILLLIGSAVLSF 115
           L TD + GL    +V    +++G N++  + E  V K  M  F   P+  ++  +A+L+ 
Sbjct: 61  LQTDPSYGLT-SDEVTKRRKKYGLNQMAEESESLVVKFLM--FFIGPIQFVMEAAAILAA 117

Query: 116 LMGNIDDAVSITLAVVIVVSVGFVQEYRSEKSLEALHKLVPASCHLIRFGAETHVLASCL 175
            + +  D   I   + +   VGF+QEY++   ++ L K +  S  ++R G    + A+ +
Sbjct: 118 GLEDWVDFGVILGLLFLNAGVGFIQEYQAGSIVDELKKSLANSAVVVRDGNLVEIPANEV 177

Query: 176 VPGDLVYFKVGDRIPADVRII-ESTDLSLDESTLTGETEPVHKSCTPVNSATYSDVPGGI 234
           VPGD++  + G  I AD R++ E   L +D+S +TGE+  V K         Y D     
Sbjct: 178 VPGDIMQLEDGVVICADGRLVTEECFLQIDQSAITGESLAVDKH--------YGDT---- 225

Query: 235 IPIGERTSIAYMGTLVREGHGKGIVVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRR 294
                     +  + V+ G G  IV ATG +T  G    ++N     +      ++ +  
Sbjct: 226 ---------TFSSSTVKRGEGFMIVTATGDNTFVGRAAALVNQAAGDQGHFTEVLNGIGT 276

Query: 295 DLSYVRFVLSGIIFLLGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAN 354
            L  +  V   +++     +    + + + ++ + +  +P GLP +VT T+A+G   +A 
Sbjct: 277 ILLVLVIVTLLLVWTACFYRTDRIVRILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAK 336

Query: 355 RKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTASKIWCLGSMANKNNVLSLEAKSSGG 414
           ++AIV++L ++E+L  V ++CSDKTGTLT N +         S+     V  +E      
Sbjct: 337 KQAIVQKLSAIESLAGVEILCSDKTGTLTKNKL---------SLHEPYTVEGVE------ 381

Query: 415 LPGKLPNLKNYLSDDVKATLRIGSICNNASFSHEHGKYLGNPTDIALLEVLQKFDLVDER 474
                        DD+  T         A  +    K   +  D A L+ L ++      
Sbjct: 382 ------------PDDLMLT---------ACLAASRKKKGLDAIDKAFLKSLIQYPRAKNA 420

Query: 475 PTTTRV-DELTFNSKRKYMAVKVDSPANSGKHIIYVKGAFERILERSASFIGGAGKVEK- 532
            T  +V D   F+   K +   V+SP   G+ II VKGA   +L+           VE+ 
Sbjct: 421 LTKYKVLDFHPFDPVSKKVTAVVESP--EGERIICVKGAPLFVLK----------TVEED 468

Query: 533 ---LSDSHKSLINDCAKSLASEGLRTLAFAQLECSTNKPMNDSTIQNLTFVGLIGMKDPP 589
                D H++  N  A+ LAS G R L  A+               +   +G++   DPP
Sbjct: 469 HPIPEDVHENYENKVAE-LASRGFRALGVARKRGEG----------HWEILGVMPCMDPP 517

Query: 590 RSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVINPEISVLTGDRLDQMTDDQ 649
           R      + E  + G+ V M+TGDA   A    RQ+G+         L       M   +
Sbjct: 518 RDDTAQTVHEARRLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSE 577

Query: 650 LAGVIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAMGHMGT 709
           LA  +++ + FA   P+HK ++V  LQ+RG +VAMTGDGVNDAP+LK AD G+A+    T
Sbjct: 578 LADFVENADGFAEVFPQHKYSVVEILQQRGYLVAMTGDGVNDAPSLKKADTGIAV-EGAT 636

Query: 710 DVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALSLVAIATAFKLQ 769
           D A+ A+D+V      S I+ A++  + IF+ + S++ ++++ S+     + +  A  L 
Sbjct: 637 DAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEIFLGLWIAI-LN 695

Query: 770 NPLNAMQILWINILMD 785
             LN   I++I I  D
Sbjct: 696 QSLNIDLIVFIAIFAD 711

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score =  213 bits (542), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 196/735 (26%), Positives = 348/735 (47%), Gaps = 89/735 (12%)

Query: 56  LNTDSAKGLCDQQQVRASEQEWGTNEVTVDGEDPVWKRFMSTFVEDPLILLLIGSAVLSF 115
           L TD + GL    +V    +++G N+++ + E+ ++ +F+  F+  P+  ++  +A+L+ 
Sbjct: 61  LQTDPSYGLT-SDEVTKRRKKYGLNQMSEETEN-LFVKFLMFFI-GPIQFVMEAAAILAA 117

Query: 116 LMGNIDDAVSITLAVVIVVSVGFVQEYRSEKSLEALHKLVPASCHLIRFGAETHVLASCL 175
            + +  D   I   + +  +VGF+QEY++   ++ L K +  S  +IR G    V ++ +
Sbjct: 118 GLEDWVDFGVICGLLFLNAAVGFIQEYQAGSIVDELKKTLANSAVVIRDGNLVEVPSNEV 177

Query: 176 VPGDLVYFKVGDRIPADVRII-ESTDLSLDESTLTGETEPVHKSCTPVNSATYSDVPGGI 234
           VPGD++  + G  IPAD R++ E   + +D+S +TGE+  V K                 
Sbjct: 178 VPGDILQLEDGVVIPADGRLVTEDCFIQIDQSAITGESLAVDKR---------------- 221

Query: 235 IPIGERTSIAYMGTLVREGHGKGIVVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRR 294
              G+ T   +  + V+ G    IV ATG  T  G    ++N            ++ +  
Sbjct: 222 --FGDST---FSSSTVKRGEAFMIVTATGDSTFVGRAAALVNKAAAGSGHFTEVLNGIGT 276

Query: 295 DLSYVRFVLSGIIFLLGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAN 354
            L  +  V   ++++    +    + + + ++++ +  +P GLP +VT T+A+G   +A 
Sbjct: 277 ILLILVIVTLLLVWVASFYRTNKIVRILRYTLAITIVGVPVGLPAVVTTTMAVGAAYLAK 336

Query: 355 RKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTASKIWCLGSMANKNNVLSLEAKSSGG 414
           ++AIV++L ++E+L  V ++CSDKTGTLT N ++  + + +  +   + +L+    +S  
Sbjct: 337 KQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVDPDDLMLTACLAAS-- 394

Query: 415 LPGKLPNLKNYLSDDVKATLRIGSICNNASFSHEHGKYLGNPTDIALLEVLQKFDLVDER 474
                   K  L    KA L+       +  S+   K             L K+ L++  
Sbjct: 395 ------RKKKGLDAIDKAFLK-------SLISYPRAK-----------AALTKYKLLEFH 430

Query: 475 PTTTRVDELTFNSKRKYMAVKVDSPANSGKHIIYVKGAFERILERSASFIGGAGKVEKL- 533
           P         F+   K +   V+SP   G+ II VKGA   +L+           VE+  
Sbjct: 431 P---------FDPVSKKVTAIVESP--EGERIICVKGAPLFVLK----------TVEEEH 469

Query: 534 ---SDSHKSLINDCAKSLASEGLRTLAFAQLECSTNKPMNDSTIQNLTFVGLIGMKDPPR 590
               D  ++  N  A+ LAS G R L  A+               +   +G++   DPPR
Sbjct: 470 PIPEDVRENYENKVAE-LASRGFRALGVARKRGEG----------HWEILGVMPCMDPPR 518

Query: 591 STVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVINPEISVLTGDRLDQMTDDQL 650
                 + E    G+ V M+TGDA   A    RQ+G+         L       M   +L
Sbjct: 519 DDTAQTVNEARHLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSEL 578

Query: 651 AGVIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAMGHMGTD 710
           A  +++ + FA   P+HK N+V  LQ+RG +VAMTGDGVNDAP+LK AD G+A+    TD
Sbjct: 579 ADFVENADGFAEVFPQHKYNVVEILQQRGYLVAMTGDGVNDAPSLKKADTGIAV-EGATD 637

Query: 711 VAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALSLVAIATAFKLQN 770
            A+ A+D+V      S I+ A++  + IF+ + S++ ++++ S+     + +  A  L  
Sbjct: 638 AARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEIFLGLWIAI-LNR 696

Query: 771 PLNAMQILWINILMD 785
            LN   +++I I  D
Sbjct: 697 SLNIDLVVFIAIFAD 711

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
            Ca2+-transporting P-type ATPase, member of the cation
            transporting (E1-E2) P-type ATPase superfamily, functions
            to pump Ca2+ into the vacuole [3522 bp, 1173 aa]
          Length = 1173

 Score =  206 bits (524), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 145/468 (30%), Positives = 245/468 (52%), Gaps = 51/468 (10%)

Query: 480  VDELTFNSKRKYMAVKVDSPANSGKHIIY---VKGAFERILERSASFIGGAGK-VEKLSD 535
            V  + F S RK+  + V       K   Y   +KGA E I+ ++ S+   +   +E++++
Sbjct: 610  VQTIPFESSRKWAGLVVKYKEGKNKKPFYRFFIKGAAE-IVSKNCSYKRNSDDTLEEINE 668

Query: 536  SHKSLINDCAKSLASEGLRTLAFAQ---LECSTNKP--MNDSTIQN-------------L 577
             +K   +D  K+LAS+ LR ++ A     EC +  P  + D    N             L
Sbjct: 669  DNKKETDDEIKNLASDALRAISVAHKDFCECDSWPPEQLRDKDSPNIAALDLLFNSQKGL 728

Query: 578  TFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGI---PVINPEI 634
               GL+G++DP R+ VR ++++  + GV V M+TGD   TA  IAR   I    + +   
Sbjct: 729  ILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARNCAILSTDISSEAY 788

Query: 635  SVLTGDRLDQMTDDQLAGVIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPA 694
            S + G    ++T ++   ++ ++ + AR++PE K  +V  L+  GD+VA+TGDG NDAPA
Sbjct: 789  SAMEGTEFRKLTKNERIRILPNLRVLARSSPEDKRLLVETLKGMGDVVAVTGDGTNDAPA 848

Query: 695  LKLADIGVAMGHMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSV 754
            LKLAD+G +MG  GT+VA+EASD++L  DDFS I+ AI+ G+ +  +I+ F+ FQL  ++
Sbjct: 849  LKLADVGFSMGISGTEVAREASDIILMTDDFSAIVNAIKWGRCVSVSIKKFIQFQLIVNI 908

Query: 755  AA--LSLVAIATAFKLQNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRSDK 812
             A  L+ V+   +    + L A+Q+LWIN++MD   A +L  +  D  +M + PR RS  
Sbjct: 909  TAVILTFVSSVASSDETSVLTAVQLLWINLIMDTLAALALATDKPDPNIMDRKPRGRSTS 968

Query: 813  ILTPQVMRRLLINAA--FIIGGTIYVFIKEM---TEDGQVTARD----TTMTFTCFVFFD 863
            +++    + +L  A    I+   ++ +  E+     + ++T+        MTF  FV+  
Sbjct: 969  LISVSTWKMILSQATLQLIVTFILHFYGPELFFKKHEDEITSHQQQQLNAMTFNTFVWLQ 1028

Query: 864  MFSALACRHATKSIFEIGIFNNKMFNYAVGFSLLGQLCAIYIPFFQNI 911
             F+ L  R   +     GI N +           G++ A  + FFQ++
Sbjct: 1029 FFTMLVSRKLDEG---DGISNWR-----------GRISAANLNFFQDL 1062

 Score =  121 bits (303), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 103/375 (27%), Positives = 176/375 (46%), Gaps = 68/375 (18%)

Query: 79  TNEVTVDGEDPVWKRFMSTFVE-------DPLILLLIGSAVLSFLMG------------- 118
           TN     G++ + +R   +F++       D  + LL  +AV+SF++G             
Sbjct: 85  TNRYKNYGDNSLPERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDP 144

Query: 119 ------NID--DAVSITLAVVIVVSVGFVQEYRSEKSLEALHKLVP-ASCHLIRFGAETH 169
                  +D  + V+I +AV +VV V    +Y+ E     L+K        +IR   E  
Sbjct: 145 EGNKIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAKLNKKKENRKIIVIRNDQEIL 204

Query: 170 VLASCLVPGDLVYFKVGDRIPADVRIIESTDLSLDESTLTGETEPVHK-----------S 218
           +    ++ GD++  + GD +PAD  +I S     DES++TGE+  + K            
Sbjct: 205 ISIHHVLVGDVISLQTGDVVPADCVMI-SGKCEADESSITGESNTIQKFPVDNSLRDFKK 263

Query: 219 CTPVNSATYS---DVPGGIIPIGERTSIAYM--GTLVREGHGKGIVVATGKHTMFGAVFE 273
              ++S  +S   D+ G +   G + +   +  G+ +  G G+G++ + G ++++G    
Sbjct: 264 FNSIDSHNHSKPLDI-GDVNEDGNKIADCMLISGSRILSGLGRGVITSVGINSVYGQTMT 322

Query: 274 MMNSIEKPKTPLQMAMDTLRRDLSYVRFVLSGIIFLL--------------------GVI 313
            +N+ E   TPLQ+ +  L  ++S    V + I+FL+                       
Sbjct: 323 SLNA-EPESTPLQLHLSQLADNISVYGCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQ 381

Query: 314 QGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRLPSVETLGSVNV 373
           +G  ++ +F  S+++ V A+PEGLP+ VT+ LA    RM     +VR L S ET+GS   
Sbjct: 382 KGSKFMNIFITSITVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATA 441

Query: 374 ICSDKTGTLTANHMT 388
           +CSDKTGTLT N MT
Sbjct: 442 VCSDKTGTLTENVMT 456

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score =  201 bits (511), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 194/736 (26%), Positives = 344/736 (46%), Gaps = 91/736 (12%)

Query: 56  LNTDSAKGLCDQQQVRASEQEWGTNEVTVDGEDPVWKRFMSTFVEDPLILLLIGSAVLSF 115
           L TD + GL    +V    +++G N++  + E  + K  M  F   P+  ++  +A+L+ 
Sbjct: 64  LQTDPSYGLT-SDEVAHRRKKYGLNQMADERESMIVKFVM--FFVGPIQFVMEAAAILAA 120

Query: 116 LMGNIDDAVSITLAVVIVVSVGFVQEYRSEKSLEALHKLVPASCHLIRFGAETHVLASCL 175
            + +  D   I   +++   VGF+QE+++   ++ L K +     +IR G    V A+ +
Sbjct: 121 GLSDWVDFGVICGLLMLNACVGFIQEFQAGSIVDELKKTLANVAVVIRDGQLVEVPANEV 180

Query: 176 VPGDLVYFKVGDRIPADVRII-ESTDLSLDESTLTGETEPVHKSCTPVNSATYSDVPGGI 234
           VPGD++  + G  IPAD R++ E+  L +D+S +TGE+  V K                 
Sbjct: 181 VPGDILQLEDGTIIPADGRLVTENCFLQVDQSAITGESLAVDKG---------------- 224

Query: 235 IPIGERTSIAYMGTLVREGHGKGIVVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRR 294
              G++T   +  + V+ G    +V ATG +T  G    ++N     +      ++ +  
Sbjct: 225 --YGDQT---FSSSTVKRGEAFMVVTATGDNTFVGRAAALVNKASGGQGHFTEVLNGIGI 279

Query: 295 DLSYVRFVLSGIIFLLGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAN 354
            L  +  V    ++     +  + +++ + ++ + +  +P GLP +VT T+A+G   +A 
Sbjct: 280 LLLVLVIVTLLGVWAACFYRTDNIVKILRFTLGITIIGVPVGLPAVVTTTMAVGAAYLAK 339

Query: 355 RKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTASKIWCLGSMANKNNVLSLEAKSSGG 414
           ++AIV++L ++E+L  V ++CSDKTGTLT N ++  + + +  ++               
Sbjct: 340 KQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVS--------------- 384

Query: 415 LPGKLPNLKNYLSDDVKATLRIGSICNNASFSHEHGKYLGNPTDIALLEVLQKFDLVDER 474
                       +DD+  T         A  +    K   +  D A L+ L  +    + 
Sbjct: 385 ------------ADDLMLT---------ACLAASRKKKGLDAIDKAFLKSLINYPKAKDA 423

Query: 475 PTTTRVDEL-TFNSKRKYMAVKVDSPANSGKHIIYVKGAFERILERSASFIGGAGKVEK- 532
            T  +V E   F+   K +   V+SP   G+ I+ VKGA   +L+           VE+ 
Sbjct: 424 LTKYKVIEFHPFDPVSKKVTAVVESP--EGERIVCVKGAPLFVLK----------TVEED 471

Query: 533 ---LSDSHKSLINDCAKSLASEGLRTLAFAQLECSTNKPMNDSTIQNLTFVGLIGMKDPP 589
                D H++  N  A+ LAS G R L  A+     +  +          +G++   DPP
Sbjct: 472 HPIPEDVHENYENKVAE-LASRGFRALGVARKRGEGHWEI----------LGVMPCMDPP 520

Query: 590 RSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVINPEISVLTGDRLDQMTDDQ 649
           R      + E  + G+ V M+TGDA   A    RQ+G+         L       M   +
Sbjct: 521 RDDTAETVNEARRLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSE 580

Query: 650 LAGVIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAMGHMGT 709
           LA  +++ + FA   P+HK  +V  LQ RG +VAMTGDGVNDAP+LK AD G+A+    +
Sbjct: 581 LADFVENADGFAEVFPQHKYKVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAV-EGAS 639

Query: 710 DVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALSLVAIATAFKLQ 769
           D A+ A+D+V      S I+ A++  + IF+ + S++ ++++ S+  L L        L 
Sbjct: 640 DAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSL-HLELFLGLWIIILN 698

Query: 770 NPLNAMQILWINILMD 785
           + L+   I++I I  D
Sbjct: 699 HSLDIELIVFIAIFAD 714

>Scas_569.0d
          Length = 468

 Score =  150 bits (378), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 92/308 (29%), Positives = 155/308 (50%), Gaps = 34/308 (11%)

Query: 633 EISVLTGDRLDQMTDDQLAGVIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDA 692
           E  V+TG + D++T +Q+  +     + AR +P+ K+ ++ AL +R    AMTGDGVND+
Sbjct: 78  ENMVMTGSQFDELTPEQIDNLPVLPLVIARCSPQTKVRMIEALHRRDKFCAMTGDGVNDS 137

Query: 693 PALKLADIGVAMGHMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQSFLTFQLST 752
           P+LK+A++G+AMG  G+DVAK+ASD+VL+DD+F++IL AIEEG+ + +NIQ F+   L+ 
Sbjct: 138 PSLKMANVGIAMGINGSDVAKDASDIVLSDDNFASILNAIEEGRRMSDNIQKFVLQLLAE 197

Query: 753 SVAALSLVAIATAFKLQN-----PLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPR 807
           +VA    +    AF+ +      PL  +++LWI ++    PA  LG+E    ++M +PP 
Sbjct: 198 NVAQALYLICGLAFQDKEGKSVFPLAPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPN 257

Query: 808 KRSDKILTPQVMRRLLINAAFIIGGTIYVFI----------------KEMTEDGQVTARD 851
                I T +++  + +    + G  +  F                 K   E      R 
Sbjct: 258 DSKSGIFTWEIIVDMFVYGIIMAGCCMGSFTTVVYGKDGGNLGFNCNKSYNETCHDVFRG 317

Query: 852 TTMTFTCFVFFDMFSALACRHATKSIFEI-------------GIFNNKMFNYAVGFSLLG 898
            +  F    +  +  A       +S F +              I++NK   +++ F  + 
Sbjct: 318 RSSAFAVMTWCALILAWEVVDLRRSFFRMQPETDTPVREFFRDIWSNKFLFWSLIFGFVS 377

Query: 899 QLCAIYIP 906
               IYIP
Sbjct: 378 TFPVIYIP 385

>Scas_297.1
          Length = 800

 Score =  152 bits (384), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 96/274 (35%), Positives = 155/274 (56%), Gaps = 15/274 (5%)

Query: 612 GDAENTAVNIARQIGI----PVINPEISVLTGDRLDQMTDDQLAGVIDHVNIFARATPEH 667
           GD   TA  IAR   I      + PE ++  G +   +T  +   ++ ++ + AR++PE 
Sbjct: 1   GDNILTARAIARNCNILSEETYLIPECAI-EGPKFRTLTKQERIKMLPNLRVMARSSPED 59

Query: 668 KLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVLTDDDFST 727
           K  +V  L+  GD+VA+TGDG NDAPALKLAD+G +MG  GT+VA+EASD++L  DDF+ 
Sbjct: 60  KRLLVETLKGMGDVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFAA 119

Query: 728 ILTAIEEGKGIFNNIQSFLTFQLSTSVAA--LSLVAIATAFKLQNPLNAMQILWINILMD 785
           I+ AI+ G+ +  +I+ F+ FQL  ++ A  L+ V+   +    + L A+Q+LWIN++MD
Sbjct: 120 IVDAIKWGRCVSISIKKFIQFQLIVNITAVILAFVSSIASEDETSVLTAVQLLWINLIMD 179

Query: 786 GPPAQSLGVEPVDHEVMRKPPRKRSDKILTPQVMRRLLINAA--FIIGGTIYVFIKEMTE 843
              A +L  +  D  +M + PR RS  ++ P   + +L  +    I+   ++   KE+  
Sbjct: 180 TLAALALATDKPDPNIMDRKPRGRSTPLIFPSTWKMILSQSCLQLIVTFILHFNGKEIFF 239

Query: 844 DG--QVTARD----TTMTFTCFVFFDMFSALACR 871
            G  ++T  +      MTF  FV+   F+ L  R
Sbjct: 240 RGRDEITGHEQQQLNAMTFNTFVWLQFFTLLVSR 273

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 67/260 (25%), Positives = 117/260 (45%), Gaps = 42/260 (16%)

Query: 90  VWKRFMSTFVEDPLILLLIGSAVLSFLMG-------------------NID--DAVSITL 128
           +W+ F    +      LL  +AV+SF++G                    +D  + ++I +
Sbjct: 514 IWEAFNDKTML-----LLTAAAVVSFVLGLYEALYTPPEYDPEGNPIKKVDWIEGIAIMI 568

Query: 129 AVVIVVSVGFVQEYRSEKSLEALHKLVP-ASCHLIRFGAETHVLASCLVPGDLVYFKVGD 187
           AV++VV VG V +Y+ E     L+K        +IR   E       L+ GD++  + GD
Sbjct: 569 AVIVVVFVGAVNDYQKELQFARLNKKKENRKIIVIRNSQELLTSIHNLLVGDIITLQTGD 628

Query: 188 RIPADVRIIESTDLSLDESTLTGETEPVHKSCTPVNSATYSDVPGG-----IIPIGERT- 241
            IPAD  ++E     +DES++TGE++ + K        T+  +  G     I+ IG +T 
Sbjct: 629 VIPADGVLVEG-QCEVDESSITGESDTIKKVKVFNALKTFDVINEGKSNDQILDIGFKTP 687

Query: 242 -------SIAYMGTLVREGHGKGIVVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRR 294
                   +   G+ +  G GK I+ + G +++ G    M   +E   TPLQ  +  L  
Sbjct: 688 NGDKIPDCMLISGSKLLSGLGKAIITSVGTNSIHGRTM-MALKVEPESTPLQQRLSQLAD 746

Query: 295 DLSYVRFVLSGIIFLLGVIQ 314
            +S    V + ++FL+  I+
Sbjct: 747 SISVYGCVAAILLFLVLFIR 766

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score =  135 bits (339), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 203/804 (25%), Positives = 326/804 (40%), Gaps = 158/804 (19%)

Query: 144  SEKSLEALHKLVPASCHLIRFGAETHVLASCLVPGDLVYFKVGDR----IPADVRIIEST 199
            SEK  +  H       +  RF   T V +S LVPGDL  F++ D     +P D  +I S 
Sbjct: 527  SEKLADISHFNCEVRVYKDRFW--TQVNSSDLVPGDL--FEISDPSLVVLPCDAVLI-SG 581

Query: 200  DLSLDESTLTGETEPVHK-SCTPVNSATY-SDVPGGIIPIGERTSIAYMGT---LVREGH 254
            D  ++ES LTGE+ PV K + T    A    D     +      S  + GT    VR   
Sbjct: 582  DCIVNESMLTGESVPVSKYAATEATMAQLLQDFKSSQVSSFVSKSFLFNGTKIIRVRNQP 641

Query: 255  GKG----IVVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRRDLSYVRF--VLSGIIF 308
            G+G    +V+ TG  T  G++   M        P  +          Y+ F  +++   F
Sbjct: 642  GQGMALALVIRTGFSTTKGSLVRSM------VFPKPVGFKFYEDSFKYIGFMTLIAMFGF 695

Query: 309  LLGVIQ----GRSWLEMFQISVSLAVAAIPEGLPIIVTV--TLALGVLRMANRKAIVRRL 362
             +  IQ    G  +  M   ++ +    +P  LP  +T+  + ALG L+   +K I    
Sbjct: 696  SISCIQFIRLGLEYKVMILRALDIITIVVPPALPATLTIGTSFALGRLK---KKGIFCIS 752

Query: 363  PS-VETLGSVNVICSDKTGTLTANHMTASKIWCLGSMANKNNVLSLEAKSSGGLPGKLPN 421
            P+ V   G V+++C DKTGTLT   +    I         + +L L       L      
Sbjct: 753  PTRVNVGGKVDMMCFDKTGTLTEEGLDVLGI-HFAKPEGSSTILQL-----SDLITDCDE 806

Query: 422  L--KNYLSD-----DVKATLRIGSICNNASFSHEHGKYLGNPTDIALLEVLQ-------- 466
            +  K+ LSD     + KA   + S+    S  H  G+ LG+P D+ + E  +        
Sbjct: 807  VLQKHTLSDCNSAEEFKAKNFLVSLLTCHSLKHIDGELLGDPLDLKMFEFTKWAYEEGYE 866

Query: 467  --KFDLVDER---------PTTT-------------RVDELTFNSKRKYMAVKVDSPANS 502
              KF   +++         PT+               +    F S+ + M+V V      
Sbjct: 867  SWKFKNAEDKTGISPAVVHPTSNCNFIENDPDNLIGVIRSFEFLSELRRMSVIVKG-FKE 925

Query: 503  GKHIIYVKGAFERILERSASFIGGAGKVEKLSDSHKSLINDCAKSLASEGLRTLAFA--- 559
              +  + KGA E I +     I     + K  D H+ L           G R +A A   
Sbjct: 926  NTYWSFTKGAPEVIAD-----ICNPATIPK--DFHELL-----HHYTHNGFRIIACAGKT 973

Query: 560  ---QLECSTNKPMNDSTIQNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAEN 616
                    + K   +    NL F+G I  ++  +S  + A++EL    +  +M TGD   
Sbjct: 974  LPKSSWLYSQKVSREEVEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVL 1033

Query: 617  TAVNIARQIG--------IPVIN--------------------------------PEIS- 635
            TAV++ R  G        IP +N                                PE S 
Sbjct: 1034 TAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLNDPEKSY 1093

Query: 636  --VLTGD------RLDQ-MTDDQLAGVIDHVNIFARATPEHKLNIVRALQKRGDIVAMTG 686
               +TGD      R D+ + DD ++ V+   +I+AR +P+ K  +V  LQK    V   G
Sbjct: 1094 TLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHELVEQLQKLDYNVGFCG 1153

Query: 687  DGVNDAPALKLADIGVAMGHMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQSFL 746
            DG ND  ALK A+IG+++      VA   +  V    D S +L  I+EG+     + SF 
Sbjct: 1154 DGANDCGALKAANIGISLSEAEASVAAPFTSAVF---DISCVLDVIKEGRASL--VTSFS 1208

Query: 747  TFQLSTSVAALSLVAIATAFKLQNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPP 806
             FQ  +  +A+  + I   +   + L   Q L+I++L+  P A S+     + ++++K P
Sbjct: 1209 CFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVPIAISMSWSKPNSKLVKKRP 1268

Query: 807  RKRSDKILTPQVMRRLLINAAFII 830
               S  +++P+++  L +N   I+
Sbjct: 1269 ---SANLVSPKILVPLCLNITLIL 1289

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score =  129 bits (324), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 185/846 (21%), Positives = 339/846 (40%), Gaps = 161/846 (19%)

Query: 112  VLSFLMGNIDDAVSITLAVVIVVSVGFVQEYRSEKSL-EALHKLVPASCHL--IRFGAET 168
            VLS ++ ++D+       + ++  +  +      K +   L ++   +C +  +R G  +
Sbjct: 491  VLSIILWSLDEYYYYAGCIFLISLLSILDTLIETKKISRTLAEMSHFNCEVRVLREGFWS 550

Query: 169  HVLASCLVPGDLVYFKVGDR----IPADVRIIESTDLSLDESTLTGETEPVHKSCTPVNS 224
             + +S LVPGD+  +++ D     +P D  I+ S D  ++ES LTGE+ PV K   P + 
Sbjct: 551  SIHSSELVPGDI--YEISDPNLNLLPCD-SILLSGDCIVNESMLTGESVPVSK--YPASE 605

Query: 225  AT----YSDVPGGIIPIGERTSIAYMGT-LVREGHGKG------IVVATGKHTMFGAVFE 273
             T    + D     I      S  + GT L+R     G      + V TG  T  G++  
Sbjct: 606  ETILQLFDDFQSTQISTFLSKSFLFNGTTLIRAKIPNGGSVALAMAVRTGFSTTKGSLIR 665

Query: 274  MMNSIEKPKTPLQMAMDTLRRD-----LSYVRFVLSGIIFLLGVIQGRSWLEMFQISVSL 328
             M    KP +  +   D+ +       +++  F +S I F+   +  R+   M   ++ +
Sbjct: 666  SM-VFPKP-SGFKFYSDSFKYIGFMAIIAFFGFSISCINFIKLGLDKRT---MILRALDI 720

Query: 329  AVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRLPSVETLGSVNVICSDKTGTLTANHMT 388
                +P  LP  +T+  +  + R+  +         V   G ++V+C DKTGTLT + + 
Sbjct: 721  ITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNIGGKIDVMCFDKTGTLTEDGLD 780

Query: 389  --ASKIWCLGSMANKNNVLSLEAKSSGGLPG-KLPNLKNYLSDDVKATLRIGSICNNASF 445
                ++ C  +  NK +   L + +    P   L +  N   DD K    + S+    S 
Sbjct: 781  VLGVRVSC-AATRNKASFSDLISDTHDIFPKFSLKDCSN--PDDYKRRNFLISLLTCHSL 837

Query: 446  SHEHGKYLGNPTDIALLEVL-----------------------QKF----DLV------- 471
                G+ LG+P D  + +                         Q F    D++       
Sbjct: 838  RVVDGELLGDPLDFKMFQFTGWSYEEDFQNHQFHSLYEERHEGQNFPENNDIIPAIVHPN 897

Query: 472  --DERPTTTRVD---------ELTFNSKRKYMAVKVDSPANSGKHIIYVKGAFERILERS 520
              DER    + D            F S+ + M+V V  P N   +  Y KGA E I++  
Sbjct: 898  DSDERNKFVQNDPNNILGIIRSFEFLSELRRMSVIV-KPNNENVYWAYTKGAPEVIID-- 954

Query: 521  ASFIGGAGKVEKLSDSHKSLINDCAKSLASEGLRTLAFAQLECSTNKPMNDSTIQ----- 575
                        L   +  ++N    S    G R +A A      N  +    ++     
Sbjct: 955  ------ICNPATLPSDYDDILNFYTHS----GYRVIACAGKTLPKNTWLYSQKVRREEVE 1004

Query: 576  -NLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGI------- 627
             N+ F+G I  ++  +    P + +L    +  +M TGD   TA+++ ++  +       
Sbjct: 1005 SNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVY 1064

Query: 628  ------------PVIN------------------------PEISVLTGDRL-------DQ 644
                        PVI+                        P    +TG+         D 
Sbjct: 1065 VPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQDN 1124

Query: 645  MTDDQLAGVIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAM 704
             +++ +  ++   +IFAR +P+ K  +V  LQK    V   GDG ND  ALK AD+G+++
Sbjct: 1125 YSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAADVGISL 1184

Query: 705  GHMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALSLVAIAT 764
                  VA   +  +    D + +L  I+EG+     + SF  FQ  +  +A+  ++I  
Sbjct: 1185 SEAEASVAAPFTSKIF---DITCVLDVIKEGRASL--VTSFACFQYMSLYSAIQFISITI 1239

Query: 765  AFKLQNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRSDKILTPQVMRRLLI 824
             +   + L   Q L+I++L+  P A ++      HE+ +K P   S  +++P+++  L++
Sbjct: 1240 LYSRGSNLGDFQFLYIDLLLIIPIAVTMSWSKPYHELAKKRP---SANLVSPKILVPLIL 1296

Query: 825  NAAFII 830
            +  F+ 
Sbjct: 1297 DIVFLF 1302

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score =  122 bits (307), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 209/881 (23%), Positives = 359/881 (40%), Gaps = 156/881 (17%)

Query: 102  PLILLLIGSAVLSFLMGNIDDAVSITLAVVIVVSVGFVQEYRSEKSLEALHKLVPASCHL 161
            P  +  I S +L         A  I +  V+ V    V+  +S + L  L +       +
Sbjct: 485  PFYIFQIFSIILWMFDAYYYYATCIFIISVLSVIDTLVETKQSSERLSELSQFY-CDVRV 543

Query: 162  IRFGAETHVLASCLVPGDLVYFKVGDR----IPADVRIIESTDLSLDESTLTGETEPVHK 217
             R G  + V +S LVPGD+  +++ D     +P D  I+ S D  ++ES LTGE+ PV K
Sbjct: 544  YRDGFWSQVPSSDLVPGDI--YELTDPSLSLLPCD-SILISGDCLVNESMLTGESVPVSK 600

Query: 218  SCTPVNS--ATYSDVPGGIIPIGERTSIAYMGT---LVREGHGK----GIVVATGKHTMF 268
                  +      D     +      S  + GT    VR   G+    G+V  TG  T  
Sbjct: 601  VAATRETMLQLLDDFMDTQLSSFVSKSFLFNGTKLIRVRATAGQSIALGMVARTGFSTTK 660

Query: 269  GAVFEMMNSIEKPKTPLQMAMDTLRRDLSYVR------FVLSGIIFLLGVIQGRSWLEMF 322
            G++   M    KP T  +   D+ +  + Y+       F +S I FL   +  R+   M 
Sbjct: 661  GSLVRSM-VFPKP-TGFKFYEDSFKY-IGYISIIALFGFAVSFIQFLRLGLDKRT---MI 714

Query: 323  QISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRLPSVETLGSVNVICSDKTGTL 382
              ++ +    +P  LP  +++     + R+  +         V   G ++V+C DKTGTL
Sbjct: 715  LRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNVGGKIDVMCFDKTGTL 774

Query: 383  TANHMTASKIWCLGSMANKNNVLSLEAKSSGGLPGKLPNLKNYLSD-----DVKATLRIG 437
            T + +    +  +  +  +  +    +K    +   L +L   LSD     D+KA   + 
Sbjct: 775  TEDGLDVLGVHVVQPLQQEMKI----SKLVTDVKDLLQSLS--LSDCVSTRDMKAKNFLV 828

Query: 438  SICNNASFSHEHGKYLGNPTDIALLEVLQKFD-----------LVDERPTTTRVDELTFN 486
            S+    S     G+ LG+P D  +++  +  D           L +ER   + + E   N
Sbjct: 829  SLLTCHSLRMVDGELLGDPFDFKMVQFTKWSDEEETGNRKVHSLYEERHDGSTMPE---N 885

Query: 487  SKRKYMAVKVDSPANSGKHI-------IYVKGAFERI--LERSA------------SFIG 525
            S+    A  +  P+  G+ I       I +  +FE +  L R +            SF  
Sbjct: 886  SR---FAPAIVHPSGKGRFIEREPSNVIGIVRSFEFLSNLRRMSVIVKPFSENVFMSFTK 942

Query: 526  GAGKVEKLSDSHKSLINDCAKSL---ASEGLRTLAFA------QLECSTNKPMNDSTIQN 576
            GA +V     S ++L  D    L      G R +A A      Q    + K   +    N
Sbjct: 943  GAPEVIFELCSKQTLPLDYEALLHHYTHNGYRVIACAGKKLTRQSWLYSQKVSREEIESN 1002

Query: 577  LTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIG--------IP 628
            L F+G I  ++  + T +  +E L +  +  IM TGD   TA+++ R+ G        + 
Sbjct: 1003 LEFLGFIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVS 1062

Query: 629  VIN-----PEISVLT-------GDRLDQMT--------DD-------------------Q 649
            VIN      E  ++T        D LD +T        DD                   Q
Sbjct: 1063 VINDIDTSQEGDIITWQNVANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQ 1122

Query: 650  LAGVIDHV----NIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAMG 705
            +  VI+++    +I+AR +P+ K  +V  LQ  G  V   GDG ND  ALK ADIG+++ 
Sbjct: 1123 IEEVINNILLKTSIYARMSPDEKHELVERLQSIGYQVGFCGDGANDCGALKAADIGISLS 1182

Query: 706  HMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALSLVAIATA 765
                 VA   +  +    + S +L  ++EG+     + SF  FQ  +  +A   V I   
Sbjct: 1183 EAEASVAAPFTSRLF---EISCVLDVMKEGRAAL--VTSFACFQYMSLYSATQFVTILIL 1237

Query: 766  FKLQNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRSDKILTPQVMRRLLIN 825
            +   + L   Q L+I++ +  P A  +      +EV+ K  ++ +  +++P+++  LL++
Sbjct: 1238 YSRGSNLGDFQFLYIDLFLIVPLAVFMSWSK-PYEVLAK--KRPTANLVSPKILIPLLVH 1294

Query: 826  AA--FIIGGTIYVFIKEMT--------EDGQVTARDTTMTF 856
                F+     ++ ++ M         +D  V + D T+ F
Sbjct: 1295 IVILFVFQLVPWLAVQHMKWYRQPVVGDDEHVASSDNTILF 1335

>Scas_665.30
          Length = 1439

 Score =  116 bits (291), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 191/850 (22%), Positives = 329/850 (38%), Gaps = 165/850 (19%)

Query: 102  PLILLLIGSAVLSFLMGNIDDAVSITLAVVIVVSVGFVQEYRSEKSLEALHKLVPASCHL 161
            P  +  I S +L  L      A  I L  ++ +    V+  R++KSL  +      +C +
Sbjct: 273  PFYVFQIFSIILWSLDEYYYYAGCIFLISILSIVDTLVETRRTQKSLADMSHF---ACEV 329

Query: 162  IRFGAE--THVLASCLVPGDLVYFKVGDR----IPADVRIIESTDLSLDESTLTGETEPV 215
              F  E  T+V ++ LVPGD+  +++ D      P D  ++ S D  ++ES LTGE+ PV
Sbjct: 330  RVFRDEFWTNVNSADLVPGDI--YEISDPSLTVFPCD-SLLLSGDCIVNESMLTGESVPV 386

Query: 216  HKSCTPVNSAT----YSDVPGGIIPIGERTSIAYMGTLV---REGHGK----GIVVATGK 264
             K   P    T      D     I      S  + GT +   R  +G+     +VV TG 
Sbjct: 387  SK--FPAEPETMLQLLDDFQNTQISSYLSKSFLFNGTTIIRARIPYGQSAALAMVVRTGF 444

Query: 265  HTMFGAVFEMMNSIEKPKTPLQMAMDTLRRD-----LSYVRFVLSGIIFLLGVIQGRSWL 319
             T  G++   M    KP T  +   D+ +       ++   F +S I F+   +  R+  
Sbjct: 445  STTKGSLVRSM-VFPKP-TGFKFYEDSFKYIGVMALIALFGFSISCIQFIKIGLDKRT-- 500

Query: 320  EMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRLPSVETLGSVNVICSDKT 379
             M   ++ +    +P  LP  +T+     + R+  +         V   G ++++C DKT
Sbjct: 501  -MILRALDIITIVVPPALPATLTIGTGFALSRLKKKGIFCISPTRVNIGGKIDILCFDKT 559

Query: 380  GTLTANHMTASKI-WCLGSMANKNNVLSLEAKSSGGLPGKLPNLKNYLSD-----DVKAT 433
            GTLT N +    +  C+ S  N      L        P      K  L+D     D +A 
Sbjct: 560  GTLTENGLDVLGVQLCVPSSHNSFQFADLVQDVHKLFP------KFSLNDCSSPRDYRAK 613

Query: 434  LRIGSICNNASFSHEHGKYLGNPTDIALL--------EVLQKFDL---VDER-------- 474
                S+    S      + +G+P D  +         E  Q+ +     +ER        
Sbjct: 614  NFFISLLTCHSLRVVDNELIGDPLDFKMFQFTKWSYEEDFQEKEFHSTYEERRHDNALPE 673

Query: 475  ---------------PTTTRVDE-----------LTFNSKRKYMAVKVDSPANSGKHIIY 508
                           P  T +D              F S+ + M+V V  P+N   +  +
Sbjct: 674  NIDIIPAVVHPNSADPENTFIDNDPHNFLGIIRSFEFLSELRRMSVIV-KPSNEDVYWAF 732

Query: 509  VKGAFERILERSASFIGGAGKVEKLSD-SHKSL-INDCAKSLASEGLRTLAFAQLECSTN 566
             KGA E I +        A   E L+  +HK   +  CA  +      T  ++Q      
Sbjct: 733  TKGAPEVITQICNKATLPANFEEMLNYYTHKGYRVIACAGRVLPRN--TWLYSQ------ 784

Query: 567  KPMNDSTIQNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIG 626
            K   +    N+ F+G I  ++  +      ++ L +  +  +M TGD   TA+++ RQ  
Sbjct: 785  KVSREEVESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCN 844

Query: 627  I----------------------------------------PVINPE------------I 634
            +                                        P+ N               
Sbjct: 845  LIKSKKVYVPSLEEIDSTGQTSIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIF 904

Query: 635  SVLTGDRLDQMTDDQLAGVIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPA 694
             ++ GD  + +++D +  V+    I+AR +P+ K  ++  LQ+    V   GDG ND  A
Sbjct: 905  RIIFGDENNSISEDYINTVLLKGTIYARMSPDEKHELMEQLQRLNYTVGFCGDGANDCGA 964

Query: 695  LKLADIGVAMGHMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSV 754
            LK AD+G+++      VA   +  V    D S +L  I+EG+     + SF  FQ  +  
Sbjct: 965  LKAADVGISLSEAEASVAAPFTSQVF---DISCVLDVIKEGRACL--VTSFSCFQYMSLY 1019

Query: 755  AALSLVAIATAFKLQNPLNAMQILWINILMDGPPAQSLGV-EPVDHEVMRKPPRKRSDKI 813
            +A+  + I   +   + L   Q L+I++L+  P A  +   +P D  V ++P    S  +
Sbjct: 1020 SAIQFITITVLYSRGSNLGDFQFLYIDLLLIVPIAIFMSWSKPYDKIVKKRP----SANL 1075

Query: 814  LTPQVMRRLL 823
            ++P+++  LL
Sbjct: 1076 VSPKILIPLL 1085

>Kwal_26.9207
          Length = 1469

 Score =  116 bits (290), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 203/891 (22%), Positives = 351/891 (39%), Gaps = 176/891 (19%)

Query: 112  VLSFLMGNIDDAVSITLAVVIVVSVGFVQEY-RSEKSLEALHKLVPASCHL--IRFGAET 168
            + S L+   D+       + I+  +  +     ++K+ + L ++  + C +   R G   
Sbjct: 509  IFSILLWLADNYYYYAACIFIISMLSIIDTLVETKKTSQRLAEVSHSHCEVRVYRDGFWV 568

Query: 169  HVLASCLVPGDLVYFKVGD----RIPADVRIIESTDLSLDESTLTGETEPVHKSCTPVNS 224
             V +S LVPGD+  +++ D      P D  ++ S D  ++ES LTGE+ PV K   P + 
Sbjct: 569  QVSSSELVPGDV--YEISDPSLSTFPCD-SLLLSGDCIVNESMLTGESVPVSK--IPASD 623

Query: 225  AT----YSDVPGGIIPIGERTSIAYMGTLV-------REGHGKGIVVATGKHTMFGAVFE 273
             T      D     I      S  + GT +        +     +VV TG  T  G++  
Sbjct: 624  ETIYQLLEDFQKTQISNFLAKSFLFNGTKIIRVRIGGEQSTALAMVVRTGFSTTKGSLLR 683

Query: 274  MMNSIEKPKTPLQMAMDTLRRDLSYVRFV----LSGI-IFLLGVIQ-GRSWLEMFQISVS 327
             M  I    +  +   D+ +    Y+ F+    L+G  I  +  I+ G ++  M   ++ 
Sbjct: 684  SM--IFPKPSGFKFYEDSFK----YIGFMTLIALAGFSISCINFIRLGLAYKVMILRALD 737

Query: 328  LAVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRLPS-VETLGSVNVICSDKTGTLTANH 386
            +    +P  LP  +++  +  + R+  +K I    P+ V   G ++V+C DKTGTLT + 
Sbjct: 738  IITIVVPPALPATLSIGASFAIARL-KKKGIFCIAPTRVNVSGKIDVMCFDKTGTLTEDG 796

Query: 387  MTASKIWCLGSMANKNNVLSLEAKSSGGLPGKLPNLKNYLSD-----DVKATLRIGSICN 441
            +    +       ++N        +  GL  K       L+D     D K+   + S+  
Sbjct: 797  LDVLGVHVAEPQGHQNFRFGALITNVRGLFNKYS-----LNDCGSPIDFKSRNFLVSLLT 851

Query: 442  NASFSHEHGKYLGNPTDIALL--------EVLQKF---DLVDERPTTTRVDE-------- 482
              S     G+ LG+P D  +         E  Q F    L +ER   + + E        
Sbjct: 852  CHSLRVVDGELLGDPLDFKMFQFTNWSYAEDFQDFKFHSLNEERNNKSTLPENAGIAPAV 911

Query: 483  --------------------------LTFNSKRKYMAVKVDSPANSGKHIIYVKGAFERI 516
                                        F S+ + M+V V  P        + KGA E I
Sbjct: 912  VHPNAESTENKFTENDPHNLLGVIRSFEFVSELRRMSVIV-KPYGENVFWGFTKGAPEVI 970

Query: 517  LE---RSASFIGGAGKVEKLSDSHKSLINDCAKSLASEGLRTLAFAQLECSTNKPMNDST 573
             E   +S         +++ + +   +I    K+L     RT  FAQ      K   +  
Sbjct: 971  SEICNKSTLPANYEQILQQYTHNGYRVIACAGKTLPK---RTWRFAQ------KVSREEV 1021

Query: 574  IQNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIG------- 626
              N+ F+G +  ++  + +  P +  L   G+  IM TGD   TA+++ R+ G       
Sbjct: 1022 ESNMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHV 1081

Query: 627  -IPVINPEIS----------------VLTGDRLDQM---TDDQLAGVID----------- 655
             +P IN  +                 +L G  L+ M   +D  +A   D           
Sbjct: 1082 FVPQINDNMDPNEDLIIWRDVDDCDLILDGVTLEPMNGSSDYTIAVTGDVFRLLFKNNEV 1141

Query: 656  ----HVN-------IFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAM 704
                ++N       I+AR +P+ K  +V  LQ    +V   GDG ND  ALK AD+GV++
Sbjct: 1142 LPESYINMVLLKSSIYARMSPDEKHELVGQLQGLDYVVGFCGDGANDCGALKAADVGVSL 1201

Query: 705  GHMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALSLVAIAT 764
                  VA   +  V    + S IL  I+EG+       SF  FQ  +  +A+  V +  
Sbjct: 1202 SEAEASVAAPFTSSVF---EISCILDVIKEGRASLTT--SFSCFQYMSLYSAIQFVTVTM 1256

Query: 765  AFKLQNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRSDKILTPQVMRRLLI 824
             +     L   Q L+I++ +  P A  +      H++++K P   S  +++P+++  L+ 
Sbjct: 1257 LYSRGINLGDFQFLYIDLFLIVPIAIFMSWSKPYHKLVKKRP---SANLVSPKILAPLVA 1313

Query: 825  NAAFII--GGTIYVFIKEMTE--------DGQVTARDTTMTFTCFVFFDMF 865
            N A I+    T ++ ++ M          D  V + D T+ F    FF  F
Sbjct: 1314 NIAIILVFQATPWLVVQAMRWYQAPVVGGDDAVQSSDNTVLF----FFSNF 1360

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score =  107 bits (267), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 199/882 (22%), Positives = 343/882 (38%), Gaps = 163/882 (18%)

Query: 112  VLSFLMGNIDDAVSITLAVVIVVSVGFVQEYRSEKSL-EALHKLVPASC--HLIRFGAET 168
            V S ++  ID+       + ++  +        +K +   L ++    C   ++R    T
Sbjct: 503  VFSIILWGIDEYYYYAACIFLISVLSIFDSLNEQKKVSRNLAEMSHFHCDVRVLRDKFWT 562

Query: 169  HVLASCLVPGDLVYFKVGDR----IPADVRIIESTDLSLDESTLTGETEPVHKSCTPVNS 224
             + +S LVPGD+  ++V D     +P D  I+ S+D  ++ES LTGE+ PV K   P   
Sbjct: 563  TISSSELVPGDI--YEVSDPNITILPCD-SILLSSDCIVNESMLTGESVPVSK--FPATE 617

Query: 225  ATY----SDVPGGIIPIGERTSIAYMGT-LVREGHGKG------IVVATGKHTMFGAVFE 273
             T      D     I      S  Y GT ++R     G      +VV TG  T  G++  
Sbjct: 618  ETMYQLCDDFQSTQISSFVSKSFLYNGTNIIRARIAPGQTAALAMVVRTGFSTTKGSLVR 677

Query: 274  MMNSIEKPKTPLQMAMDTLRRDLSYVRFV-LSGII-FLLGVIQ----GRSWLEMFQISVS 327
             M    KP T  +   D+ +    Y+ F+ L  I  F +  +Q    G     M   ++ 
Sbjct: 678  SM-VFPKP-TGFKFYRDSFK----YIGFMSLIAIFGFCVSCVQFIKLGLDKKTMILRALD 731

Query: 328  LAVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRLPSVETLGSVNVICSDKTGTLTANHM 387
            +    +P  LP  +T+     + R+  +         +   G ++V+C DKTGTLT + +
Sbjct: 732  IITIVVPPALPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCFDKTGTLTEDGL 791

Query: 388  TASKIWCLGSMANKNNVLSLEAKSSGGLPGKLPNL--KNYLSD-----DVKATLRIGSIC 440
                   LG   ++ N   +  +  G L   +  +  K  L+D     D K+     S+ 
Sbjct: 792  DV-----LGVQISEPN--GVRGQKFGELLSDIRQVFPKFSLNDCSSPLDFKSRNFFMSLL 844

Query: 441  NNASFSHEHGKYLGNPTDIALL--------EVLQKFDLVDERPTTTRVDELTFNSKRKYM 492
               S     G  LG+P D  +         E  QK             D    NS+    
Sbjct: 845  TCHSLRSVDGNLLGDPLDFKMFQFTGWSFEEDFQKRAFHSLYEGRHEDDVFPENSEIIPA 904

Query: 493  AVKVDS-------PANSGKHIIYVKGAFERI--LERSA------------SFIGGAGKVE 531
             V  DS         N   + + V  +FE +  L R +            SF  GA +V 
Sbjct: 905  VVHPDSNNRENTFTDNDPHNFLGVVRSFEFLSELRRMSVIVKTNNDDVYWSFTKGAPEVI 964

Query: 532  KLSDSHKSLINDCAKSL---ASEGLRTLAFA------QLECSTNKPMNDSTIQNLTFVGL 582
                +  +L  D  + L      G R +A A      +    + K   +    NL F+G 
Sbjct: 965  SEICNKSTLPADFEEVLRCYTHNGYRVIACAGKTLPKRTWLYSQKVSREEVESNLEFLGF 1024

Query: 583  IGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIG--------IPVIN--- 631
            I  ++  +      ++ L    +  IM TGD   TA+++ R+ G        +P IN   
Sbjct: 1025 IIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDTP 1084

Query: 632  ----PEIS------------------------------------VLTGD--RL-----DQ 644
                P I                                      ++GD  RL     ++
Sbjct: 1085 LHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDENE 1144

Query: 645  MTDDQLAGVIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAM 704
            + ++ L  ++ + +I+AR +P+ K  ++  LQK    V   GDG ND  ALK AD+G+++
Sbjct: 1145 IPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGALKAADVGISL 1204

Query: 705  GHMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALSLVAIAT 764
                  VA   +  +    + S +L  I EG+     + SF  FQ  +  +A+  + I  
Sbjct: 1205 SEAEASVAAPFTSKIF---NISCVLDVIREGRAAL--VTSFACFQYMSLYSAIQFITITI 1259

Query: 765  AFKLQNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRSDKILTPQVMRRLLI 824
             +   + L   Q L+I++L+  P A  +       ++ +K P   S  +++P+++  LLI
Sbjct: 1260 LYSRGSNLGDFQFLYIDLLLIVPIAICMSWSKSYEKIDKKRP---SANLVSPKILVPLLI 1316

Query: 825  NA--AFIIGGTIYVFIKEMTE--------DGQVTARDTTMTF 856
            +    F+     ++ +++M+         D  V + D T+ F
Sbjct: 1317 SVFLVFLFQFIPWIIVQKMSWYIKPIVGGDDAVQSSDNTVLF 1358

>KLLA0C08393g 734655..738101 highly similar to sp|P40527
           Saccharomyces cerevisiae YIL048w NEO1 ATPase whose
           overproduction confers neomycin resistance, start by
           similarity
          Length = 1148

 Score = 91.3 bits (225), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 147/653 (22%), Positives = 267/653 (40%), Gaps = 110/653 (16%)

Query: 174 CLVP------GDLVYFKVGDRIPADVRIIESTDLS----LDESTLTGETE-PVHKSCTPV 222
           C +P      GD++  K G R+PADV ++++ + +    +    L GET+  +  +C+  
Sbjct: 266 CPIPSKDLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLT 325

Query: 223 NSATYSDVPGGIIPIG---ERTSIAYMGTL-----------VREGHGKGIVVATGKHTMF 268
            S T +D+   I       E +   ++G +           V     +  V+A+    + 
Sbjct: 326 QSLTENDLLNNITITASAPEHSIHNFLGKITYKDSTSSPLSVDNTMWENTVLASSAACIC 385

Query: 269 GAVF------EMMNSIE-KPKTPL-QMAMDTLRRDLSYVRFVLSGIIFLLGVIQGRSWLE 320
             V+      + +N+ + K KT L ++ ++ L + L    F+LS ++          W  
Sbjct: 386 CIVYTGRETRQALNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVAFAGFNNNDWYV 445

Query: 321 MFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRK----AIVRRLPSVETLGSVNVICS 376
                + L    IP  L + + +  ++   ++ + K     IVR     E LG +  + S
Sbjct: 446 DIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIPEDLGRIEYLLS 505

Query: 377 DKTGTLTANHMTASKIWCLGSMANKNNVL--------SLEAKSSGGLPGKLPNLKNYLSD 428
           DKTGTLT N M   KI  LG+++  N  +        S+ +++S   P      +  +SD
Sbjct: 506 DKTGTLTQNDMQLKKI-HLGTVSYTNETMDIVTDFIQSMNSRTSNSTP---TTTRKNISD 561

Query: 429 DVKATLRIGSICNNASFSHEHGKYL---GNPTDIALLEVLQKFDLVDERPTTTRVDELTF 485
            V   +   +IC+N + + E G+      +P +IA+++  +   L   R     +     
Sbjct: 562 RVIDLVTTLAICHNVTPTFEDGELTYQAASPDEIAIVKFTESVGLSLFRRDRHSISLFHD 621

Query: 486 NSKRKY-MAVKVDSPANSGKHIIYVKGAFERILERSASFIGGAGKVEKLSDSHKSLINDC 544
           +S  K    +K+  P NS    + V   F+++ +       GA  V          + + 
Sbjct: 622 HSGMKLEYDIKILFPFNSDSKRMGVI-IFDKLKQEYWFLQKGADTVMSSIVVRNDWLEEE 680

Query: 545 AKSLASEGLRTLAFAQLECSTN------KPMNDSTI------------------QNLTFV 580
             ++A+EGLRTL   + + STN      K  +++++                   +L  +
Sbjct: 681 TSNMATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELL 740

Query: 581 GLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTA---------------VNIARQI 625
           GL G++D  +  V+ +IE L   G+ + M+TGD   TA               V+   ++
Sbjct: 741 GLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKV 800

Query: 626 GIP----------VINPEISVLT-----GDRLDQMTDDQLAGVIDHVNIFA-RATPEHKL 669
             P           +N    +L      G  L    D+    V++   + A R TP+ K 
Sbjct: 801 NKPEGALHHLEYLQVNQNSCLLIDGESLGLYLQYFPDEFFDIVVNLPTVVACRCTPQQKA 860

Query: 670 NI-VRALQKRGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVLT 721
           ++ V   Q  G  V   GDG ND   ++ AD+GV +       A  A+D  +T
Sbjct: 861 DVAVFIRQATGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSIT 913

>CAGL0L01419g 156123..159767 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           hypothetical start
          Length = 1214

 Score = 85.5 bits (210), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 141/628 (22%), Positives = 257/628 (40%), Gaps = 126/628 (20%)

Query: 156 PASCHLIRFGAETHVLASCLVPGDLVYF---KVGDRIPADVRIIESTDLSLDESTLTGET 212
           P + +++R G    +  + L+P D+V          +P D+ +++ T + ++E+ L+GE+
Sbjct: 251 PYAINVLRDGKWVEMQTNELLPMDVVSVVRTAEDSALPCDLILVDGTCI-VNEAMLSGES 309

Query: 213 EPVHKSCTPVNSATYSDVPGG---IIPIGERTSIAYMGTLVRE---------------GH 254
            P+ K    +        PG     I   ++ S+ + GT V +               G 
Sbjct: 310 TPLLKESIRLR-------PGNEELQIEGTDKISVLHGGTKVLQVTTPEKTGKVPSPPDGG 362

Query: 255 GKGIVVATGKHTMFGAVFE-MMNSIEKPKTPLQMAMDTLRRDLSYVRFVL------SGII 307
              IV  TG  T  G++   M+ S E+      + +D  +  L ++ F+L      S  +
Sbjct: 363 AIAIVTKTGFETSQGSLVRVMIYSSER------VGVDN-KEALYFILFLLIFAVVASWYV 415

Query: 308 FLLGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRLPSVET 367
           ++ G   GR   ++    + +  + +P  LP+ +T+ +   +  ++           +  
Sbjct: 416 WVEGTKMGRVQSKLILDCILIITSVVPPELPMELTMAVNSSLSALSKFYVYCTEPFRIPF 475

Query: 368 LGSVNVICSDKTGTLTANHMTASKIWCLGSMANKNNVLSLEAKSSGGLPGKLPNLKNYLS 427
            G ++V C DKTGTLT   +    +  L S  +  ++  L + +        PN  + + 
Sbjct: 476 AGRIDVCCFDKTGTLTGEDLVFEGLAGLSS--DPKDIRHLYSATD------CPNSTSLVV 527

Query: 428 DDVKATLRIGSICNNASFSHEHGKYLGNPTDIALLEVL----QKFDLV--DERPTTTRVD 481
               A +R+           E G+ +G+P + A L+ L    +K D V  ++    T + 
Sbjct: 528 GAAHALVRL-----------EDGEIVGDPMEKATLKALKWTVEKGDKVFNEKNGQVTILR 576

Query: 482 ELTFNSKRKYMAVKVDSPANSGKHIIYVKGAFERILERSASFIGGAGKVEKLSDSHKSLI 541
              F+S  K  +       + GK    VKGA E I ER  +      ++      +KS  
Sbjct: 577 RFQFSSALKRSS---SVATHDGKLYSAVKGAPETIRERLFTIPANYDEI------YKSFT 627

Query: 542 NDCAK--SLASEGLRTLAFAQLECSTNKPMNDSTIQNLTFVGLIGMKDPPRSTVRPAIEE 599
              ++  +LAS+ L  ++ +Q+E +  +       ++L F G +    P +      I+ 
Sbjct: 628 RSGSRVLALASKKLEKMSQSQIEDADREHFE----RDLEFNGFLIFHCPLKHDAIETIQM 683

Query: 600 LLQGGVHVIMITGDAENTAVNIARQIGI-------------------------PVINPEI 634
           L +     +MITGD   TAV++A+++GI                           ++ E 
Sbjct: 684 LNESAHRCVMITGDNPLTAVHVAKEVGIVKGETLIVDMVDNGNDDKLVFRNVEETLSFEF 743

Query: 635 SV-----------------LTGDRLDQMT-DDQLAGVIDHVNIFARATPEHKLNIVRALQ 676
            V                 +TG  L+ +    QL  +I H  I+AR +P  K  I+  L+
Sbjct: 744 VVSKDSFEKYGIFDKYDLAVTGHALEALKGHHQLQDLIRHAWIYARVSPAQKEFILNNLK 803

Query: 677 KRGDIVAMTGDGVNDAPALKLADIGVAM 704
             G    M GDG ND  ALK A +GVA+
Sbjct: 804 DMGYQTLMCGDGTNDVGALKQAHVGVAL 831

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 151/666 (22%), Positives = 257/666 (38%), Gaps = 148/666 (22%)

Query: 178 GDLVYFKVGDRIPADVRIIESTDLS----LDESTLTGETE-PVHKSCTPVNSATYSDVPG 232
           GDL+    G RIPAD+ +++S++ S    +    L GET+  +  +C+   + +  D+  
Sbjct: 269 GDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACSLTQNLSTDDLLN 328

Query: 233 GIIPIG---ERTSIAYMGTLVRE----------------------GHGKGIVVATGKHTM 267
            I       E++   ++G L  +                      G   G VV TG  T 
Sbjct: 329 KISITASSPEKSIHRFLGKLTYKDSSSNALSVDNTMWANTVLASVGSCIGCVVYTGTDTR 388

Query: 268 FGAVFEMMNSIEKPKTPLQMAMDTLRRDLSYVRFVLSGIIFLLGVIQGRSWLEMFQISVS 327
             A+   M+S++     L++ +++L + L    FVLS ++        + W     + + 
Sbjct: 389 -QAMNTTMSSVKTGL--LELEINSLSKILCACVFVLSIVLVAFAGFGNKDWY----VDIM 441

Query: 328 LAVAAIPEGLPIIVTVTLALGVLRMANR--------KAIVRRLPSVETLGSVNVICSDKT 379
             +      +P+ + V L LG    A +          IVR     E LG +  + SDKT
Sbjct: 442 RYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATIPDTIVRTSTIPEDLGRIEYLLSDKT 501

Query: 380 GTLTANHMTASKI------WCLGSMANKNNVLSLEAKSSGGLPGKLPNLKNYLSDDVKAT 433
           GTLT N M   K+      + + +M    + +     SS   P      K  L + V+  
Sbjct: 502 GTLTQNDMQLKKLHLGTVSYTMDTMDIVTDYVQELVSSSTTTPMPQSTAKKDLPNRVRDL 561

Query: 434 LRIGSICNNASFSHEHGKYL---GNPTDIALLEVLQKFDLV-------------DERPTT 477
           +   +IC+N + + E G+      +P +IA+++  +   L                  T 
Sbjct: 562 VVTLAICHNVTPTFEDGELTYQAASPDEIAIVKFTESVGLSLFKRDRHSVSLFHQHSATN 621

Query: 478 TRVDELT---FNSKRKYMAVKVDSPANSGKHIIYVKGA---FERILERSASFIGGAGKVE 531
              D L    FNS  K M + V      G+H    KGA     RI++ +           
Sbjct: 622 FEYDILQVFPFNSDTKRMGIIVYDKVK-GEHWFMQKGADTVMARIVQSN----------- 669

Query: 532 KLSDSHKSLINDCAKSLASEGLRTLAFAQLECSTN------KPMNDSTI----------- 574
                    +++   ++A EGLRTL   + + S        K  +D+++           
Sbjct: 670 -------DWLDEEVGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSS 722

Query: 575 -------QNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTA--------- 618
                   NL  +GL G++D  ++ V+ +IE L   GV + M+TGD   TA         
Sbjct: 723 VIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKL 782

Query: 619 ------VNIARQIGIP----------VINPEISVLT-----GDRLDQMTDDQLAGVIDHV 657
                 V+   ++  P           IN    +L      G  L     +    V+D  
Sbjct: 783 ISRGQYVHTVTKLSRPEGALNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLP 842

Query: 658 NIFA-RATPEHKLNIVRALQK-RGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEA 715
            + A R TP+ K ++   +++  G  V   GDG ND   ++ AD+GV +       A  A
Sbjct: 843 AVIACRCTPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLA 902

Query: 716 SDMVLT 721
           +D  +T
Sbjct: 903 ADFSVT 908

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           start by similarity
          Length = 1206

 Score = 84.3 bits (207), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 144/644 (22%), Positives = 247/644 (38%), Gaps = 121/644 (18%)

Query: 156 PASCHLIRFGAETHVLASCLVPGDLVYF---KVGDRIPADVRIIESTDLSLDESTLTGET 212
           P + ++ R G    +    L P DLV          IP D+ +I+ + + ++E+ L+GE+
Sbjct: 252 PYAINVFRDGKWVEMQTDKLFPMDLVSITRTAEDSAIPCDLLLIDGSCI-VNEAMLSGES 310

Query: 213 EPVHKSCTPVNSATYSDVPGGIIPIGERTSIAYMGTLVRE---------------GHGKG 257
            P+ K    +  A       G+    ++ ++ + GT   +               G    
Sbjct: 311 TPLLKESIKLRPANDQLQLDGV----DKNAVLHGGTKALQVTAPENRTGVITPPDGGALA 366

Query: 258 IVVATGKHTMFGAVFE-MMNSIEKPKTPLQMAMDTLRRDLSYVRFVLSGIIFLLGVIQGR 316
           +V  TG  T  G++   M+ S E+     + A+  +   L +   V S  ++  G   GR
Sbjct: 367 VVTKTGFETSQGSLVRVMIFSAERVDVGNKEALYFILFLLIFA-IVASWYVWKEGTRMGR 425

Query: 317 SWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRLPSVETLGSVNVICS 376
              ++    + +  + +P  LP+ +T+ +   +  ++           +   G ++V C 
Sbjct: 426 IQSKLILDCILIITSVVPPELPMELTMAVNSSLAALSKFYVYCTEPFRIPYAGRIDVCCF 485

Query: 377 DKTGTLTANHMTASKIWCLGSMANKNNVLSLEAKSSGGLPGKLPNLKNYLSDDVKATLRI 436
           DKTGTLTA  +       L  + + +++ +L++              N  S +V +   I
Sbjct: 486 DKTGTLTAEDLVFEG---LAGLHDGSDIRTLKSA-------------NDASQEVLSA--I 527

Query: 437 GSICNNASFSHEHGKYLGNPTDIALLEVLQKFDLVDERPTTTRVDELTFNSKRKY----- 491
           G+   +A    + G+ +G+P + A L+       VD +    R         R++     
Sbjct: 528 GAA--HALVKLDDGEIVGDPMEKATLKASSW--TVDFKDVVKRAGADNIRILRRFQFSSS 583

Query: 492 MAVKVDSPANSGKHIIYVKGAFERILERSASFIGGAGKVEKLSDSHKSLINDCAKSLASE 551
           +       + S +    VKGA E I ER               +S  S  +D  KS    
Sbjct: 584 LKRSASIASQSNRFFAAVKGAPETIRERL--------------NSVPSDYDDIYKSFTRS 629

Query: 552 GLRTLAFAQLECSTNKPMNDSTIQN---------LTFVGLIGMKDPPRSTVRPAIEELLQ 602
           G R LA A  +      M++S I N         LTF   +    P +      I+ L +
Sbjct: 630 GSRVLALAYKDLPK---MSNSQIDNIDRDEIETGLTFGAFLVFHCPLKDDAIETIKMLNE 686

Query: 603 GGVHVIMITGDAENTAVNIARQIGI----------PV-------------------INPE 633
                IMITGD   TAV++A+++GI          P+                    NP+
Sbjct: 687 SSHRSIMITGDNPLTAVHVAKEVGIVDRETLILDEPIDGSSHALVMRDVNETIVKPFNPD 746

Query: 634 ISVLTGDRLDQMTD--------------DQLAGVIDHVNIFARATPEHKLNIVRALQKRG 679
                   + Q  D               QL  VI H  I+AR +P  K  I+  L+  G
Sbjct: 747 ADTFDEKEIFQKYDLAVTGHALKLLQGHKQLRDVIRHTWIYARVSPSQKEFILITLKDMG 806

Query: 680 DIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVLTDD 723
               M GDG ND  ALK A +G+A+ +   D  K+  +    D+
Sbjct: 807 YQTLMCGDGTNDVGALKQAHVGIALLNGTEDSLKKLQEQRKIDN 850

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
           (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 83.2 bits (204), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 134/604 (22%), Positives = 246/604 (40%), Gaps = 115/604 (19%)

Query: 175 LVPGDLVYFKVGDR---IPADVRIIESTDLSLDESTLTGETEPVHKSCTPVNSATYSDVP 231
           L+P DL+     D    +  D+ +++ T + ++E+ L+GE+ P+ K    + S+      
Sbjct: 272 LLPMDLISVTRTDEDSALSCDMILVDGTCI-VNEAMLSGESTPLLKESVKLRSSEEKLQV 330

Query: 232 GGIIPIGERTSIAYMGTLVRE----------------GHGKGIVVATGKHTMFGAVFE-M 274
            G+    ++ S+ + GT V +                G    +V  TG  T  GA+   M
Sbjct: 331 EGL----DKNSVLHGGTKVLQVTAPEKGSSSIPAPPDGGALAVVSKTGFETSQGALVRVM 386

Query: 275 MNSIEKPKTPLQMAMDTLRRDLSYVRFVL------SGIIFLLGVIQGRSWLEMFQISVSL 328
           + S E+     + A       L ++ F+L      S  +++ G   GR   ++    + +
Sbjct: 387 IYSSERVSVGNKEA-------LYFILFLLIFAIAASWYVWVEGTRMGRVQSKLILDCILI 439

Query: 329 AVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRLPSVETLGSVNVICSDKTGTLTANHMT 388
             + +P  LP+ +T+ +   +  ++           +   G ++V C DKTGTLT   + 
Sbjct: 440 ITSVVPSELPMELTMAVNNSLAVLSKFYVYCTEPFRIPLAGRIDVCCFDKTGTLTGEDLV 499

Query: 389 ASKIWCLGSMANKNNVLSLEAKSSGGLPGKLPNLKNYLSDDVKATLRIGSICNNASFSHE 448
                 L  +A KN  ++   K +     ++P   N +     A +R+           +
Sbjct: 500 FEG---LAGLAGKNQPVNHLFKGT-----EVPLDTNLVIGAAHALVRL-----------D 540

Query: 449 HGKYLGNPTDIALLEVLQKFDLVDERPTTTRVDELTFNSKRKYM-AVKVDS--PANSGKH 505
             + +G+P + A L        V +  +  +V +++   + ++  A+K  S    ++ +H
Sbjct: 541 DDEVVGDPMEKATLAATGWKVGVKDSLSNEKVGDISILRRFQFSSALKRSSTIAVHNKQH 600

Query: 506 IIYVKGAFERILERSASFIGGAGKVEKLSDSHKSLINDCAK--SLASEGLRTLAFAQLEC 563
              VKGA E I ER +       +V      +KS     ++  +LAS+ L +++  Q+E 
Sbjct: 601 YSAVKGAPETIRERLSQVPTDYDQV------YKSFTRAGSRVLALASKKLPSMSIKQIE- 653

Query: 564 STNKPMNDSTIQNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIAR 623
              K   ++   +L F G +    P +      I+ L +     IMITGD   TAV++A+
Sbjct: 654 ---KLEREAVESDLEFKGFLVFHCPLKDDAIETIKMLNESSHRCIMITGDNPLTAVHVAK 710

Query: 624 QIGI----------PV-------------------INPEISVLTGDRLDQMTD------- 647
           ++ I          P+                    NPE       +L    D       
Sbjct: 711 EVAIVERETLILDEPIDGSSHALVFRNIEETIVNPFNPEKDTFEHSKLFAKYDIAVTGHA 770

Query: 648 -------DQLAGVIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADI 700
                   QL  +I H  ++AR +P  K  I+ +L+  G    M GDG ND  ALK A +
Sbjct: 771 LQLLSGHSQLNELIRHTWVYARVSPAQKEFIMNSLKDMGYQTLMCGDGTNDVGALKQAHV 830

Query: 701 GVAM 704
           G+A+
Sbjct: 831 GIAL 834

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the
           Drs2p-like ATPases family in the superfamily of P-type
           ATPases, overproduction confers neomycin resistance
           [3456 bp, 1151 aa]
          Length = 1151

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 148/653 (22%), Positives = 261/653 (39%), Gaps = 118/653 (18%)

Query: 178 GDLVYFKVGDRIPADVRIIESTDLS----LDESTLTGETEPVHKSCTPVNS--------- 224
           GDL+    GDRIPAD+ +++S++ S    +    L GET+   +   P+           
Sbjct: 273 GDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSENDLIN 332

Query: 225 -------------------ATYSDVPGGIIPIGERTSIAYMGTLVREGHGKGIVVATGKH 265
                               TY D      P+    ++     L   G     VV TG+ 
Sbjct: 333 RISITASAPEKSIHKFLGKVTYKDSTSN--PLSVDNTLWANTVLASSGFCIACVVYTGRD 390

Query: 266 TMFGAVFEMMNSIEKPKTPL-QMAMDTLRRDLSYVRFVLSGIIFLLGVIQGRSWLEMFQI 324
           T       M  +  K KT L ++ ++++ + L    F LS ++          W      
Sbjct: 391 TRQA----MNTTTAKVKTGLLELEINSISKILCACVFALSILLVAFAGFHNDDWYIDILR 446

Query: 325 SVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAI----VRRLPSVETLGSVNVICSDKTG 380
            + L    IP  L + + +  ++   ++ + K I    VR     E LG +  + SDKTG
Sbjct: 447 YLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTG 506

Query: 381 TLTANHMTASKIWCLGSMANKNNVL--------SLEAKSSGGLPGK---LPNLKNYLSDD 429
           TLT N M   KI  LG+++  +  L        SL +  +  L      L   +  +S  
Sbjct: 507 TLTQNDMQLKKI-HLGTVSYTSETLDIVSDYVQSLVSSKNDSLNNSKVALSTTRKDMSFR 565

Query: 430 VKATLRIGSICNNA--SFSHEHGKY-LGNPTDIALLEVLQKFDLVDERPTTTRVDELTFN 486
           V+  +   +IC+N   +F  +   Y   +P +IA+++  +   L   +     +  L  +
Sbjct: 566 VRDMILTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKRDRHSISLLHEH 625

Query: 487 SKR--KYMAVKVDSPANSGKHIIYVKGAFERILERSASFIGGAGKVEKLSDSHKSLINDC 544
           S +   Y  ++V  P NS    + +    E++ E      G    + K+ +S+  L  + 
Sbjct: 626 SGKTLNYEILQV-FPFNSDSKRMGIIVRDEQLDEYWFMQKGADTVMSKIVESNDWLEEET 684

Query: 545 AKSLASEGLRTLAFAQLECST------NKPMNDSTI------------------QNLTFV 580
             ++A EGLRTL   + + +        K  ND+++                   +L  +
Sbjct: 685 G-NMAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELL 743

Query: 581 GLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTA--VNIARQI---------GIPV 629
           GL G++D  +  V+ +IE L   G+ + M+TGD   TA  V+I+ ++            V
Sbjct: 744 GLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTITKV 803

Query: 630 INPEIS---------------VLTGDRLD---QMTDDQLAGVIDHVN--IFARATPEHKL 669
             PE +               ++ G+ L    +  + +   V+ H+   I  R TP+ K 
Sbjct: 804 TRPEGAFNQLEYLKINRNACLLIDGESLGMFLKHYEQEFFDVVVHLPTVIACRCTPQQKA 863

Query: 670 NIVRALQK-RGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVLT 721
           ++   ++K  G  V   GDG ND   ++ AD+GV +       A  A+D  +T
Sbjct: 864 DVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSIT 916

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
           cerevisiae YDR270w CCC2 probable copper-transporting
           ATPase, start by similarity
          Length = 975

 Score = 80.1 bits (196), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 75/148 (50%), Gaps = 29/148 (19%)

Query: 578 TFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVINPEISVL 637
           + VG   + D  +      +E L   G+   M+TGDA  +A+ +A+Q+GI          
Sbjct: 740 SLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQLGISA-------- 791

Query: 638 TGDRLDQMTDDQLAGVIDHVNIFARATPEHKLNIVRALQKRG-DIVAMTGDGVNDAPALK 696
                               ++F+  TPE K +IV  LQ  G + VA  GDG+ND+PAL 
Sbjct: 792 -------------------NDVFSEVTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALV 832

Query: 697 LADIGVAMGHMGTDVAKEASDMVLTDDD 724
            AD+G+++   GTD+A EA+D+V+ D D
Sbjct: 833 EADLGISISS-GTDIAIEAADIVILDSD 859

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 66/266 (24%), Positives = 111/266 (41%), Gaps = 45/266 (16%)

Query: 143 RSEKS--LEALHKLVPASCHLIR-FGAETHVLASCLVPGDLVYFKVGDRIPADVRIIEST 199
           +SE S  +  L  L P+SC ++   G+   +    L P D+V    G +IPAD  +I + 
Sbjct: 391 KSETSTAMSKLISLTPSSCSIVLPDGSTREISVELLQPNDIVEVVPGMKIPADGVVIRN- 449

Query: 200 DLSLDESTLTGETEPVHKSCTPVNSATYSDVPGGIIPIGERTSIAYMGTLVREGHGKGIV 259
           +  +DES +TGE+  V K          S V GG              ++   GH     
Sbjct: 450 ETEVDESLITGESMLVEK-------IVGSQVIGG--------------SVNGPGHFYFRA 488

Query: 260 VATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRRDLSYVRFV--LSGIIFLLGVI---- 313
           +  G+ T    +   M   +  K P+Q   D +     +V FV  LS I F+  ++    
Sbjct: 489 IRVGEDTKLANIIATMKKAQLSKAPIQKYADKMAG--IFVPFVISLSAITFITWMLVSYT 546

Query: 314 -----------QGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRL 362
                       G+ ++ M Q+S+S+ + A P  L +     + +G    A+   +++  
Sbjct: 547 MKTPPLIFNSENGKFFMCM-QMSISVIIVACPCALGLAAPTAIMVGTGVGASHGVLIKGG 605

Query: 363 PSVETLGSVNVICSDKTGTLTANHMT 388
             +E   ++     DKTGTLT   M+
Sbjct: 606 DVLEKCSALQTFLFDKTGTLTTGRMS 631

>Scas_583.14*
          Length = 875

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 128/516 (24%), Positives = 212/516 (41%), Gaps = 110/516 (21%)

Query: 254 HGKGIVVA-TGKHTMFGAVFE-MMNSIEKPKTPLQMAMDTLRRDLSYVRFVL------SG 305
           HG  +VV  TG  T  G++   M+ S E+      + +D  +  L ++ F+L      S 
Sbjct: 17  HGALVVVTKTGFETYQGSLVRVMIYSAER------VGVDN-KEALMFILFLLNFAVVASW 69

Query: 306 IIFLLGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRLPSV 365
            +++ G   GR   ++    + +    +P  LP+ +T+ +   +  ++           +
Sbjct: 70  YVWVEGTKMGRIQSKLILDCILIITYVVPPELPMELTMAVNSSLAALSKFYVYCTEPFRI 129

Query: 366 ETLGSVNVICSDKTGTLTANHMTASKIWCLGSMANKNNVLSLEAKSSGGLPGKLPNLKNY 425
              G ++V C DKTGTLT   +    +                     GL  K  ++++ 
Sbjct: 130 PLAGRIDVCCFDKTGTLTGEDLVFEGL--------------------AGLSDKSEDVRHL 169

Query: 426 LSDD---VKATLRIGSICNNASFSHEHGKYLGNPTDIALLEVL-QKFDLVD--ERPTTTR 479
            S +    +  L +G+   +A    + G+ +G+P + A L+ L  K +  D   RP T +
Sbjct: 170 FSSEDASQETILVVGAA--HALVKLDDGEIVGDPMEKATLKALGWKVEGNDFTSRPKTGK 227

Query: 480 VDELTFNSKRKYM---AVKVDSPANSGKHIIY--VKGAFERILERSASFIGGAGKVEKLS 534
           +  L     R++    A+K  S   S K  ++  VKGA E I ER A        V K  
Sbjct: 228 LQIL-----RRFQFSSALKRSSSVASHKDKLFTAVKGAPETIRERLAV-------VPKNY 275

Query: 535 DS-HKSLINDCAK--SLASEGLRTLAFAQLECSTNKPMNDSTIQNLTFVGLIGMKDPPRS 591
           D  +KS     ++  +LAS+ L  L+  QL+        D     LTF G +    P + 
Sbjct: 276 DEIYKSFTRSGSRVLALASKSLPNLSSKQLDDLDR----DEIETGLTFNGFLVFHCPLKP 331

Query: 592 TVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPV-------------------INP 632
                I+ L +     IMITGD   TAV++A+++ I                      N 
Sbjct: 332 DAVETIKMLNESAHRSIMITGDNPLTAVHVAKEVAIVTGETLILDKSETVGDGKLLFFNV 391

Query: 633 EISV-----------------------LTGDRLDQMTD-DQLAGVIDHVNIFARATPEHK 668
           E ++                       +TG  L+ + D  QL  +I H  ++AR +P  K
Sbjct: 392 EETIKIPFDPASDKFDHRELFDKYDIAVTGYALNLLEDHSQLKDLIRHTWVYARVSPSQK 451

Query: 669 LNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAM 704
             I+  L++ G    M GDG ND  ALK A +GVA+
Sbjct: 452 EFILNNLKEMGYQTLMCGDGTNDVGALKQAHVGVAL 487

>YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transporting
           P-type ATPase, member of the heavy-metal transporting
           P-type ATPases in the superfamily of P-type ATPases
           [3015 bp, 1004 aa]
          Length = 1004

 Score = 78.6 bits (192), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 124/597 (20%), Positives = 229/597 (38%), Gaps = 126/597 (21%)

Query: 143 RSEKSLEALHKLVPASCHLI---RFGAETHVLASCLVPGDLVYFKVGDRIPADVRIIEST 199
           ++  +L  L +L P+ C +I          +    L   D+V  K G +IPAD  II   
Sbjct: 396 QTSTALSKLIQLTPSVCSIISDVERNETKEIPIELLQVNDIVEIKPGMKIPAD-GIITRG 454

Query: 200 DLSLDESTLTGETEPVHKSCTPVNSATYSDVPGGIIPIGERTSIAYM-GTLVREGHGKGI 258
           +  +DES +TGE+                      I + ++T    + G++   GH    
Sbjct: 455 ESEIDESLMTGES----------------------ILVPKKTGFPVIAGSVNGPGHFYFR 492

Query: 259 VVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRRDLSYVRFVLSGIIFLLGVIQGRSW 318
               G+ T    + ++M   +  K P+Q   D       Y+  +    I +L V+    W
Sbjct: 493 TTTVGEETKLANIIKVMKEAQLSKAPIQGYAD-------YLASIFVPGILILAVLTFFIW 545

Query: 319 LEMFQISVS--LAVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRLPSVETLGSVNVICS 376
             +  IS +  +A  A  +     + +  A  V+ +A   A+    P+   +G       
Sbjct: 546 CFILNISANPPVAFTANTKADNFFICLQTATSVVIVACPCALGLATPTAIMVG------- 598

Query: 377 DKTGTLTANHMTASKIWCLGSMANK-NNVLSLEAKSSGGLPGKLPNLKNYLSDDVKATLR 435
             TG    N +        G +  K N++ +     +G L      +K +L D       
Sbjct: 599 --TGVGAQNGVLIKG----GEVLEKFNSITTFVFDKTGTLTTGFMVVKKFLKDS------ 646

Query: 436 IGSICNNASFSHEHGKYLGNPTDIALLEVLQKFDLVDERPTTTRVDELT--FNSKRKYMA 493
                           ++GN  +  +L  ++  + + + P +  +       N  +   A
Sbjct: 647 ---------------NWVGNVDEDEVLACIKATESISDHPVSKAIIRYCDGLNCNKALNA 691

Query: 494 VKVDSPANSGKHIIYVKGAFERILERSASFIGGAGKVEKLSDSHKSLINDCAKSLASEGL 553
           V ++S    GK I+                     K +   +++   I + A  L  + L
Sbjct: 692 VVLESEYVLGKGIV--------------------SKCQVNGNTYDICIGNEALIL-EDAL 730

Query: 554 RTLAFAQLECSTNKPMNDSTIQNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGD 613
           +   F          ++  ++    F GL  + D  +      ++ L + G    MITGD
Sbjct: 731 KKSGFINSNVDQGNTVSYVSVNGHVF-GLFEINDEVKHDSYATVQYLQRNGYETYMITGD 789

Query: 614 AENTAVNIARQIGIPVINPEISVLTGDRLDQMTDDQLAGVIDHVNIFARATPEHKLNIVR 673
             + A  +AR++G                           I   N+++  +P  K ++V+
Sbjct: 790 NNSAAKRVAREVG---------------------------ISFENVYSDVSPTGKCDLVK 822

Query: 674 ALQKR--GDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMV-LTDDDFST 727
            +Q +   + VA+ GDG+NDAPAL L+D+G+A+   GT++A EA+D+V L  +D +T
Sbjct: 823 KIQDKEGNNKVAVVGDGINDAPALALSDLGIAIS-TGTEIAIEAADIVILCGNDLNT 878

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative
           Ca2+-transporting ATPase, member of the P-type ATPase
           superfamily of membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score = 77.4 bits (189), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 138/628 (21%), Positives = 255/628 (40%), Gaps = 126/628 (20%)

Query: 156 PASCHLIRFGAETHVLASCLVPGDLVYF-KVGDR--IPADVRIIESTDLSLDESTLTGET 212
           P + ++ R      +  + L+P DLV   +  +   IP D+ +++ + + ++E+ L+GE+
Sbjct: 253 PYTINVFRNKKWVALQTNELLPMDLVSITRTAEESAIPCDLILLDGSAI-VNEAMLSGES 311

Query: 213 EPVHKSCTPVNSATYSDVPGGIIPIGERTSIAYMGTLVRE---------------GHGKG 257
            P+ K    +  +  +    G+    ++ ++ + GT   +               G    
Sbjct: 312 TPLLKESIKLRPSEDNLQLDGV----DKIAVLHGGTKALQVTPPEHKSDIPPPPDGGALA 367

Query: 258 IVVATGKHTMFGAVFE-MMNSIEKPKTPLQMAMDTLRRDLSYVRFVL------SGIIFLL 310
           IV  TG  T  G++   M+ S E+      +++D  +  L ++ F+L      S  +++ 
Sbjct: 368 IVTKTGFETSQGSLVRVMIYSAER------VSVDN-KEALMFILFLLIFAVIASWYVWVE 420

Query: 311 GVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRLPSVETLGS 370
           G   GR   ++    + +  + +P  LP+ +T+ +   +  +A           +   G 
Sbjct: 421 GTKMGRIQSKLILDCILIITSVVPPELPMELTMAVNSSLAALAKFYVYCTEPFRIPFAGR 480

Query: 371 VNVICSDKTGTLTANHMTASKIWCLGSMANKNNVLSLEAKSSGGLPGKLPNLKNYLSDDV 430
           ++V C DKTGTLT   +    +   G  A+  N+  L + +        P          
Sbjct: 481 IDVCCFDKTGTLTGEDLVFEGL--AGISADSENIRHLYSAAEA------PE--------- 523

Query: 431 KATLRIGSICNNASFSHEHGKYLGNPTDIALLEVLQKFDLVDERPTTTRVDELTFNSKRK 490
              L IG+   +A    E G  +G+P + A L+ +     V+ + +  R      +  R+
Sbjct: 524 STILVIGAA--HALVKLEDGDIVGDPMEKATLKAVGW--AVERKNSNYREGTGKLDIIRR 579

Query: 491 YM---AVKVDSPANSGKHIIY--VKGAFERILERSASFIGGAGKVEKLSDSHKSLINDCA 545
           +    A+K  +   S    ++  VKGA E I ER             LSD  K+  ++  
Sbjct: 580 FQFSSALKRSASIASHNDALFAAVKGAPETIRER-------------LSDIPKNY-DEIY 625

Query: 546 KSLASEGLRTLAFA-----QLECSTNKPMNDSTIQN-LTFVGLIGMKDPPRSTVRPAIEE 599
           KS    G R LA A     ++  S    +N   +++ LTF G +    P +      I+ 
Sbjct: 626 KSFTRSGSRVLALASKSLPKMSQSKIDDLNRDDVESELTFNGFLIFHCPLKDDAIETIKM 685

Query: 600 LLQGGVHVIMITGDAENTAVNIARQIGIPV---------------------INPEISV-- 636
           L +     IMITGD   TAV++A+++GI                       +   +S+  
Sbjct: 686 LNESSHRSIMITGDNPLTAVHVAKEVGIVFGETLILDRAGKSDDNQLLFRDVEETVSIPF 745

Query: 637 -------------------LTGDRLDQMT-DDQLAGVIDHVNIFARATPEHKLNIVRALQ 676
                              +TG  L+ +    QL  ++ H  ++AR +P  K  ++  L+
Sbjct: 746 DPSKDTFDHSKLFDRYDIAVTGYALNALEGHSQLRDLLRHTWVYARVSPSQKEFLLNTLK 805

Query: 677 KRGDIVAMTGDGVNDAPALKLADIGVAM 704
             G    M GDG ND  ALK A +G+A+
Sbjct: 806 DMGYQTLMCGDGTNDVGALKQAHVGIAL 833

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH]
           (544854..548354) [3501 bp, 1166 aa]
          Length = 1166

 Score = 76.3 bits (186), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 156/675 (23%), Positives = 268/675 (39%), Gaps = 151/675 (22%)

Query: 173 SCLVP------GDLVYFKVGDRIPADVRIIESTDLS----LDESTLTGETE--------- 213
           S LVP      GDLV      RIPAD+ +++S++ S    +    L GET+         
Sbjct: 280 SQLVPSKNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSL 339

Query: 214 -----------PVHKSCTPVNSATYS-----DVPGGIIPIGERTSIAYMGTLVREGHGKG 257
                       VH + +    + +         G   P+    ++     L   G    
Sbjct: 340 TQNLTQDEMLTKVHITASAPEKSIHMFTGKLTYKGSSAPLSVDNTLWANTVLASSGTCVA 399

Query: 258 IVVATGKHTMFGAVFEMMNSIEKPKTPL-QMAMDTLRRDLSYVRFVLSGIIFLLGVIQGR 316
            V+ TG  T       M  S    KT L ++ +++L + L    F LS ++ ++G +   
Sbjct: 400 CVIYTGTDTRQA----MNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVIGGLDDD 455

Query: 317 SWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAI----VRRLPSVETLGSVN 372
            W       + L    IP  L + + +  ++   ++ + K+I    VR     E LG + 
Sbjct: 456 KWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTSTIPEDLGRIE 515

Query: 373 VICSDKTGTLTANHMTASKIWCLGSMAN--------KNNVLSLEAKSSGGLPG-KLPNLK 423
            + SDKTGTLT N M   KI  LG+++          + + +L + ++ G  G  +   +
Sbjct: 516 YLLSDKTGTLTQNDMQLRKI-HLGTVSYTMETMDMVTDYIQTLTSPANMGAAGVAVTGSR 574

Query: 424 NYLSDDVKATLRIGSICNNASFSHEHGKY---LGNPTDIALLEVLQKFDLV---DERPTT 477
             +S  V+  +   + C+N + + E  +      +P +IA+++  ++  L     +R + 
Sbjct: 575 KEVSQRVRDLVVTLATCHNVTPNFEDNELAYQAASPDEIAIVKFTERVGLSLFKRDRHSL 634

Query: 478 TRVDELT-------------FNSKRKYMAVKVDSPANSGKHIIYVKGAFERILERSASFI 524
           T   E +             F S  K M + V    +  K+ I+        L++ A  +
Sbjct: 635 TLFHEYSGVNLQYDILHVFPFTSDTKRMGIIV---RDRTKNEIW-------FLQKGADTV 684

Query: 525 GGAGKVEKLSDSHKSLINDCAKSLASEGLRTLAFAQLECST------NKPMNDSTI---- 574
                + K+  S+  L  + + ++A EGLRTL  A+ + ST      +K   D+++    
Sbjct: 685 -----MSKIVQSNDWLEEEVS-NMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLSMLN 738

Query: 575 --------------QNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVN 620
                          NL  +GL G++D  +  V+ +IE L   GV + M+TGD   TA  
Sbjct: 739 RDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVETARC 798

Query: 621 I---ARQIGIPVINPEISVLTG-----DRLDQMT----------DDQLAGVIDH------ 656
           +   A+ I        I+ LT       RL+ +            D LA  + H      
Sbjct: 799 VCVSAKLISRGQYVHTITKLTRRDGALSRLEYLKANRNSCLLIDGDSLAIYMSHYRAEFF 858

Query: 657 -------VNIFARATPEHKLNIVRALQK-RGDIVAMTGDGVNDAPALKLADIGVAMGHMG 708
                  V I  R TP+ K ++   +++  G  V   GDG ND   ++ AD+GV +    
Sbjct: 859 EIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCIGDGGNDVSMIQCADVGVGI---- 914

Query: 709 TDVAKEASDMVLTDD 723
             V KE     L  D
Sbjct: 915 --VGKEGKQASLAAD 927

>Scas_704.38
          Length = 1161

 Score = 76.3 bits (186), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 153/692 (22%), Positives = 268/692 (38%), Gaps = 169/692 (24%)

Query: 169 HVL-ASCLVP------GDLVYFKVGDRIPADVRIIESTDLS----LDESTLTGETE---- 213
           HVL  S LVP      GDL+    GDR+PAD+ +++S++ S    +    L GET+    
Sbjct: 267 HVLNQSKLVPSKDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLR 326

Query: 214 ------------------------PVHKSCTPVNSATYSDVPGGIIPIGERTSIAYMGTL 249
                                   P       +   TY D      P+    ++     L
Sbjct: 327 IAPALTQNLTEPDLMNKVSITASAPEKAIHNFLGKVTYKDTSSN--PLSIDNTLWANTVL 384

Query: 250 VREGHGKGIVVATGKHTMFGAVFEMMNSIEKP-KTPL-QMAMDTLRRDLSYVRFVLSGII 307
              G   G VV TG+ T      + MN+     KT L ++ ++++ + L    F LS I+
Sbjct: 385 ASTGFCIGCVVYTGRDTR-----QAMNTTTATVKTGLLELEINSISKILCASVFALSIIL 439

Query: 308 FLLGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANR--------KAIV 359
            +        W     + V   +      +P+ + V L L     A++        + IV
Sbjct: 440 VVFAGFHNSDWY----LDVMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDDTIPETIV 495

Query: 360 RRLPSVETLGSVNVICSDKTGTLTANHMTASKIWCLGSMANKNNVLSL---------EAK 410
           R     E LG +  + SDKTGTLT N M   KI  LG+++  +  L +          + 
Sbjct: 496 RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIH-LGTVSYTSETLDIVSDYVDALVNSS 554

Query: 411 SSGGLPGK-LPNL-KNYLSDDVKATLRIGSICNNA--SFSHEHGKY-LGNPTDIALLEVL 465
           +S    GK +P+  +  LS  V+  +   +IC+N   +F  +   Y   +P +IA+++  
Sbjct: 555 NSANPSGKSVPSTSRKDLSARVRDMVVTLAICHNVTPTFEDDELTYQAASPDEIAIVKFT 614

Query: 466 QKFDLV----DERP------------TTTRVDELTFNSKRKYMAVKVDSPANSGKHIIYV 509
           +   L     D               T   +    FNS  K M + V       ++    
Sbjct: 615 ESVGLSLFKRDRHSISLLHGHSGSILTYEILQVFPFNSDSKRMGIIVHD-EQKDEYWFMQ 673

Query: 510 KGA---FERILERSASFIGGAGKVEKLSDSHKSLINDCAKSLASEGLRTLAFAQLECSTN 566
           KGA     RI+E                  +   + +   ++A EGLRTL   + + S N
Sbjct: 674 KGADTVMARIVE------------------NNDWLEEETGNMAREGLRTLVVGRKKLSRN 715

Query: 567 ------KPMNDSTIQ------------------NLTFVGLIGMKDPPRSTVRPAIEELLQ 602
                 K  +D+++                   +L  +GL G++D  ++ V+ +IE L  
Sbjct: 716 IYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRN 775

Query: 603 GGVHVIMITGDAENTAVNIARQIGIPVINPEISVLTG--------DRLDQMTDDQLAGVI 654
            G+ + M+TGD   TA  ++    +      + ++T         ++L+ +  ++ A ++
Sbjct: 776 AGIKIWMLTGDKVETARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKVNKGACLL 835

Query: 655 ---DHVNIF--------------------ARATPEHKLNIVRALQK-RGDIVAMTGDGVN 690
              + + +F                     R TP+ K ++   +++  G  V   GDG N
Sbjct: 836 IDGESLGMFLRYYKREFFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVCCIGDGGN 895

Query: 691 DAPALKLADIGVAMGHMGTDVAKEASDMVLTD 722
           D   ++ AD+GV +       A  A+D  +T+
Sbjct: 896 DVSMIQCADVGVGIVGKEGKQASLAADFSITE 927

>ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH]
           (511968..514400) [2433 bp, 810 aa]
          Length = 810

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 84/172 (48%), Gaps = 32/172 (18%)

Query: 576 NLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVINPEIS 635
           N   +G   + D  R      ++ LL  G +V M+TGD    A++++  +GIP +N    
Sbjct: 576 NDVLLGRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGIP-LN---- 630

Query: 636 VLTGDRLDQMTDDQLAGVIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPAL 695
                                 N+F+   PE K +++R L+++ D VA  GDG+ND+ AL
Sbjct: 631 ----------------------NVFSERLPEGKCDVLRQLRQKYDYVAFIGDGINDSVAL 668

Query: 696 KLADIGVAMGHMGTDVAKEASDMVLTDDD----FSTILTAIEEGKGIFNNIQ 743
             +D+G+++    +D+  +A+ +V+ D       + IL AI+  +  FN ++
Sbjct: 669 AESDLGISLSG-NSDIVADAAGIVVLDHSSAPPLTRILYAIDLARATFNRVK 719

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 64/269 (23%), Positives = 112/269 (41%), Gaps = 39/269 (14%)

Query: 127 TLAVVIVVSVGFVQEYRSE-KSLEALHKLV---PASCHLIRFGAETHVLASCLVPGDLVY 182
           T+ +V  + VG + E R+  ++ ++L ++V   P+ C +   G++  V    L  GD+V 
Sbjct: 218 TVMLVAFICVGKLLESRARARAADSLARMVSSAPSMCTIRESGSDREVEVELLQAGDVVV 277

Query: 183 FKVGDRIPADVRIIESTDLSLDESTLTGETEPVHKSCTPVNSATYSDVPGGIIPIGERTS 242
            + G ++PAD  ++E  +  +DES +TGE+  V K             PG  +  G    
Sbjct: 278 MRPGTKLPADGTVLEG-EAEVDESLMTGESTLVPK------------YPGSRVLCGSVNG 324

Query: 243 IAYMGTLVREGHGKGIVVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRRD------- 295
            A  G L R           G+ T    +   M   +  K P+Q   D L          
Sbjct: 325 AA--GFLYRAD-------LVGEETRLAGIVAAMKQAQLAKAPIQRYADFLASWFIPSVLI 375

Query: 296 LSYVRFVLSGIIFLL-----GVIQGRSWLEMF-QISVSLAVAAIPEGLPIIVTVTLALGV 349
           L+ + FV   +I  L      +    + L +  +I++++ V A P  L +     + +G 
Sbjct: 376 LALLTFVCWMLICTLLATPPSIFNNSNRLYVCSRIAITVIVVACPCPLGLAAPTAIMVGT 435

Query: 350 LRMANRKAIVRRLPSVETLGSVNVICSDK 378
              A R  + +    +ET  +V  I  DK
Sbjct: 436 GLGAERGLLFKGGDVIETAAAVQAILFDK 464

>KLLA0D04092g complement(344666..348124) some similarities with
            sp|P38995 Saccharomyces cerevisiae YDR270w CCC2 probable
            copper-transporting ATPase P16.2.f2.1, hypothetical start
          Length = 1152

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 68/237 (28%), Positives = 116/237 (48%), Gaps = 40/237 (16%)

Query: 537  HKSLINDCAKSLASEGLRTLAFAQLECSTNKPMNDSTIQNLTFVG--------LIGMKDP 588
            ++ L+ D    L SE L+ LA  +   +  K +  + I++ ++ G        +   KD 
Sbjct: 874  NERLLRDYKCHLTSEQLKLLAEWK---ARGKSLMVTAIKSRSYFGNDNFYPVMMCAAKDE 930

Query: 589  PRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVINPEISVLTGDRLDQMTDD 648
             R   +  I+EL + G+   MI+GD E TA  +A+++ I  +  E+          + ++
Sbjct: 931  IRPEAKDVIKELRRSGIECWMISGDNEVTARAVAQELDIDNVIAEV----------LPEE 980

Query: 649  QLAGV--IDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAMGH 706
            + A V  I H NI A     HK            +VAM GDG+NDAPAL  AD+G+A+  
Sbjct: 981  KAAKVKWIQHNNIGANG--HHK------------VVAMVGDGINDAPALAAADVGIALAS 1026

Query: 707  MGTDVAKEASDMVLTD--DDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALSLVA 761
             G+++A  + D VL    +   ++L  ++  K +FN I+   T+ L  ++ AL + A
Sbjct: 1027 -GSELAMTSCDFVLLSPINTLVSLLALLKLSKTVFNRIKFNFTWALVYNMLALPIAA 1082

>Scas_615.9
          Length = 942

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 72/150 (48%), Gaps = 29/150 (19%)

Query: 576 NLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVINPEIS 635
           N T VG   ++D  +  V   I+ L      + M+TGD+   A+ +A+Q+GI        
Sbjct: 691 NDTLVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTGDSHGAAMKVAQQVGIAA------ 744

Query: 636 VLTGDRLDQMTDDQLAGVIDHVNIFARATPEHKLNIVRALQKRG-DIVAMTGDGVNDAPA 694
                                 N+++  TP  K  IV +LQ      VA  GDG+ND+P 
Sbjct: 745 ---------------------NNVYSGVTPSGKCEIVESLQADSVGGVAFVGDGINDSPV 783

Query: 695 LKLADIGVAMGHMGTDVAKEASDMVLTDDD 724
           L  +DIGVA+   GTD+A EA+D+V+  +D
Sbjct: 784 LVTSDIGVALS-TGTDIAMEAADIVVLGND 812

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/276 (22%), Positives = 109/276 (39%), Gaps = 56/276 (20%)

Query: 143 RSEKSLEALHKLVPASCHLIR-----FGAETHVLASCLVPGDLVYFKVGDRIPADVRIIE 197
           ++  SL  L +L P+ C +++       +   +  + L   D++  K G +IPAD  II+
Sbjct: 342 QTSSSLSKLIQLTPSKCIILQDKNNIQSSHIEIETNLLQRNDIIEIKPGMKIPADGIIIQ 401

Query: 198 STDLSLDESTLTGETEPVHKSCTPVNSATYSDVPGGIIPIGERTSIAYMGTLVREGHGKG 257
             +  +DES +TGE+  VHK                     ++ S    G+L   GH   
Sbjct: 402 G-ESEIDESLMTGESILVHK---------------------QKGSQVIAGSLNGPGHFYF 439

Query: 258 IVVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRRDLSYVRFVLSGIIFLLGVIQGRS 317
             +  G  T    + + M S +  K P+Q   D       Y+  +    I  L +I   +
Sbjct: 440 KAINIGDDTKLAQIIQTMKSAQLNKAPIQNNAD-------YLASIFVPTILCLSIITFIT 492

Query: 318 WLEM----------------------FQISVSLAVAAIPEGLPIIVTVTLALGVLRMANR 355
           W+ +                      FQI++S+ V A P  L +     + +G    A  
Sbjct: 493 WITLSNLLTKPPVIFTNNNNGKFYTSFQIAISVIVVACPCALGLATPTAIMVGTGIGAQH 552

Query: 356 KAIVRRLPSVETLGSVNVICSDKTGTLTANHMTASK 391
             +++    +E   ++  I  DKTGT+T   MT  +
Sbjct: 553 GVLIKGGDILERFNTITKIVFDKTGTITTGQMTVQR 588

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
           cerevisiae YIL048w NEO1 ATPase whose overproduction
           confers neomycin resistance, hypothetical start
          Length = 1144

 Score = 70.1 bits (170), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 145/665 (21%), Positives = 258/665 (38%), Gaps = 143/665 (21%)

Query: 178 GDLVYFKVGDRIPADVRIIESTDLS----LDESTLTGETE-PVHKSCTPVNSATYSDVPG 232
           GDL+    G R+PAD+ +++S++ S    +    L GET+  +  +CT   +    D+  
Sbjct: 267 GDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLRIACTLTQNLNEDDLLE 326

Query: 233 GIIPIG---ERTSIAYMG----------------------TLVREGHGKGIVVATGKHTM 267
            I       E++  +++G                       L   G   G V+ TG+ T 
Sbjct: 327 KITITASAPEKSIHSFLGRVTYKDTNTSGLTIDNTLWANTVLASSGFCIGCVIYTGRDTR 386

Query: 268 FGAVFEMMNSIE-KPKTP-LQMAMDTLRRDLSYVRFVLSGIIFLLGVIQGRSWLEMFQIS 325
                + MN+   K KT  L++ ++ + + L    F+LS ++ +   +    W       
Sbjct: 387 -----QAMNTTSAKVKTGLLELEINDISKILCACVFILSILLVVFAGLHNDDWYVDIMRY 441

Query: 326 VSLAVAAIPEGLPIIVTVTLALGVLRMANRK----AIVRRLPSVETLGSVNVICSDKTGT 381
           + L    IP  L + + +  ++   ++ + K     IVR     E LG +  + SDKTGT
Sbjct: 442 LILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGT 501

Query: 382 LTANHMTASKIWCLGSMANKNNVLSLEAKSSGGL----------PGKLPNLKNYLSDDVK 431
           LT N M   K+  LG+++       + +    G+           G     +   +  V 
Sbjct: 502 LTQNDMQLKKV-HLGNVSYTTETADIVSDYIQGMIESKNDSVTNLGPRSTTRKDAATHVI 560

Query: 432 ATLRIGSICNNA--SFSHEHGKY-LGNPTDIALLEV-------LQKFD------LVDERP 475
             +   +IC+N   +F  +   Y   +P +IA+++        L K D      L +   
Sbjct: 561 DLITTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKRDRHSMSLLHEHSG 620

Query: 476 TTTRVDELT---FNSKRKYMAVKVDSPANSGKHIIYVKGAFERILERSASFIGGAGKVEK 532
           T    D LT   FNS  K M + V                +++  ++      GA  V  
Sbjct: 621 TILNYDVLTMFPFNSDTKRMGIIV----------------YDKQKDQYWFLQKGADTVMN 664

Query: 533 LSDSHKSLINDCAKSLASEGLRTLA----------FAQL-----ECSTNKPMNDSTIQN- 576
              ++   + +   ++A EGLRTL           + Q      E S +    +  + N 
Sbjct: 665 RIVANNDWLEEETGNMAREGLRTLVIGRKKLTKKIYEQFKKEYEEVSASMYNREQEMANT 724

Query: 577 --------LTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTA---------- 618
                   L  +GL G++D  +  V+ +IE L   G+ + M+TGD   TA          
Sbjct: 725 ISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLI 784

Query: 619 -----VNIARQIGIP----------VINPEISVLT-GDRLD---QMTDDQLAGVIDHVN- 658
                V++  ++  P           +N    +L  G+ L    +    +   V+ H+  
Sbjct: 785 SRGQYVHVVTKLSKPEGAFNQLEYLKVNKNACLLIDGESLGMFLKYYRQEFFDVVVHLPT 844

Query: 659 -IFARATPEHKLNIVRALQK-RGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEAS 716
            I  R TP+ K ++   +++  G  V   GDG ND   ++ AD+GV +       A  A+
Sbjct: 845 VIACRCTPQQKADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAA 904

Query: 717 DMVLT 721
           D  +T
Sbjct: 905 DFSIT 909

>Kwal_23.5789
          Length = 1133

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 154/687 (22%), Positives = 262/687 (38%), Gaps = 175/687 (25%)

Query: 173 SCLVP------GDLVYFKVGDRIPADVRIIESTDLS----LDESTLTGETEPVHKSCTPV 222
           S LVP      GDL+    G R PAD+ +++S++ S    +    L GET+   +   P+
Sbjct: 248 SQLVPSKDLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIACPL 307

Query: 223 NSATYSD-----------VPGGII---------------PIGERTSIAYMGTLVREGHGK 256
                 D           VP   I               P+    ++         G   
Sbjct: 308 TQHLSQDDLLYRISITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVFASAGTAI 367

Query: 257 GIVVATGKHTMFGAVFEMMNSIEKPKTPL-QMAMDTLRRDLSYVRFVLSGIIFLLGVIQG 315
             VV TG  T       M  S+   KT L ++ +++L + L    F+LS  +        
Sbjct: 368 ACVVYTGADTRQA----MNTSMSSVKTGLLELEINSLSKILCACVFILSVALVAFAGFNN 423

Query: 316 RSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANR--------KAIVRRLPSVET 367
             W     + +   +      +P+ + V L LG    A++        + IVR     E 
Sbjct: 424 NDWY----VDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIPED 479

Query: 368 LGSVNVICSDKTGTLTANHMTASKIWCLGS-----------------MANKNNVLSLEAK 410
           LG +  + SDKTGTLT N M   K+  LG+                 M++  N  ++ + 
Sbjct: 480 LGRIEYLLSDKTGTLTQNDMELKKL-HLGTVSYTMDTMDIVTDYVRAMSDNLNSSAVPSA 538

Query: 411 SSGGLPGKLPNLKNYLSDDVKATLRIGSICNNASFSHEHGKYL---GNPTDIALLEVLQK 467
           S   LPG++         D+  TL   ++C+  + + E G+      +P +IA+++  + 
Sbjct: 539 SKKDLPGRV--------RDLVLTL---ALCHQVTPTFEDGELTYQAASPDEIAIVKFTES 587

Query: 468 FDLV-------------DERPTTTRVDEL---TFNSKRKYMAVKVDSPANSGKHIIYVKG 511
             L              D+  T    D L    FNS  K M +           +I+ K 
Sbjct: 588 VGLTLFRRDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGI-----------VIFDKQ 636

Query: 512 AFER-ILERSASFIGGAGKVEKLSDSHKSLINDCAKSLASEGLRTLAFAQLECSTN---- 566
             E   L++ A  +    K+ + +D     + +   +LA EGLRTL   +   S      
Sbjct: 637 KDEYWFLQKGADVV--MSKIVQKND----WLEEETGNLAREGLRTLVIGRKRLSKKLLQT 690

Query: 567 --KPMNDSTI------------------QNLTFVGLIGMKDPPRSTVRPAIEELLQGGVH 606
             K   D+++                   +L  +GL G++D  +  V+ +IE L   G+ 
Sbjct: 691 FTKDYEDASLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIK 750

Query: 607 VIMITGDAENTA--VNIARQI--------GIPVINPEISVLTGDRLDQMTD--------D 648
           + M+TGD   TA  V+I+ ++         +  +N     LT   L ++          +
Sbjct: 751 IWMLTGDKVETARCVSISAKLVSRGQYVHTVTKVNKPEGALTHLELLKINTNSCLLIDGE 810

Query: 649 QLAGVIDH---------VNIFA----RATPEHKLNIVRALQK-RGDIVAMTGDGVNDAPA 694
            L   +++         VN+ A    R TP+ K ++   +++  G  V   GDG ND   
Sbjct: 811 SLGLYLEYYRQQFFEIVVNLPAVIACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSM 870

Query: 695 LKLADIGVAMGHMGTDVAKEASDMVLT 721
           ++ AD+GV +       A  A+D  +T
Sbjct: 871 IQSADVGVGIVGKEGKQASLAADFSIT 897

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
           complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 117/470 (24%), Positives = 181/470 (38%), Gaps = 120/470 (25%)

Query: 353 ANRKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTASKIWCLGSMANKNNVLSL-EAKS 411
           +N   +VR    VE LG +  I SDKTGTLT N M      C  S+A +  + S+ E K 
Sbjct: 532 SNMPTVVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKS--C--SIAGRCYIQSIPEDKD 587

Query: 412 SGGLPGKLPNLKNYLSDDVKATLR---------------IGSICN--------NASFSHE 448
           +    G     + Y  DD+   L                + SIC+        N S  ++
Sbjct: 588 AAFDEGIEVGYRTY--DDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQ 645

Query: 449 -----HGKYLGNPTDIALLEVLQKFD---LVDERPTTTRVDEL----TFNSKRKYMAVKV 496
                 G  +    D+    +++K +   ++ E  T   V EL     FNS RK M+   
Sbjct: 646 AASPDEGALVQGAADLGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIF 705

Query: 497 DSPANSGKHIIYVKGAFERILERSASFIGGAGKVEKLSDSHKSLINDCAKSLASEGLRTL 556
             P NS +  +  KGA   ILER A+           S+ + +      +  A+EGLRTL
Sbjct: 706 RFPDNSIR--LLCKGADTVILERLAA----------TSNPYVAATLRHLEDYAAEGLRTL 753

Query: 557 AFAQL--------ECSTNKPMNDSTIQN---------------LTFVGLIGMKDPPRSTV 593
             A          E S       +T+ N               L  +G   ++D  +  V
Sbjct: 754 CIASRTIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGV 813

Query: 594 RPAIEELLQGGVHVIMITGDAENTAVNI-------ARQIGIPVINPEISVLTG----DRL 642
              I  L Q G+ V ++TGD + TA+NI       +  + + ++N +    T     D+L
Sbjct: 814 PETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKL 873

Query: 643 DQMTDDQ--------LAGVID-----------------------HVNIFARATPEHKLNI 671
             + D Q        LA VID                          I  R +P  K  +
Sbjct: 874 RAINDHQISQQDMNTLALVIDGKSLGFALEPDLEEFLLAIGKMCRAVICCRVSPLQKALV 933

Query: 672 VRALQKR-GDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVL 720
           V+ +++R   ++   GDG ND   ++ A +GV +  M    A  ++D  L
Sbjct: 934 VKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAL 983

>Kwal_26.7070
          Length = 1315

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 122/540 (22%), Positives = 214/540 (39%), Gaps = 120/540 (22%)

Query: 358  IVRRLPSVETLGSVNVICSDKTGTLTANHMTASKIWCLGSMANKNNVLSL-EAKSSGGLP 416
            +VR    VE LG +  I SDKTGTLT N M      C  S+A K  + ++ E K++    
Sbjct: 540  VVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKS--C--SIAGKCYIETIPEDKAATTED 595

Query: 417  G------KLPNLKNYLSDD-------VKATLRIGSICNNA--SFSHEHG-KY-LGNPTDI 459
            G      K  ++K  L+D        +   L + + C+     F  +   KY   +P + 
Sbjct: 596  GIEIGFRKFDSMKETLNDTQDPDSHIINDFLTLLATCHTVIPEFQEDGSIKYQAASPDEG 655

Query: 460  ALLE----VLQKFDLVDERPTTTRVDEL------------TFNSKRKYMAVKVDSPANSG 503
            AL+E    +  KF +      +  +++L             FNS RK M+     P  +G
Sbjct: 656  ALVEGAASLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIFRLP--NG 713

Query: 504  KHIIYVKGAFERILERSASFIGGAGKVEKLSDSHKSLINDCAKSLASEGLRTLAFA---- 559
            +  ++ KGA   ILER       AG+   +  + + L     +  A+EGLRTL  A    
Sbjct: 714  EIKLFCKGADTVILERLK-----AGENPYIEATLRHL-----EDYAAEGLRTLCLASRTV 763

Query: 560  -QLECSTNKPMNDSTI------------------QNLTFVGLIGMKDPPRSTVRPAIEEL 600
             + E +  K + D+                    ++L  +G   ++D  +  V   I  L
Sbjct: 764  TESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTL 823

Query: 601  LQGGVHVIMITGDAENTAVNI-------ARQIGIPVINPE------------ISVLTGDR 641
               G+ V ++TGD + TAVNI       +  + + +IN E            +  ++  +
Sbjct: 824  QDAGIKVWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQ 883

Query: 642  LDQMTDDQLAGVIDHVN-----------------------IFARATPEHKLNIVRALQKR 678
            + Q   + LA VID  +                       I  R +P  K  +V+ ++++
Sbjct: 884  ISQQDMNSLALVIDGKSLGFALEADLEDYLLAIGKLCKAVICCRVSPLQKALVVKMVKRK 943

Query: 679  GD-IVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVLTDDDFSTILTAIEEGKG 737
             D ++   GDG ND   ++ A +GV +  M    A  ++D  +    +   L  +  G  
Sbjct: 944  TDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQFKYLKKLLLV-HGSW 1002

Query: 738  IFNNIQSFLTFQLSTSVAALS---LVAIATAFKLQNPLNAMQILWINILMDGPPAQSLGV 794
             +  I   + +    ++A          A A+  Q+ + +  + + N+     P   +GV
Sbjct: 1003 SYQRISQAILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGV 1062

>Kwal_55.21575
          Length = 989

 Score = 66.6 bits (161), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 72/287 (25%), Positives = 114/287 (39%), Gaps = 44/287 (15%)

Query: 134 VSVGFVQEYRSE----KSLEALHKLVPASCHLIRFGAETHVLASCLVPGDLVYFKVGDRI 189
           +SVG + E +++     SL  L  L P++C +I  G    +    L  GD V  K G +I
Sbjct: 382 ISVGKLLENKAKSKTNNSLSKLMSLAPSTCTIIENGKAREIPVEFLQVGDTVEIKPGAKI 441

Query: 190 PADVRIIESTDLSLDESTLTGETEPVHKSCTPVNSATYSDVPGGIIPIGERTSIAYMGTL 249
           P D  IIE  +  +DES +TGE+  V +         Y   P               G++
Sbjct: 442 PTDGVIIEG-ESEVDESLITGESLMVPR---------YKGFP------------VIAGSI 479

Query: 250 VREGHGKGIVVAT--GKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRRDLSYVRFVLSGII 307
              G  + ++ AT  G  T    + + M   +  K P+Q   D L         VL+ I 
Sbjct: 480 --NGPNRFLLTATSVGDDTKLAQIIQTMKQAQLSKAPIQHYADYLASKFVPSVLVLAMIT 537

Query: 308 FLLGVIQGR--------------SWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMA 353
           F+   I  R               +    ++++S+ V A P  L +     + +G    A
Sbjct: 538 FVTWTILSRVLSNPPSIFDSPNGKFFICLEMTISVIVVACPCALGLAAPTAIMVGTGLGA 597

Query: 354 NRKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTASKIWCLGSMAN 400
               +++    +E   S+     DKTGTLT  HMT  +   +G   N
Sbjct: 598 KHGVLIKGGDILEKCSSLETFLFDKTGTLTTGHMTVEQFVPMGVRDN 644

 Score = 66.2 bits (160), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 54/214 (25%), Positives = 99/214 (46%), Gaps = 53/214 (24%)

Query: 516 ILERSASFIGGA--------GKVEKLSDSHKSLINDCAKSLASEGLRTLAFAQLECSTNK 567
           ++ +S + +GG         GK   +   +++++ D   SL+++   TLA+ ++      
Sbjct: 684 VVTKSKTILGGGLICDCELDGKAYHVVIGNRNVMQD--MSLSADASSTLAYVKI------ 735

Query: 568 PMNDSTIQNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGI 627
                   N   VG   + D  +      ++ L + G  V M+TGD   +A+ +A ++GI
Sbjct: 736 --------NGELVGRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGI 787

Query: 628 PVINPEISVLTGDRLDQMTDDQLAGVIDHVNIFARATPEHKLNIVRALQKRG-DIVAMTG 686
                                      +  N+++  TP  K  +V+ LQ  G   VA  G
Sbjct: 788 ---------------------------EANNVYSELTPADKNQLVQDLQDGGRKNVAFIG 820

Query: 687 DGVNDAPALKLADIGVAMGHMGTDVAKEASDMVL 720
           DG+ND+PAL  +D+GV++   GTD+A EA+D+++
Sbjct: 821 DGINDSPALVTSDLGVSI-STGTDIAMEAADVII 853

>CAGL0M08602g complement(856349..859387) similar to sp|P38995
           Saccharomyces cerevisiae YDR270w CCC2, start by
           similarity
          Length = 1012

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 68/143 (47%), Gaps = 28/143 (19%)

Query: 581 GLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVINPEISVLTGD 640
           G   + D  +S  +  I  L      V M+TGD   +A+ +A  + IP   P        
Sbjct: 757 GRFELLDEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIP---PN------- 806

Query: 641 RLDQMTDDQLAGVIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADI 700
                            N+++  TP+ K   V  L++ G ++A  GDG+ND+ AL  +D+
Sbjct: 807 -----------------NVYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDL 849

Query: 701 GVAMGHMGTDVAKEASDMVLTDD 723
           G+A+   GT+VA EA+ +V+ +D
Sbjct: 850 GIAISS-GTEVAIEAAGIVILND 871

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 72/311 (23%), Positives = 124/311 (39%), Gaps = 56/311 (18%)

Query: 127 TLAVVIVVSVG-FVQEYRSEKSLEALHKLV---PASCHLIRFGAET---HVLASCLVPGD 179
           ++ +V  +S+G +++     K+  AL KL+   P+SC ++    ++    +    L  GD
Sbjct: 377 SVMIVAYISIGKYLENKAKSKTSTALSKLISLTPSSCIIVDKDDDSITQEIGIELLEVGD 436

Query: 180 LVYFKVGDRIPADVRIIESTDLSLDESTLTGETEPVHKSCTPVNSATYSDVPGGIIPIGE 239
           +   K G +IP+D  I+      +DES +TGET  V K    V       V GG I    
Sbjct: 437 IAMVKPGAKIPSD-GIVTKGISEVDESLMTGETNLVVKEIGSV-------VTGGTI---- 484

Query: 240 RTSIAYMGTLVREGHGKGI----VVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRRD 295
                         +G G+    V + G  T    + ++M + +  K  +Q   D +   
Sbjct: 485 --------------NGSGLIYFEVTSVGDDTKLANIIKVMKNAQLKKASIQRYTDYVASI 530

Query: 296 LSYVRFVLSGIIFLLGVIQGRS-----------------WLEMFQISVSLAVAAIPEGLP 338
                 +LS + F++     RS                 +    QI+ S+ + A P  L 
Sbjct: 531 FVPTVLILSLLTFIVWTSLTRSEKIISKLSIFGETSESRFYMCLQIATSVVIVACPCALG 590

Query: 339 IIVTVTLALGVLRMANRKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTASKIWCLGSM 398
           +     + +G    +    +++    +E    VN    DKTGTLT  HMT  +   +G+ 
Sbjct: 591 LATPTAIMVGTGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTLTTGHMTVQQF--VGNA 648

Query: 399 ANKNNVLSLEA 409
               N+  LE 
Sbjct: 649 EMIKNLFYLEC 659

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
            Saccharomyces cerevisiae YAL026c DRS2 P-type
            amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 118/546 (21%), Positives = 201/546 (36%), Gaps = 133/546 (24%)

Query: 358  IVRRLPSVETLGSVNVICSDKTGTLTANHMTASKIWCLGSMANKNNVLSLEAKSSGGLP- 416
            +VR    VE LG +  I SDKTGTLT N M    +   G    +       A    G+  
Sbjct: 545  VVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDGIEI 604

Query: 417  --GKLPNLKNYLSD--DVKATLRI-------------------GSICNNASFSHEHGKYL 453
                  +LK+ ++D  D +A + I                   G+I   A+ S + G  +
Sbjct: 605  GFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAA-SPDEGALV 663

Query: 454  GNPTDIALLEVLQKFDLVDERPTTTRVDE-------------LTFNSKRKYMAVKVDSPA 500
                D+       +FD+   RP +  +                 FNS RK M+     P 
Sbjct: 664  QGAADLGF-----RFDI--RRPNSVSISTPFSEQLEYQLLNICEFNSTRKRMSAIFRMPD 716

Query: 501  NSGKHIIYVKGAFERILERSASFIGGAGKVEKLSDSHKSLINDCAKSL---ASEGLRTLA 557
             S K  ++ KGA   ILER             L       +    + L   A+EGLRTL 
Sbjct: 717  GSIK--LFCKGADTVILER-------------LDSEFNPYVQSTLRHLEDYAAEGLRTLC 761

Query: 558  FA-------------QLECSTNKPMNDSTIQ----------NLTFVGLIGMKDPPRSTVR 594
             A             ++  + +  M D T +          +L F+G   ++D  +  V 
Sbjct: 762  IASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKLQEGVP 821

Query: 595  PAIEELLQGGVHVIMITGDAENTAVNI-------ARQIGIPVINPE------------IS 635
              I  L + G+ V ++TGD + TA+NI       +  + + ++N E            ++
Sbjct: 822  ETIHHLQEAGLKVWVLTGDRQETAINIGMSCRLLSEDMNLLIVNEETKEDTRTNLQSKLN 881

Query: 636  VLTGDRLDQMTDDQLAGVIDHVN-----------------------IFARATPEHKLNIV 672
             +   ++ Q   + LA VID  +                       I  R +P  K  +V
Sbjct: 882  AIESHQISQQDMNSLALVIDGKSLGYALEEDLEDQFLTIGKLCKAVICCRVSPLQKALVV 941

Query: 673  RALQKR-GDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVLTDDDFSTILTA 731
            + ++++   ++   GDG ND   ++ A +GV +  M    A  ++D  +    F   L  
Sbjct: 942  KMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIGQFRFLRKL-L 1000

Query: 732  IEEGKGIFNNIQSFLTFQLSTSVAALS---LVAIATAFKLQNPLNAMQILWINILMDGPP 788
            I  G   +  I   + +    ++A          A AF  Q+ + +  + + N+     P
Sbjct: 1001 IVHGSWSYQRISLAILYSFYKNMALYMTQFWYVFANAFSGQSIMESWTLTFYNVFFTVMP 1060

Query: 789  AQSLGV 794
               +G+
Sbjct: 1061 PFVIGI 1066

>CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharomyces
            cerevisiae YAL026c DRS2, start by similarity
          Length = 1328

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 124/553 (22%), Positives = 211/553 (38%), Gaps = 120/553 (21%)

Query: 358  IVRRLPSVETLGSVNVICSDKTGTLTANHMTASKI----WCLGSMANKNNVLSLEAKSSG 413
            +V+    VE LG +  I SDKTGTLT N M          C      ++   + E     
Sbjct: 524  VVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAEHIPEDKAATFEDGIEV 583

Query: 414  GLPGKLPNLKNYL---SDDVK---ATLRIGSICNNA--SFSHEHG-KY-LGNPTDIALLE 463
            G      +LK  L   SDD K     L + + C+     F  +   KY   +P + AL+E
Sbjct: 584  GYRS-FDDLKKQLTTNSDDCKIIDEFLTLLATCHTVIPEFQADGSIKYQAASPDEGALVE 642

Query: 464  --VLQKFDLVDERPTTTRV-------------DELTFNSKRKYMAVKVDSPANSGKHIIY 508
               L  +  +  +P +  +             +   FNS RK M+     P +S K  + 
Sbjct: 643  GGALLGYKFLIRKPNSVTILINEEEEREYQLLNICEFNSTRKRMSAIFRFPDDSIK--LL 700

Query: 509  VKGAFERILERSASFIGGAGKVEKLSDSHKSLINDCAKSL---ASEGLRTLAFA------ 559
             KGA   ILER             LS++    ++   + L   A+EGLRTL  A      
Sbjct: 701  CKGADSVILER-------------LSETGNFYVDATTRHLEDYATEGLRTLCLATKDIPE 747

Query: 560  -QLECSTNKPMNDSTI----------------QNLTFVGLIGMKDPPRSTVRPAIEELLQ 602
             +      K M+ +T                   LT +G   ++D  +  V   I  L +
Sbjct: 748  DEYNAWNKKYMDAATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQE 807

Query: 603  GGVHVIMITGDAENTAVNI-------ARQIGIPVINPE------------ISVLTGDRLD 643
             G+ + ++TGD + TA+NI       +  + + +I+ E            ++ L    L 
Sbjct: 808  AGIKIWVLTGDKQETAINIGMSCRLLSEDMNLLIISEETKEATRRNMEEKLAALHEHSLS 867

Query: 644  QMTDDQLAGVID-HVNIFA----------------------RATPEHKLNIVRALQKRGD 680
            +   + LA VID H   FA                      R +P  K  +V+ ++++ +
Sbjct: 868  EHDMNTLALVIDGHSLSFALEADLEDYFLAIGKMCKAVICCRVSPLQKALVVKMVKRKTN 927

Query: 681  -IVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIF 739
             ++   GDG ND   ++ A +GV +  M    A  ++D+ +    F   L  +  G   +
Sbjct: 928  SLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADISVGQFRFLKKLLLV-HGAWSY 986

Query: 740  NNIQSFLTFQLSTSVAALS---LVAIATAFKLQNPLNAMQILWINILMDGPPAQSLGV-- 794
              I   + +    + A          A AF  Q+ + +  +   N+     P   +GV  
Sbjct: 987  QRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSLYNVFFTVLPPFVIGVFD 1046

Query: 795  EPVDHEVMRKPPR 807
            + V+  ++ + P+
Sbjct: 1047 QFVNSRLLERYPQ 1059

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
            Ca-ATPase (P-type) required for ribosome assembly and
            involved in late Golgi function, member of the cation
            transporting (E1-E2) P-type ATPase superfamily [4068 bp,
            1355 aa]
          Length = 1355

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 131/594 (22%), Positives = 219/594 (36%), Gaps = 132/594 (22%)

Query: 358  IVRRLPSVETLGSVNVICSDKTGTLTANHMTASKI----WCLGSMANKNNVLSLEAKSSG 413
            +VR    VE LG +  I SDKTGTLT N M          C      ++   ++E     
Sbjct: 541  VVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDGIEV 600

Query: 414  GLPGKLPNLKNYLSD-------------DVKATLRI--------GSICNNASFSHEHGKY 452
            G   K  +LK  L+D              + AT           GSI   A+ S + G  
Sbjct: 601  GYR-KFDDLKKKLNDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQAA-SPDEGAL 658

Query: 453  LGNPTDIALLEVLQKFDLVD-------ERPTTTRVDELTFNSKRKYMAVKVDSPANSGKH 505
            +    D+    +++K + V        E      ++   FNS RK M+     P  S K 
Sbjct: 659  VQGGADLGYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFPDGSIK- 717

Query: 506  IIYVKGAFERILERSASFIGGAGKVEKLSDSHKSLINDCAKSL---ASEGLRTLAFAQLE 562
             ++ KGA   ILER             L D     +    + L   ASEGLRTL  A  +
Sbjct: 718  -LFCKGADTVILER-------------LDDEANQYVEATMRHLEDYASEGLRTLCLAMRD 763

Query: 563  CST------NKPMNDSTI-----------------QNLTFVGLIGMKDPPRSTVRPAIEE 599
             S       N   N++                   +NL  +G   ++D  +  V   I  
Sbjct: 764  ISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHT 823

Query: 600  LLQGGVHVIMITGDAENTAVNI-------ARQIGIPVINPE------------ISVLTGD 640
            L + G+ + ++TGD + TA+NI       +  + + +IN E            I+ L   
Sbjct: 824  LQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNLLIINEETRDDTERNLLEKINALNEH 883

Query: 641  RLDQMTDDQLAGVIDHVNI-FA----------------------RATPEHKLNIVRALQK 677
            +L       LA VID  ++ FA                      R +P  K  +V+ +++
Sbjct: 884  QLSTHDMKSLALVIDGKSLGFALEPELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKR 943

Query: 678  R-GDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVLTDDDFSTILTAIEEGK 736
            +   ++     G ND   ++ A +GV +  M    A  ++D+ L    F   L  +  G 
Sbjct: 944  KSSSLLLAIASGANDVSMIQAAHVGVGISGMEGMQAARSADIALGQFKFLKKLLLV-HGS 1002

Query: 737  GIFNNIQSFLTFQLSTSVAALS---LVAIATAFKLQNPLNAMQILWINILMDGPPAQSLG 793
              +  I   + +    + A          A AF  Q+ + +  + + N+     P   +G
Sbjct: 1003 WSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSFYNLFFTVWPPFVIG 1062

Query: 794  V--EPVDHEVMRKPPR----KRSDKILTPQVMRRLLINAAF----IIGGTIYVF 837
            V  + V   ++ + P+     +  +  +  +    +IN  F    +  GTI ++
Sbjct: 1063 VFDQFVSSRLLERYPQLYKLGQKGQFFSVYIFWGWIINGFFHSAIVFIGTILIY 1116

>AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) [3702
            bp, 1233 aa]
          Length = 1233

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 82/185 (44%), Gaps = 35/185 (18%)

Query: 582  LIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVINPEISVLTGDR 641
             + ++D  R   +  ++ L + G+   MI+GD    A  +A ++GI              
Sbjct: 1013 FLAVRDELRPEAKEVVQALHERGIECWMISGDNSLAANAVALEVGIK------------- 1059

Query: 642  LDQMTDDQLAGVIDHVNIFARATPE---HKLNIVRALQKRGDIVAMTGDGVNDAPALKLA 698
                            ++ A   PE    K+  +R    +G  +AM GDG+NDAPA+  A
Sbjct: 1060 ----------------HVIADVLPEGKAEKIQWIRETSGQGVAIAMVGDGMNDAPAIAAA 1103

Query: 699  DIGVAMGHMGTDVAKEASDMVL--TDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAA 756
            D+G+++   G+D+A  + D VL    +  + I+  ++  K +F  ++    + L  ++  
Sbjct: 1104 DVGISLAS-GSDLAMISCDFVLLSKKNPLTGIVVLLQLSKKVFRRVKFNFVWALVYNIIC 1162

Query: 757  LSLVA 761
            + + A
Sbjct: 1163 VPIAA 1167

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 68/281 (24%), Positives = 119/281 (42%), Gaps = 35/281 (12%)

Query: 121 DDAVSITLAVVIVVSVGFVQEYRSEKSLEALHKLVPASCHLIR------FGAETHVLASC 174
           D  V +TL ++I   +  + + +  K+LE+L  L   +  L++      F  ET V A  
Sbjct: 604 DSVVFLTLFLLIGRLLESLSKSKMVKTLESLTSLKQRTGILMQADGARDFKKETSVSAEM 663

Query: 175 LVPGDLVYFKVGDRIPADVRIIESTDLSLDESTLTGETEPVHKSCTPVNSATYSDVPG-- 232
           L  GD +  K G     D  I++  +   DES+LTGE+ P+            +  PG  
Sbjct: 664 LELGDHILIKPGASPAVDALIVQG-ETEFDESSLTGESRPI------------THFPGDQ 710

Query: 233 ---GIIPIGERTSIAYMGTLVREGHGKGIVVATGKHTMFGAVFEMMNSIEKPKTPLQMAM 289
              G + +G+   IA + T         ++ A     + GA  E +  +    T   +  
Sbjct: 711 IFAGTVNVGQCAVIAKVSTAPGNSLLDHVISAVRDGQLRGAPIERIADV---LTGYFVPF 767

Query: 290 DTLRRDLSYVRFVLSGIIFLL------GVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTV 343
             L   L++  +++ G   +L      G + G  +  + + ++++ V A P G+ +    
Sbjct: 768 IVLLAILTWAIWLILGFAGVLSQEKLDGSVGGWPFWSL-EFAIAVFVIACPCGIGLAAPT 826

Query: 344 TLALGVLRMANRKAIVRRLPSVETLGS-VNVICSDKTGTLT 383
            L +G    A    + R   +   +GS V  +C DKTGTLT
Sbjct: 827 ALFVGANIAAKYGILARGGSAAFQMGSKVTTVCFDKTGTLT 867

>YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transporting
            ATPase, involved in resistance to cadmium [3651 bp, 1216
            aa]
          Length = 1216

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 73/160 (45%), Gaps = 18/160 (11%)

Query: 617  TAVNIARQIGIPVINPEISVLTGDRLDQMTDDQLAGVIDHVNIFARATPEHKLNIVRAL- 675
            + +N+ RQ GI      + +L+GD    +        I+  NI + ATP  K   ++ + 
Sbjct: 1032 STINLLRQRGI-----SLHILSGDDDGAVRSMAARLGIESSNIRSHATPAEKSEYIKDIV 1086

Query: 676  ---------QKRGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVLTDDDFS 726
                     Q +  +V   GDG NDA  L  A IGV +   G++VAK A+D+V+     +
Sbjct: 1087 EGRNCDSSSQSKRPVVVFCGDGTNDAIGLTQATIGVHINE-GSEVAKLAADVVMLKPKLN 1145

Query: 727  TILTAIEEGKGIFNNIQSFLTFQLSTSVAALSLVAIATAF 766
             ILT I   +     ++  L F  S +    +++  A AF
Sbjct: 1146 NILTMITVSQKAMFRVK--LNFLWSFTYNLFAILLAAGAF 1183

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 71/301 (23%), Positives = 124/301 (41%), Gaps = 54/301 (17%)

Query: 127 TLAVVIVVSVGFVQE---YRSEKSLEALHKLVPASCHLI-RFGAETHVLASCLVPGDLVY 182
           +L V +++   FV E   +R+ KS+ ++  L  +S  L+ + G ET +    L  GD+  
Sbjct: 663 SLLVTLIMVGRFVSELARHRAVKSI-SVRSLQASSAILVDKTGKETEINIRLLQYGDIFK 721

Query: 183 FKVGDRIPADVRIIESTDLSLDESTLTGETEPVHKSCTPVNSATYSDVPGGII----PIG 238
                RIP D  +I  +   +DE+ +TGE+ PV K C  +  A   +  G +      + 
Sbjct: 722 VLPDSRIPTDGTVISGSS-EVDEALITGESMPVPKKCQSIVVAGSVNGTGTLFVKLSKLP 780

Query: 239 ERTSIAYMGTLVREGHGKGIVVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRRDLSY 298
              +I+ + T+V E                         + KPK  +Q   D +    SY
Sbjct: 781 GNNTISTIATMVDEA-----------------------KLTKPK--IQNIADKI---ASY 812

Query: 299 VRFVLSGIIFLLGVI----------QGRS--WLEMFQISVSLAVAAIPE--GLPIIVTVT 344
               + GI  +   +          Q RS   ++    ++++ + + P   GL + +   
Sbjct: 813 FVPTIIGITVVTFCVWIAVGIRVEKQSRSDAVIQAIIYAITVLIVSCPCVIGLAVPIVFV 872

Query: 345 LALGVLRMANRKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTASKIWCLGSMANKNNV 404
           +A GV   A R  I +   S+E   + + +  DKTGTLT   +T       G   N  ++
Sbjct: 873 IASGV--AAKRGVIFKSAESIEVAHNTSHVVFDKTGTLTEGKLTVVHETVRGDRHNSQSL 930

Query: 405 L 405
           L
Sbjct: 931 L 931

>Scas_89.1
          Length = 271

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 77/183 (42%), Gaps = 42/183 (22%)

Query: 575 QNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVINPEI 634
            NL  +GL G++D  ++ V+ +IE L   GV + M+TGD   TA  ++  I   +I+   
Sbjct: 33  HNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVS--ISAKLISRGQ 90

Query: 635 SVLTGDRLDQ-------------------MTDDQLAG-------------VIDHVNIFA- 661
            V T  +L +                   + D +  G             V+D   + A 
Sbjct: 91  YVHTVTKLSRPEGALNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLPAVIAC 150

Query: 662 RATPEHKLNIVRALQK-RGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVL 720
           R TP+ K ++   +++  G  V   GDG ND   ++ AD+GV +      V KE     L
Sbjct: 151 RCTPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGI------VGKEGKQASL 204

Query: 721 TDD 723
             D
Sbjct: 205 AAD 207

>Scas_576.8
          Length = 1591

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 87/200 (43%), Gaps = 39/200 (19%)

Query: 480  VDELTFNSKRKYMAVKVD----SPANSGKHIIYVKGAFERILERSASFIGGAGKVEKLSD 535
            ++ L FNS RK M+  V     +P +  + ++  KGA   I  R  +   GA     L  
Sbjct: 853  LNTLEFNSTRKRMSCIVKIPGANPDDEPRALLICKGADSIIYSRLGT-KNGANSENLLEK 911

Query: 536  SHKSLINDCAKSLASEGLRTLAFAQLECS------------------TNK-----PMNDS 572
            +   L     +  A+EGLRTL  AQ E S                  TN+      ++D 
Sbjct: 912  TALHL-----EQYATEGLRTLCIAQRELSWPEYLEWNKRYDIAAASVTNREEQLEAVSDE 966

Query: 573  TIQNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVINP 632
              + LT +G   ++D  +  V  +I  L Q G+ + ++TGD   TA+NI       ++N 
Sbjct: 967  IERELTLLGGTAIEDRLQDGVPESISILAQAGIKLWVLTGDKVETAINIG--FSCNLLNN 1024

Query: 633  EISVL----TGDRLDQMTDD 648
            ++ +L     GD + +  +D
Sbjct: 1025 DMELLVVKTNGDDVQEFGND 1044

 Score = 30.4 bits (67), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 661  ARATPEHKLNIVRALQKRGDIVAMT-GDGVNDAPALKLADIGVAMG 705
             R +P  K  +V+ +    D++ +  GDG ND   ++ AD+GV + 
Sbjct: 1119 CRVSPAQKAAVVKLVMTSLDVMTLAIGDGSNDVAMIQSADVGVGIA 1164

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 72/167 (43%), Gaps = 39/167 (23%)

Query: 575  QNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVINPEI 634
            ++LT +G IG++D  +  V  AI++L + G+ + M+TGD   TA+NI     +      +
Sbjct: 998  RDLTLLGTIGIEDKLQEGVPDAIDKLRRAGIKMWMLTGDKRETAINIGYSCRLIHDYSTV 1057

Query: 635  SVLT------GDRLDQMTDDQLAGVIDH---------VNIF------------------- 660
             +L         ++  +T +  AG + H         + IF                   
Sbjct: 1058 IILAPNDENMASKITTITQEIEAGNVAHCVVVIDGATLTIFEGNLTLMTLFIELCTKTDS 1117

Query: 661  ---ARATPEHKLNIVRALQK--RGDIVAMTGDGVNDAPALKLADIGV 702
                R++P  K  +V  ++K  +  +    GDG ND   ++ ADIGV
Sbjct: 1118 VICCRSSPSQKALMVTKIRKTDKKLVTLAIGDGANDIAMIQSADIGV 1164

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 20/33 (60%)

Query: 365 VETLGSVNVICSDKTGTLTANHMTASKIWCLGS 397
           +E LG V+ I SDKTGTLT N M   K    G+
Sbjct: 495 LEELGQVSYIFSDKTGTLTDNRMIFRKFSFCGT 527

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
           Saccharomyces cerevisiae YER166w or sp|Q12675
           Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 77/170 (45%), Gaps = 39/170 (22%)

Query: 483 LTFNSKRKYMAVKVD----SPANSGKHIIYVKGAFERILERSASFIGGAGKVEKLSDSHK 538
           L FNS RK M+  +     +P +  + ++  KGA   I  R ++         K  ++ +
Sbjct: 836 LEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLST---------KAGENDE 886

Query: 539 SLINDCA---KSLASEGLRTLAFAQLECS------------------TNKP-----MNDS 572
           +L+   A   +  A+EGLRTL  AQ E +                  TN+      ++DS
Sbjct: 887 TLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLEIVSDS 946

Query: 573 TIQNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIA 622
             ++L  +G   ++D  +  V  +I  L + G+ + ++TGD   TA+NI 
Sbjct: 947 IERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIG 996

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 661  ARATPEHKLNIVRALQKRGDIVAMT-GDGVNDAPALKLADIGVAMG 705
             R +P  K  +V+ ++   D++ +  GDG ND   ++ AD+G+ + 
Sbjct: 1099 CRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIA 1144

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 83/194 (42%), Gaps = 39/194 (20%)

Query: 483  LTFNSKRKYMAVKVD----SPANSGKHIIYVKGAFERILERSASFIGGAGKVEKLSDSHK 538
            L FNS RK M+  V     +P +  + ++  KGA + I+    S   G+     L  +  
Sbjct: 840  LEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGA-DSIIYSRLSRQSGSNSEAILEKTAL 898

Query: 539  SLINDCAKSLASEGLRTLAFAQLECSTNKP-----------------------MNDSTIQ 575
             L     +  A+EGLRTL  AQ E S ++                        + DS  +
Sbjct: 899  HL-----EQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDELEVVADSIER 953

Query: 576  NLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVINPEIS 635
             L  +G   ++D  +  V   IE L + G+ + ++TGD   TA+NI       ++N E+ 
Sbjct: 954  ELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIG--FSCNLLNNEME 1011

Query: 636  VL----TGDRLDQM 645
            +L    TGD + + 
Sbjct: 1012 LLVIKTTGDDVKEF 1025

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 661  ARATPEHKLNIVRALQKRGDIVAMT-GDGVNDAPALKLADIGVAMG 705
             R +P  K  +V+ ++   D++ +  GDG ND   ++ AD+G+ + 
Sbjct: 1103 CRVSPSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIA 1148

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
           Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 67/283 (23%), Positives = 110/283 (38%), Gaps = 70/283 (24%)

Query: 178 GDLVYFKVGDRIPADVRII----ESTDLSLDESTLTGETEPVHKSCTP------------ 221
           G+ V     D +PAD+ ++    E+ +  ++   L GET    K+  P            
Sbjct: 280 GEFVLLNSDDWVPADILLLSTDGENNEAFVETMALDGETNLKSKNPLPELAKRMTSATGL 339

Query: 222 -VNSATYS---------------DVPGGIIPIGERTSIAYMGTLVREGHG-KGIVVATGK 264
            ++SAT +               ++ G + P+G   ++ Y G+++R      GIV+ TG+
Sbjct: 340 SMHSATTTLEDPNNDLYNFEGTVEIDGELYPLGS-DNVVYRGSILRNTQSIVGIVIFTGE 398

Query: 265 HTMFGAVFEMMNSIEKPKTPLQMAMDTLRRDLSYVRFVLSGIIFL--LG--------VIQ 314
            T        MN+I+ P+T        +   + ++ FV++ +     LG        V  
Sbjct: 399 ETKI-----RMNAIKNPRTKAPKLQGKINLIVLFMVFVVAAMAMFSYLGQHILKKNYVDN 453

Query: 315 GRSWLEMFQISVSLAVAA----------IPEGLPIIVTVTLALGVLRM----------AN 354
            R+W  +FQ     A             IP  L +   +  A+    M          ++
Sbjct: 454 NRAWY-LFQEDAGTAPTIMSFIIMYNTLIPLSLYVTTEIIKAMQSKLMEWDIDMYHIESD 512

Query: 355 RKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTASKIWCLGS 397
                R    +E LG V+ I SDKTGTLT N M   K    GS
Sbjct: 513 TPCESRTATILEELGQVSYIFSDKTGTLTDNKMIFRKFSICGS 555

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 73/180 (40%), Gaps = 40/180 (22%)

Query: 576  NLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVINPEIS 635
            +L  +G   ++D  +  V  AI+++ + G+ + M+TGD   TA+NI     +      + 
Sbjct: 998  DLELLGATAIEDKLQEGVPEAIQKIRRAGIKMWMLTGDKRETAINIGYACKLIYDYSTVV 1057

Query: 636  VLT-------------GDRLDQMTDDQLAGVIDHVN------------------------ 658
            +L              G+ LD         VID  +                        
Sbjct: 1058 ILKKNDDNLISKMTALGEELDTGKIAHCVLVIDGASLAVFENNPTMMSVFIELCTKTDSV 1117

Query: 659  IFARATPEHKLNIVRALQ-KRGDIVAMT-GDGVNDAPALKLADIGVAM-GHMGTDVAKEA 715
            I  RA+P  K  IV  ++ K  D+V +  GDG ND   ++ ADIGV + G  G   ++ +
Sbjct: 1118 ICCRASPSQKALIVTNIRLKNKDLVTLAIGDGANDIAMIQSADIGVGITGKEGLQASRSS 1177

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 25/40 (62%)

Query: 480 VDELTFNSKRKYMAVKVDSPANSGKHIIYVKGAFERILER 519
           ++ + F+S+RK M+V V  P +  + ++  KGA   ILER
Sbjct: 746 LEYINFDSQRKRMSVAVKMPNDDDRVLLICKGADNVILER 785

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 72/170 (42%), Gaps = 40/170 (23%)

Query: 483  LTFNSKRKYMAVKVDSPANSG----KHIIYVKGAFERILERSASFIGGAGKVEKLSDSHK 538
            L FNS RK M+  V  P +      K ++  KGA   I  R          ++K   + +
Sbjct: 847  LEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSR----------LDKTGLNEE 896

Query: 539  SLINDCA---KSLASEGLRTLAFAQLECSTNK-----------------------PMNDS 572
            SL+   A   +  A+EGLRTL  AQ E S  +                        ++D 
Sbjct: 897  SLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKVSDE 956

Query: 573  TIQNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIA 622
              ++L  +G   ++D  +  V  +I  L + G+ + ++TGD   TA+NI 
Sbjct: 957  IERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIG 1006

>Scas_669.3
          Length = 1638

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 80/192 (41%), Gaps = 36/192 (18%)

Query: 236 PIGERTSIAYMGTLVREGHGK-GIVVATGKHTMFGAVFEMMNSIEKPKTP---LQMAMDT 291
           P+G   ++AY G+++R      G+V+ TGK T        MN++  P+T    LQ  ++ 
Sbjct: 387 PVGP-DNVAYRGSIIRNTDNVIGMVIYTGKETKI-----RMNALNNPRTKAPKLQKNINI 440

Query: 292 LRRDLSYVRFVLSGIIFLLGVIQGRSWLEMFQISVSLAVAA----------------IPE 335
           +   + +V  V+S   +L  V+Q +  ++  Q    L   A                IP 
Sbjct: 441 IITFMVFVVAVISLFSYLGHVLQNKKAIDENQAWYLLTKDAGAAPTIMSFIIMYNTIIPL 500

Query: 336 GLPIIVTVTLALGVLRM----------ANRKAIVRRLPSVETLGSVNVICSDKTGTLTAN 385
            L + + +  A+    M           N     R    +E LG V+ + SDKTGTLT N
Sbjct: 501 SLYVTMEIIKAMQSKMMEWDIDMYHSETNTPCESRTATILEELGQVSYMFSDKTGTLTDN 560

Query: 386 HMTASKIWCLGS 397
            M   K    GS
Sbjct: 561 KMIFRKFSICGS 572

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 29/48 (60%)

Query: 575  QNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIA 622
            Q+L  +G   ++D  +  V  AIE++ + G+ + M+TGD   TA+NI 
Sbjct: 1052 QDLQLLGATAIEDKLQEGVSEAIEKIRRAGIKIWMLTGDKRETAINIG 1099

 Score = 33.9 bits (76), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 25/40 (62%)

Query: 480 VDELTFNSKRKYMAVKVDSPANSGKHIIYVKGAFERILER 519
           ++ + FNS+RK M+V V +P    K ++  KGA   ILER
Sbjct: 779 LNYIDFNSQRKRMSVLVKTPDEPNKVLLICKGADNMILER 818

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 53/211 (25%), Positives = 91/211 (43%), Gaps = 41/211 (19%)

Query: 483  LTFNSKRKYMA--VKV--DSPANSGKHIIYVKGAFERILERSASFIGGAGKVEKLSDSHK 538
            L FNS RK M+  +K+   +P +  K ++  KGA   I  R       A  +EK +    
Sbjct: 885  LEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDRTQNDATLLEKTALH-- 942

Query: 539  SLINDCAKSLASEGLRTLAFAQLECS------------------TNK-----PMNDSTIQ 575
                   +  A+EGLRTL  AQ E +                  TN+      + D   +
Sbjct: 943  ------LEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDKVTDVIER 996

Query: 576  NLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVINPEIS 635
             L  +G   ++D  +  V  +I  L + G+ + ++TGD   TA+NI       V+N ++ 
Sbjct: 997  ELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIG--FSCNVLNNDME 1054

Query: 636  VL----TGDRLDQMTDDQLAGVIDHVNIFAR 662
            +L    +G+ +++   D +  V + V  + R
Sbjct: 1055 LLVVKASGEDVEEFGSDPIQVVNNLVTKYLR 1085

 Score = 34.3 bits (77), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 45/101 (44%), Gaps = 3/101 (2%)

Query: 661  ARATPEHKLNIVRALQKRGDIVAMT-GDGVNDAPALKLADIGVAMGHMGTDVAKEASDMV 719
             R +P  K  +V+ ++K  D++ +  GDG ND   ++ AD+GV +       A   SD  
Sbjct: 1146 CRVSPAQKAAVVKLVKKTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYA 1205

Query: 720  LTDDDFSTILTAIEEGKGIFNNIQSFL-TFQLSTSVAALSL 759
            +    + T L  +  GK  +  +   +  F     +  LSL
Sbjct: 1206 IGQFRYVTRLVLV-HGKWCYKRLAEMIPQFFYKNVIFTLSL 1245

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/234 (23%), Positives = 88/234 (37%), Gaps = 65/234 (27%)

Query: 546  KSLASEGLRTLAFAQL---------------ECSTNKPMNDSTIQN--------LTFVGL 582
            +S ++EGLRTL FA                 E  T+       I          L  +G 
Sbjct: 966  ESFSTEGLRTLLFAHKWISNEDFEQWRTRYHEAKTSLSERKQKIDEVGAQIEDELYLLGA 1025

Query: 583  IGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGI--------------- 627
              ++D  +  V  AIE++ + G+ + M+TGD   TA+NI     +               
Sbjct: 1026 TAIEDKLQEGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCKLIHDYSTVVILTTSDE 1085

Query: 628  ------PVINPEIS---------VLTGDRLDQMTDD--------QLAGVIDHVNIFARAT 664
                    I+ E+          V+ G  L    D+        +L    D V +  RA+
Sbjct: 1086 NIISKMNAISQEVDSGNVAHCVIVIDGATLAMFEDNPTLMSVFTELCTKTDSV-VCCRAS 1144

Query: 665  PEHKLNIVRALQK--RGDIVAMTGDGVNDAPALKLADIGVAM-GHMGTDVAKEA 715
            P  K  +V  ++   +  +    GDG ND   ++ ADIGV + G  G   ++ A
Sbjct: 1145 PAQKALMVSNIRNTDKSIVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRSA 1198

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 66/290 (22%), Positives = 115/290 (39%), Gaps = 79/290 (27%)

Query: 178 GDLVYFKVGDRIPADVRIIES----TDLSLDESTLTGETEPVHKSCTP-VNSATYS---- 228
           GD V  +  D +PAD+ I+ S    +++ ++   L GET    K   P +N  T S    
Sbjct: 269 GDFVLLQQDDWVPADILILTSDGDNSEVFIETMALDGETNLKGKVPHPEINKLTKSASGL 328

Query: 229 -----------------DVPGGI-----------IPIGERTSIAYMGTLVREGHG-KGIV 259
                            +  G +            P+G   ++ Y G+++R      G+V
Sbjct: 329 ANINAQVTVEDPNNDLYNFEGNLELNSGSSSKKKYPLGP-DNVIYRGSIIRNTRNCVGMV 387

Query: 260 VATGKHTMFGAVFEMMNSIEKPKTP---LQMAMDTLRRDLSYVRFVLSGIIFLLGVIQ-- 314
           + TG+ +        MN++  P+T    LQ  ++ +   + +V   +S   +L   IQ  
Sbjct: 388 IFTGEESKI-----RMNALRNPRTKAPKLQRKINMIVVFMVFVVACMSLFSYLGHTIQIK 442

Query: 315 -----GRSWLEMFQISVSLA------VAAIPEGLPIIVTVTLALGVLRMANRKAI----- 358
                 ++W  + Q     A      +      +P+ + VT+ L  +++A  + +     
Sbjct: 443 RYVNNNKAWY-LLQEDAGTAPTIMSFIIMYNTIIPLSLYVTMEL--IKVAQSRMMEWDID 499

Query: 359 -----------VRRLPSVETLGSVNVICSDKTGTLTANHMTASKIWCLGS 397
                      VR    +E LG V+ I SDKTGTLT N M   K+   G+
Sbjct: 500 MYHAESDTPCAVRTATILEELGQVSYIFSDKTGTLTDNKMLFRKLSFCGT 549

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 22/35 (62%)

Query: 485 FNSKRKYMAVKVDSPANSGKHIIYVKGAFERILER 519
           FNS+RK M+V V  P    + +++ KGA   ILER
Sbjct: 760 FNSQRKRMSVIVRVPEEKDRVLLFCKGADNVILER 794

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of the
            Drs2p-like family of the P-type ATPase superfamily of
            membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/220 (22%), Positives = 90/220 (40%), Gaps = 62/220 (28%)

Query: 548  LASEGLRTLAFA-------QLECSTNK------PMNDSTIQ----------NLTFVGLIG 584
             ++EGLRTL +A       Q E    +       + D  I+           L  +G+  
Sbjct: 1028 FSTEGLRTLVYAYKWIDIGQYENWNKRYHQAKTSLTDRKIKVDEAGAEIEDGLNLLGVTA 1087

Query: 585  MKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVINPEISVLTG----- 639
            ++D  +  V  AIE++ + G+ + M+TGD   TA+NI     +      + +LT      
Sbjct: 1088 IEDKLQDGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCMLIKDYSTVVILTTTDENI 1147

Query: 640  -DRLDQMTDDQLAGVIDH-------------------VNIF------------ARATPEH 667
              +++ ++ +  +G I H                   +++F             RA+P  
Sbjct: 1148 ISKMNAVSQEVDSGNIAHCVVVIDGATMAMFEGNPTYMSVFVELCTKTDSVICCRASPSQ 1207

Query: 668  KLNIVRALQKRG-DIVAMT-GDGVNDAPALKLADIGVAMG 705
            K  +V  ++    ++V +  GDG ND   ++ ADIGV + 
Sbjct: 1208 KALMVSNIRNTDPNLVTLAIGDGANDIAMIQSADIGVGIA 1247

 Score = 38.1 bits (87), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 78/193 (40%), Gaps = 38/193 (19%)

Query: 236 PIGERTSIAYMGTLVREGHGK-GIVVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRR 294
           P+G   ++ Y G+++R      G+V+ +G+ T        MN+++ P+T        +  
Sbjct: 401 PLGP-DNVIYRGSILRNTQNVVGMVIFSGEETKI-----RMNALKNPRTKAPKLQRKINM 454

Query: 295 DLSYVRFVLSGIIFL--LGVI--------QGRSWLEMFQISVSLAVA----------AIP 334
            + ++ FV++ I     LG +        Q ++W  +FQ    +A             IP
Sbjct: 455 IIVFMVFVVATISLFSYLGHVLHKKKYIDQNKAWY-LFQADAGVAPTIMSFIIMYNTVIP 513

Query: 335 EGLPIIVTVTLALGVLRM----------ANRKAIVRRLPSVETLGSVNVICSDKTGTLTA 384
             L + + +   +    M           N     R    +E LG V+ I SDKTGTLT 
Sbjct: 514 LSLYVTMEIIKVVQSKMMEWDIDMYHAETNTPCESRTATILEELGQVSYIFSDKTGTLTD 573

Query: 385 NHMTASKIWCLGS 397
           N M   K    GS
Sbjct: 574 NKMIFRKFSLCGS 586

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
            cerevisiae YER166w, start by similarity
          Length = 1576

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 82/195 (42%), Gaps = 48/195 (24%)

Query: 483  LTFNSKRKYMA----VKVDSPANSGKHIIYVKGAFERILERSASFIGGAGKVEKLSDSHK 538
            L FNS RK M+    +  ++P    + ++  KGA   I  R +             ++ +
Sbjct: 885  LEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIYSRLSK------------NNDE 932

Query: 539  SLINDCA---KSLASEGLRTLAFAQLECSTNK-----------------------PMNDS 572
             L+   A   +  A+EGLRTL  AQ E S  +                        + D 
Sbjct: 933  KLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDREDEMEKVADV 992

Query: 573  TIQNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVINP 632
              + LT +G   ++D  +  V  +I  L + G+ + ++TGD   TA+NI       ++N 
Sbjct: 993  IERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIG--FSCNLLNN 1050

Query: 633  EISVL----TGDRLD 643
            E+ +L    +GD +D
Sbjct: 1051 EMELLVIKASGDDVD 1065

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 661  ARATPEHKLNIVRALQKRGDIVAMT-GDGVNDAPALKLADIGVAMG 705
             R +P  K  +V+ ++   D++ +  GDG ND   ++ ADIGV + 
Sbjct: 1145 CRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIA 1190

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 68/170 (40%), Gaps = 41/170 (24%)

Query: 483  LTFNSKRKYMAVKVDSPA----NSGKHIIYVKGAFERILERSASFIGGAGKVEKLSDSHK 538
            L FNS RK M+  V  PA    +  K ++  KGA   I  R              S +  
Sbjct: 847  LEFNSTRKRMSCIVKIPAADENSKPKALLLCKGADSVIYSRLDR-----------SRNDP 895

Query: 539  SLINDCA---KSLASEGLRTLAFAQLECSTNKPMN-----------------------DS 572
             L+   A   +  A+EGLRTL  AQ E   ++ +N                       D+
Sbjct: 896  KLLERTALHLEQFATEGLRTLCVAQREIDWDEYLNWNERRELAAASLDNREEALERVADA 955

Query: 573  TIQNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIA 622
              + L  +G   ++D  +  V  +I  L   G+ + ++TGD   TA+NI 
Sbjct: 956  IERQLVLLGGTAIEDRLQDGVPDSISILADAGIKLWVLTGDKVETAINIG 1005

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 661  ARATPEHKLNIVRALQKRGDIVAMT-GDGVNDAPALKLADIGVAMG 705
             R +P  K  +V+ +++  D+V +  GDG ND   ++ AD+G+ + 
Sbjct: 1108 CRVSPSQKAAVVKLVKESLDVVTLAIGDGSNDVAMIQAADVGIGIA 1153

>Scas_636.16
          Length = 1554

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 51/198 (25%), Positives = 83/198 (41%), Gaps = 41/198 (20%)

Query: 483  LTFNSKRKYMAVKVDSPANSGKH----IIYVKGAFERILERSASFIGGAGKVEKLSDSHK 538
            L FNS RK M+  V  P  + K     ++  KGA   I  R +          K   + +
Sbjct: 819  LEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLS---------RKPGYNDE 869

Query: 539  SLINDCA---KSLASEGLRTLAFAQLECST------NKPMN-----------------DS 572
            +L+   A   +  A+EGLRTL   Q E S       N+  N                 D 
Sbjct: 870  TLLEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHVADL 929

Query: 573  TIQNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVINP 632
              ++L  +G   ++D  +  V  +I  L + G+ + ++TGD   TA+NI     +   + 
Sbjct: 930  IERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDM 989

Query: 633  EISVL--TGDRLDQMTDD 648
            E+ V+  TG+ + +  DD
Sbjct: 990  ELLVIKTTGEDVKEFGDD 1007

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 38/83 (45%), Gaps = 2/83 (2%)

Query: 661  ARATPEHKLNIVRALQKRGDIVAMT-GDGVNDAPALKLADIGVAMGHMGTDVAKEASDMV 719
             R +P  K  +V+ ++   D++ +  GDG ND   ++ AD+GV +       A   SD  
Sbjct: 1082 CRVSPAQKAAVVKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYA 1141

Query: 720  LTDDDFSTILTAIEEGKGIFNNI 742
            +    + T L  +  GK  +  +
Sbjct: 1142 IGQFRYVTRLVLV-HGKWCYKRL 1163

>Kwal_23.3556
          Length = 1597

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 69/287 (24%), Positives = 112/287 (39%), Gaps = 76/287 (26%)

Query: 178 GDLVYFKVGDRIPADVRIIESTD---------LSLDESTLTGETEPVHKSCTPVNSAT-- 226
           GD V  +  + +PAD+ ++  +D         ++LD  T     +P+ +    + +A   
Sbjct: 273 GDYVVLEQDEWVPADMLVLTCSDEKNECFVETMALDGETNLKNKQPLTEVSEVMKTAAGL 332

Query: 227 ---------------YSDVPGGIIPIGERTS-------IAYMGTLVRE-GHGKGIVVATG 263
                            +  G +  +GE          I Y G+++R   +  G+VV TG
Sbjct: 333 TEFKAKVTVEDPNIDLHNFEGNLELLGENRKLTIGPDHIIYRGSIIRNTSNAVGMVVFTG 392

Query: 264 KHTMFGAVFEMMNSIEKP--KTP-LQMAMDTLRRDLSYVRFVLSGIIF--LLG------- 311
           + T        MN+I+ P  K P LQ A++ +   + ++ FV++ +    LLG       
Sbjct: 393 EETKI-----RMNAIKNPRIKAPKLQRAINLI---VLFMVFVVASMALFSLLGQRIIKKK 444

Query: 312 -VIQGRSWLEMFQISVSLAVAA----------IPEGLPIIVTVTLALGVLRM-------- 352
            V   R+W  +F     LA             IP  L + + +  A+    M        
Sbjct: 445 YVDNNRAWY-LFNSDAGLAPTVMSFIIMYNTLIPLSLYVTMEIIKAMQSKLMEWDIDMYH 503

Query: 353 --ANRKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTASKIWCLGS 397
              N     R    +E LG V+ I SDKTGTLT N M    +   GS
Sbjct: 504 AETNTPCESRTATILEELGQVSYIFSDKTGTLTDNKMVFRALSVCGS 550

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 75/191 (39%), Gaps = 43/191 (22%)

Query: 576  NLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIG--------- 626
            +L  +G   ++D  +  V  AI+++ + G+ + M+TGD   TA+NI              
Sbjct: 1018 SLHLLGATAIEDKLQEGVADAIDKIRRAGIKMWMLTGDKRETAINIGYSCNLIHDYSTVV 1077

Query: 627  ------------IPVINPEIS---------VLTGDRLDQMTDD--------QLAGVIDHV 657
                        +  ++ EI          V+ G  L     +        +L    D V
Sbjct: 1078 ILSAKDENISSKLTAVSQEIERGNIAHCVVVIDGSTLTTFESNPTLMSVFVELCTKTDSV 1137

Query: 658  NIFARATPEHK---LNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKE 714
             I  RA+P  K   +  +R   K+   +A+ GDG ND   ++ ADIGV +       A  
Sbjct: 1138 -ICCRASPSQKALMVTHIRNTDKKLVTLAI-GDGANDIAMIQSADIGVGIAGKEGLQASR 1195

Query: 715  ASDMVLTDDDF 725
            +SD  +    F
Sbjct: 1196 SSDYSIAQFRF 1206

>YDL150W (RPC53) [718] chr4 (183344..184612) RNA polymerase III,
           fourth-largest essential subunit (C53) [1269 bp, 422 aa]
          Length = 422

 Score = 33.5 bits (75), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 3/67 (4%)

Query: 696 KLADIGVAMGHMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVA 755
           KLAD+G+       D  + A+++ L + D   IL  +   K + N  + F+ FQL T + 
Sbjct: 258 KLADLGLEKEFQSVDGKEAAAELELLNADHQHILRKL---KKMNNKPERFMVFQLPTRLP 314

Query: 756 ALSLVAI 762
           A    A+
Sbjct: 315 AFERPAV 321

>Scas_505.4
          Length = 1025

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 34/185 (18%), Positives = 76/185 (41%), Gaps = 12/185 (6%)

Query: 662 RATPEHKLNIVRALQKR-GDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVL 720
           R +P  K  +V+ ++++   ++   GDG ND   ++ A +GV +  M    A  ++D+ +
Sbjct: 593 RVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAV 652

Query: 721 TDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALS---LVAIATAFKLQNPLNAMQI 777
               F   L  +  G   +  I   + +    + A          A AF  Q+ + +  +
Sbjct: 653 GQFRFLKKLLLV-HGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTM 711

Query: 778 LWINILMDGPPAQSLGV--EPVDHEVMRKPPR----KRSDKILTPQVMRRLLINAAFIIG 831
            + N+     P   +GV  + V   ++ + P+     +  K  + ++    ++N  F   
Sbjct: 712 SYYNVFFTVFPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVN-GFYHS 770

Query: 832 GTIYV 836
             +Y+
Sbjct: 771 AVVYI 775

>KLLA0E17963g complement(1587614..1596283) similar to sp|P19158
            Saccharomyces cerevisiae YOL081w IRA2 GTPase-activating
            protein for RAS proteins, start by similarity
          Length = 2889

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 61/148 (41%), Gaps = 21/148 (14%)

Query: 430  VKATLRIGS--ICNNASFSHEHGKYLGNPTDIALLEVLQKF-DLVDERPTTTRVDELTFN 486
            VK  LR+ +  + N  SF H+   Y G     AL+E ++ F DL   R T   VDEL   
Sbjct: 1736 VKINLRMQNRVLPNEFSFLHKFLYYHGLEMRNALIEDIKSFDDLATVRETAEAVDELLSL 1795

Query: 487  SKRKYMAVKVDSPANSGKHIIYVKGAFERILERSASFIGGAGKVEKLSDSHKSLINDCA- 545
              +  M  K + PA       Y++   E   E     I  A K  +  +      N+C  
Sbjct: 1796 MGQPRMEFKNEIPA-------YIREHSETSSELYEFMIKQAVKCPETPE------NECKF 1842

Query: 546  --KSLASEGLRTLAFAQLECSTNKPMND 571
              +S+ SEGL  + F    C   K  ND
Sbjct: 1843 VQESVTSEGLPVVIFNW--CEYQKDGND 1868

>CAGL0L08778g complement(956737..957939) similar to tr|Q12297
           Saccharomyces cerevisiae YPL011c TAF47 component of the
           TBP-associated protein complex, start by similarity
          Length = 400

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 51/111 (45%), Gaps = 16/111 (14%)

Query: 646 TDDQLAGVIDHVNIFARATPEHKL-NIVRALQKRGDIVAMTGDGVND------APAL--- 695
           T D+L+ +  ++ I   + PE++L NI  + +   D      DG++D      +PA    
Sbjct: 281 TKDKLSQLTQYLPI---SKPENRLQNIALSYENEQDDADEINDGIDDYHSESASPATLTD 337

Query: 696 -KLADIGVAMG--HMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQ 743
            KL D   +MG  H+  D+A E  DM+  D  F       +E + + N  Q
Sbjct: 338 EKLIDDIQSMGPMHLQNDIAVEDDDMMPMDYQFDDPDAMFDEQEDMDNTFQ 388

>CAGL0H07579g 740607..742067 highly similar to sp|P04807
           Saccharomyces cerevisiae YGL253w HXK2 or sp|P04806
           Saccharomyces cerevisiae YFR053c HXK1, start by
           similarity
          Length = 486

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 53/120 (44%), Gaps = 21/120 (17%)

Query: 349 VLRMANRKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTASK-----IWCLGSMANKNN 403
           V+ M  ++   R LP ++ +  +N    D TGTL A+  T  +     I+  G      +
Sbjct: 188 VIPMLQKQIEKRNLP-IDIVALIN----DTTGTLVASLYTDGETKMGVIFGTGVNGAYYD 242

Query: 404 VLSLEAKSSGGLPGKLPNLKNYLSDDVKATLRIGSICNNASFSHEHGKYLGNPTDIALLE 463
           V+S            +P L+  L+DD+ ++  +   C   SF +EH     N  DIA+ E
Sbjct: 243 VVS-----------DIPKLEGKLADDIPSSSLMAINCEYGSFDNEHVVLPRNKYDIAIDE 291

>Scas_706.13
          Length = 1568

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 32/70 (45%), Gaps = 7/70 (10%)

Query: 466  QKFDLVDERPTTTRVDELTFNS---KRKYMAVKVDSPANSGKHIIYVKGAF----ERILE 518
            ++F+L+DE PTT  +++ T NS   K  Y   K+D       H   +   F      IL 
Sbjct: 1238 ERFELIDEYPTTIFIEKFTINSVKVKLDYKPKKIDYSGLRSGHTTELMNFFILDGANILL 1297

Query: 519  RSASFIGGAG 528
            +SA   G  G
Sbjct: 1298 KSAVLYGVNG 1307

>Kwal_33.15353
          Length = 215

 Score = 30.0 bits (66), Expect = 7.5,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 29/58 (50%), Gaps = 3/58 (5%)

Query: 5   GKMSDNPFDSYLNRSKDDSSMETKSLASEAFLKPNAS-LEYCTMTVDETLRQLNTDSA 61
            K  D+ +D+Y NR K+     TKS A E FLK  A  L     T D  L+ +N D A
Sbjct: 133 AKHMDDFYDNY-NRKKEQQLKNTKSEA-EKFLKERAEFLNQNNTTWDRVLQLINVDDA 188

>ACL130C [919] [Homologous to ScYGR208W (SER2) - SH]
           (124650..125600) [951 bp, 316 aa]
          Length = 316

 Score = 30.0 bits (66), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 683 AMTGDGVNDAPALKLADIGVAMGHMGTDVAKEA 715
           AM GDG ND PA+  A +G+A  H    V ++A
Sbjct: 251 AMVGDGANDLPAMHAAGLGIAW-HAKPRVQQQA 282

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.135    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 28,577,780
Number of extensions: 1195234
Number of successful extensions: 3591
Number of sequences better than 10.0: 91
Number of HSP's gapped: 3487
Number of HSP's successfully gapped: 172
Length of query: 940
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 829
Effective length of database: 12,753,511
Effective search space: 10572660619
Effective search space used: 10572660619
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)