Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AEL297W89587946380.0
KLLA0A03069g89590132120.0
CAGL0I04224g94293529560.0
Scas_668.1887591429420.0
YGL163C (RAD54)89892129410.0
Kwal_14.153784284627230.0
Scas_718.409266409761e-117
YBR073W (RDH54)9246389521e-114
AGL212W9036309271e-111
Kwal_27.105139006379231e-110
KLLA0F11814g9315559101e-108
CAGL0M01958g9207339071e-108
KLLA0E22726g10335357481e-84
Scas_549.410795397291e-81
Sklu_2125.310525367243e-81
CAGL0I01694g10715657112e-79
YJR035W (RAD26)10855367061e-78
AEL065C10255366882e-76
Kwal_34.160827264726162e-68
CAGL0C01683g11155006118e-66
Scas_652.1710254916043e-65
YOR304W (ISW2)11204845959e-64
CAGL0I09614g10394845851e-62
Kwal_14.160011024925842e-62
YER164W (CHD1)14684875862e-62
CAGL0M04807g17304885863e-62
KLLA0F24838g10624885798e-62
KLLA0E23804g18735435821e-61
Kwal_26.916414544905755e-61
Kwal_56.2344214354925756e-61
Scas_662.713424885748e-61
Kwal_23.477713014885739e-61
KLLA0F04521g13445215731e-60
Scas_597.810654955701e-60
YOR290C (SNF2)17034885712e-60
Kwal_34.1592510254885672e-60
CAGL0L11770g14764875693e-60
AER375C12884885674e-60
AFR562C14444895684e-60
Scas_665.1710604845639e-60
AFL040W10864855612e-59
KLLA0F06710g10964855594e-59
Scas_576.614574865587e-59
KLLA0C17578g15254815571e-58
Scas_594.717034895562e-58
KLLA0B08327g15344885552e-58
CAGL0H05533g19045465553e-58
YBR245C (ISW1)11294895505e-58
AEL256C18665405445e-57
YIL126W (STH1)13594885419e-57
AFR537W10254845353e-56
CAGL0G08756g13544885347e-56
Scas_664.918595475322e-55
CAGL0J02662g8445285242e-55
AGR123C14224885303e-55
YPL082C (MOT1)18675485285e-55
KLLA0E04048g8265215171e-54
YAL019W (FUN30)11315415185e-54
ACR286C10195375061e-52
KLLA0F07513g10485195061e-52
Kwal_26.712310815455034e-52
Kwal_47.180778095274951e-51
ADL098C8045284941e-51
Scas_548.410545634953e-51
CAGL0H06193g11265284856e-50
ADR309W14862983333e-31
Scas_646.3*14563033333e-31
Kwal_55.2014314943023324e-31
YDR334W15143063262e-30
CAGL0M01188g14503033234e-30
KLLA0F21758g15723033172e-29
Scas_669.2013973023012e-27
Kwal_27.1138813343042931e-26
YGL150C (INO80)14893112894e-26
YFR038W8532622875e-26
Sklu_1582.22831632715e-26
Scas_520.58631532868e-26
CAGL0E05038g14841582852e-25
KLLA0E08965g14892092852e-25
AGR379W14141572832e-25
AFR220W10851602304e-19
AAR147W15802152225e-18
KLLA0F17479g11141792162e-17
ADL345C7461722072e-16
Kwal_14.186813571192082e-16
CAGL0A03432g11511772063e-16
Kwal_47.177719721582054e-16
Kwal_23.36607681722035e-16
CAGL0K07766g8301722036e-16
KLLA0B09240g8001722028e-16
YBR114W (RAD16)7901731973e-15
KLLA0C05368g16051371965e-15
YLR032W (RAD5)11691811948e-15
Scas_721.10011371741931e-14
Scas_591.107721731912e-14
Scas_674.12d13231621912e-14
YOR191W (RIS1)16191241894e-14
CAGL0G09493g14081591885e-14
Sklu_2412.711271861832e-13
AAL030C15391591474e-09
KLLA0F12166g15281761412e-08
Kwal_14.128715181491341e-07
YLR247C15561241285e-07
Scas_573.91502631205e-06
CAGL0B05049g1470631181e-05
Sklu_2234.210061161071e-04
Sklu_2432.91475871035e-04
KLLA0E10527g371109810.12
Scas_720.1751985780.32
Kwal_56.2400553377760.56
AFL080W53577741.0
KLLA0C15499g50470731.6
Scas_588.1669356722.0
CAGL0H03377g54077712.2
YJR124C44861712.5
KLLA0F23716g554176712.8
YGL234W (ADE5,7)802121712.9
KLLA0D08932g27836693.3
YGL078C (DBP3)52377694.9
KLLA0E04763g63660685.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AEL297W
         (879 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AEL297W [2208] [Homologous to ScYGL163C (RAD54) - SH] complement...  1791   0.0  
KLLA0A03069g complement(271516..274203) similar to sp|P32863 Sac...  1241   0.0  
CAGL0I04224g complement(369858..372686) highly similar to sp|P32...  1143   0.0  
Scas_668.18                                                          1137   0.0  
YGL163C (RAD54) [1826] chr7 complement(193711..196407) DNA-depen...  1137   0.0  
Kwal_14.1537                                                         1053   0.0  
Scas_718.40                                                           380   e-117
YBR073W (RDH54) [263] chr2 (383172..385946) Protein required for...   371   e-114
AGL212W [4100] [Homologous to ScYBR073W (RDH54) - SH] complement...   361   e-111
Kwal_27.10513                                                         360   e-110
KLLA0F11814g complement(1089699..1092494) similar to sp|P38086 S...   355   e-108
CAGL0M01958g complement(238113..240875) similar to sp|P38086 Sac...   353   e-108
KLLA0E22726g complement(2018248..2021349) similar to sp|P40352 S...   292   1e-84
Scas_549.4                                                            285   1e-81
Sklu_2125.3 YJR035W, Contig c2125 6474-9632                           283   3e-81
CAGL0I01694g complement(141422..144637) similar to sp|P40352 Sac...   278   2e-79
YJR035W (RAD26) [2931] chr10 (497269..500526) Putative helicase ...   276   1e-78
AEL065C [2441] [Homologous to ScYJR035W (RAD26) - SH] (511520..5...   269   2e-76
Kwal_34.16082                                                         241   2e-68
CAGL0C01683g 178695..182042 highly similar to sp|P38144 Saccharo...   239   8e-66
Scas_652.17                                                           237   3e-65
YOR304W (ISW2) [5088] chr15 (884510..887872) Protein required fo...   233   9e-64
CAGL0I09614g 917707..920826 highly similar to tr|Q08773 Saccharo...   229   1e-62
Kwal_14.1600                                                          229   2e-62
YER164W (CHD1) [1592] chr5 (505387..509793) Protein involved in ...   230   2e-62
CAGL0M04807g complement(514847..520039) similar to sp|P22082 Sac...   230   3e-62
KLLA0F24838g complement(2309842..2313030) similar to sgd|S000583...   227   8e-62
KLLA0E23804g 2108059..2113680 similar to sp|P32333 Saccharomyces...   228   1e-61
Kwal_26.9164                                                          226   5e-61
Kwal_56.23442                                                         226   6e-61
Scas_662.7                                                            225   8e-61
Kwal_23.4777                                                          225   9e-61
KLLA0F04521g complement(435649..439683) similar to sp|P32597 Sac...   225   1e-60
Scas_597.8                                                            224   1e-60
YOR290C (SNF2) [5074] chr15 complement(855144..860255) Component...   224   2e-60
Kwal_34.15925                                                         223   2e-60
CAGL0L11770g 1254125..1258555 highly similar to sp|P32657 Saccha...   223   3e-60
AER375C [2876] [Homologous to ScYIL126W (STH1) - SH] (1332505..1...   223   4e-60
AFR562C [3754] [Homologous to ScYOR290C (SNF2) - SH] (1439983..1...   223   4e-60
Scas_665.17                                                           221   9e-60
AFL040W [3153] [Homologous to ScYBR245C (ISW1) - SH] complement(...   220   2e-59
KLLA0F06710g 645650..648940 similar to sp|P38144 Saccharomyces c...   219   4e-59
Scas_576.6                                                            219   7e-59
KLLA0C17578g 1547890..1552467 similar to sp|P32657 Saccharomyces...   219   1e-58
Scas_594.7                                                            218   2e-58
KLLA0B08327g 742205..746809 similar to sp|P22082 Saccharomyces c...   218   2e-58
CAGL0H05533g 538045..543759 highly similar to sp|P32333 Saccharo...   218   3e-58
YBR245C (ISW1) [424] chr2 complement(708107..711496) Putative AT...   216   5e-58
AEL256C [2250] [Homologous to ScYPL082C (MOT1) - SH] (156109..16...   214   5e-57
YIL126W (STH1) [2550] chr9 (117992..122071) Component of abundan...   213   9e-57
AFR537W [3729] [Homologous to ScYOR304W (ISW2) - SH] complement(...   210   3e-56
CAGL0G08756g complement(829778..833842) highly similar to sp|P32...   210   7e-56
Scas_664.9                                                            209   2e-55
CAGL0J02662g 261909..264443 similar to sp|P43610 Saccharomyces c...   206   2e-55
AGR123C [4434] [Homologous to ScYER164W (CHD1) - SH] (980963..98...   208   3e-55
YPL082C (MOT1) [5362] chr16 complement(398475..404078) Transcrip...   207   5e-55
KLLA0E04048g 375999..378479 similar to sp|P43610 Saccharomyces c...   203   1e-54
YAL019W (FUN30) [49] chr1 (114922..118317) Member of the Snf2p f...   204   5e-54
ACR286C [1333] [Homologous to ScYAL019W (FUN30) - SH] (877337..8...   199   1e-52
KLLA0F07513g 707516..710662 similar to sp|P31380 Saccharomyces c...   199   1e-52
Kwal_26.7123                                                          198   4e-52
Kwal_47.18077                                                         195   1e-51
ADL098C [1643] [Homologous to ScYFR038W (MEI4) - SH] (508448..51...   194   1e-51
Scas_548.4                                                            195   3e-51
CAGL0H06193g 604422..607802 similar to sp|P31380 Saccharomyces c...   191   6e-50
ADR309W [2050] [Homologous to ScYDR334W (SWR1) - SH] complement(...   132   3e-31
Scas_646.3*                                                           132   3e-31
Kwal_55.20143                                                         132   4e-31
YDR334W (SWR1) [1163] chr4 (1135923..1140467) Member of the Snf2...   130   2e-30
CAGL0M01188g complement(132330..136682) similar to sp|Q05471 Sac...   129   4e-30
KLLA0F21758g complement(2023805..2028523) similar to sp|Q05471 S...   126   2e-29
Scas_669.20                                                           120   2e-27
Kwal_27.11388                                                         117   1e-26
YGL150C (INO80) [1838] chr7 complement(221107..225576) Member of...   115   4e-26
YFR038W (YFR038W) [1720] chr6 (229367..231928) Member of the Snf...   115   5e-26
Sklu_1582.2 , Contig c1582 197-1048                                   108   5e-26
Scas_520.5                                                            114   8e-26
CAGL0E05038g 488549..493003 similar to sp|P53115 Saccharomyces c...   114   2e-25
KLLA0E08965g complement(797861..802330) similar to sp|P53115 Sac...   114   2e-25
AGR379W [4690] [Homologous to ScYGL150C (INO80) - SH] complement...   113   2e-25
AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH] complement(...    93   4e-19
AAR147W [335] [Homologous to ScYOR191W (RIS1) - SH] complement(6...    90   5e-18
KLLA0F17479g complement(1601287..1604631) similar to sp|P32849 S...    88   2e-17
ADL345C [1395] [Homologous to ScYBR114W (RAD16) - SH] (100332..1...    84   2e-16
Kwal_14.1868                                                           85   2e-16
CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces c...    84   3e-16
Kwal_47.17771                                                          84   4e-16
Kwal_23.3660                                                           83   5e-16
CAGL0K07766g 770935..773427 highly similar to sp|P31244 Saccharo...    83   6e-16
KLLA0B09240g complement(810178..812580) similar to sp|P31244 Sac...    82   8e-16
YBR114W (RAD16) [303] chr2 (467204..469576) Nucleotide excision ...    80   3e-15
KLLA0C05368g 481598..486415 some similarities with sgd|S0005717 ...    80   5e-15
YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded DNA...    79   8e-15
Scas_721.100                                                           79   1e-14
Scas_591.10                                                            78   2e-14
Scas_674.12d                                                           78   2e-14
YOR191W (RIS1) [4987] chr15 (692475..697334) Protein involved in...    77   4e-14
CAGL0G09493g complement(902228..906454) similar to tr|Q08562 Sac...    77   5e-14
Sklu_2412.7 YLR032W, Contig c2412 15481-18864                          75   2e-13
AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4...    61   4e-09
KLLA0F12166g complement(1116715..1121301) weakly similar to sgd|...    59   2e-08
Kwal_14.1287                                                           56   1e-07
YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protei...    54   5e-07
Scas_573.9                                                             51   5e-06
CAGL0B05049g 487186..491598 some similarities with tr|Q06554 Sac...    50   1e-05
Sklu_2234.2 YOR191W, Contig c2234 6350-9366 reverse complement         46   1e-04
Sklu_2432.9 , Contig c2432 20306-24733 reverse complement              44   5e-04
KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces c...    36   0.12 
Scas_720.17                                                            35   0.32 
Kwal_56.24005                                                          34   0.56 
AFL080W [3113] [Homologous to ScYGL078C (DBP3) - SH] complement(...    33   1.0  
KLLA0C15499g complement(1345201..1346715) similar to sp|P20447 S...    33   1.6  
Scas_588.16                                                            32   2.0  
CAGL0H03377g complement(313755..315377) highly similar to sp|P20...    32   2.2  
YJR124C (YJR124C) [3016] chr10 complement(652807..654153) Member...    32   2.5  
KLLA0F23716g join(complement(2216857..2218129), some similaritie...    32   2.8  
YGL234W (ADE5,7) [1764] chr7 (56481..58889) Phosphoribosylamine-...    32   2.9  
KLLA0D08932g 751943..752779 similar to sp|P09064 Saccharomyces c...    31   3.3  
YGL078C (DBP3) [1904] chr7 complement(360289..361860) ATP-depend...    31   4.9  
KLLA0E04763g complement(429714..431624) similar to sgd|S0006383 ...    31   5.8  

>AEL297W [2208] [Homologous to ScYGL163C (RAD54) - SH]
           complement(83368..86055) [2688 bp, 895 aa]
          Length = 895

 Score = 1791 bits (4638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 867/879 (98%), Positives = 867/879 (98%)

Query: 1   MAKRKLPDRPPNGSGAGERPSVRPRRLDSGRAYSTLTQPFRVPLNSERTRHGERYGVRAT 60
           MAKRKLPDRPPNGSGAGERPSVRPRRLDSGRAYSTLTQPFRVPLNSERTRHGERYGVRAT
Sbjct: 1   MAKRKLPDRPPNGSGAGERPSVRPRRLDSGRAYSTLTQPFRVPLNSERTRHGERYGVRAT 60

Query: 61  RRAVTTYAEEGGARSEENDVGGKRIDALSEQRVSKDAQRLAGIERTLRRSFSVPIKGYVP 120
           RRAVTTYAEEGGARSEENDVGGKRIDALSEQRVSKDAQRLAGIERTLRRSFSVPIKGYVP
Sbjct: 61  RRAVTTYAEEGGARSEENDVGGKRIDALSEQRVSKDAQRLAGIERTLRRSFSVPIKGYVP 120

Query: 121 RHNIPLALGMKMRVVAPPRPLHDPTEEFAIVLYDPTVDGEIPDETPREEPAQKENDGGNE 180
           RHNIPLALGMKMRVVAPPRPLHDPTEEFAIVLYDPTVDGEIPDETPREEPAQKENDGGNE
Sbjct: 121 RHNIPLALGMKMRVVAPPRPLHDPTEEFAIVLYDPTVDGEIPDETPREEPAQKENDGGNE 180

Query: 181 EQARPTRRTATHPEKLSNGLRNKTLRELLGTVTETPKFPSVPVVIDPRLARILRPHQVEG 240
           EQARPTRRTATHPEKLSNGLRNKTLRELLGTVTETPKFPSVPVVIDPRLARILRPHQVEG
Sbjct: 181 EQARPTRRTATHPEKLSNGLRNKTLRELLGTVTETPKFPSVPVVIDPRLARILRPHQVEG 240

Query: 241 VRFLYRCVTGLAMKDFLDTQAVLAAGEVQDDGTGKDPGSKDSEPIVVEVLEEXXXXXXXX 300
           VRFLYRCVTGLAMKDFLDTQAVLAAGEVQDDGTGKDPGSKDSEPIVVEVLEE        
Sbjct: 241 VRFLYRCVTGLAMKDFLDTQAVLAAGEVQDDGTGKDPGSKDSEPIVVEVLEETPTPTPTP 300

Query: 301 XXXXSPEILDANAAMTRESNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEK 360
               SPEILDANAAMTRESNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEK
Sbjct: 301 TPTPSPEILDANAAMTRESNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEK 360

Query: 361 CIIVCPSSLVNNWANEIVKWLGPDALSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVK 420
           CIIVCPSSLVNNWANEIVKWLGPDALSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVK
Sbjct: 361 CIIVCPSSLVNNWANEIVKWLGPDALSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVK 420

Query: 421 PVLIISYETLRRNVENLKGCKVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPI 480
           PVLIISYETLRRNVENLKGCKVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPI
Sbjct: 421 PVLIISYETLRRNVENLKGCKVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPI 480

Query: 481 QNDLSEYFALLNFSNPGLLGTRAQFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIV 540
           QNDLSEYFALLNFSNPGLLGTRAQFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIV
Sbjct: 481 QNDLSEYFALLNFSNPGLLGTRAQFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIV 540

Query: 541 SKFIIRRTNDILSKYLPCKYEHILFVNLSPMQKAIYEHFVRSREVAKLMKGTGSQPLKAI 600
           SKFIIRRTNDILSKYLPCKYEHILFVNLSPMQKAIYEHFVRSREVAKLMKGTGSQPLKAI
Sbjct: 541 SKFIIRRTNDILSKYLPCKYEHILFVNLSPMQKAIYEHFVRSREVAKLMKGTGSQPLKAI 600

Query: 601 GLLKKLCNHPDLLDLPDEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILER 660
           GLLKKLCNHPDLLDLPDEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILER
Sbjct: 601 GLLKKLCNHPDLLDLPDEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILER 660

Query: 661 FLFKIKHESNDKIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPS 720
           FLFKIKHESNDKIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPS
Sbjct: 661 FLFKIKHESNDKIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPS 720

Query: 721 GEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFIT 780
           GEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFIT
Sbjct: 721 GEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFIT 780

Query: 781 TGSIEEKISQRPSMKMSLSSCVVEEKEDVERLFSSENLRPLFQFDSNTHMRYPPTYHCKR 840
           TGSIEEKISQRPSMKMSLSSCVVEEKEDVERLFSSENLRPLFQFDSNTHMRYPPTYHCKR
Sbjct: 781 TGSIEEKISQRPSMKMSLSSCVVEEKEDVERLFSSENLRPLFQFDSNTHMRYPPTYHCKR 840

Query: 841 CRDGKQMIKAPAMLYGDATTWNHLNHDALLKTNDHLLRN 879
           CRDGKQMIKAPAMLYGDATTWNHLNHDALLKTNDHLLRN
Sbjct: 841 CRDGKQMIKAPAMLYGDATTWNHLNHDALLKTNDHLLRN 879

>KLLA0A03069g complement(271516..274203) similar to sp|P32863
           Saccharomyces cerevisiae YGL163c RAD54 DNA-dependent
           ATPase of the SNF2P family, start by similarity
          Length = 895

 Score = 1241 bits (3212), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 608/901 (67%), Positives = 724/901 (80%), Gaps = 44/901 (4%)

Query: 1   MAKRKLPDRPPNGSGAGERPSVRPRRLDSGRAYSTLTQPFRVPLNSERTRHGERYGVRAT 60
           MA+R+LPDRPPNG GAG RP++RPRRLD+ +A  TLT+PF+VP    +T H +RYGVR++
Sbjct: 1   MARRRLPDRPPNGIGAGARPNLRPRRLDTNQALETLTKPFKVPFKVNKTDHAKRYGVRSS 60

Query: 61  RRAVTTYAEEGGARSEENDVGGKRIDALSEQRVSKDAQRLAGIERTLRRSFSVPIKGYVP 120
           RR+ TTYA      S ++D+  KR DALS  R++ +  RL  I  TLRRSF+VPIKGYVP
Sbjct: 61  RRSQTTYANMDS--SLDSDLHVKRKDALSLSRLNAEPSRLDTIYSTLRRSFTVPIKGYVP 118

Query: 121 RHNIPLALGMKMRVVAPPRPLHDPTEEFAIVLYDPTVDGEIPD-----ETPRE-----EP 170
           RHNIP+ALG K +VV PPRPLHDPT+E AIVLYDPTVDG+IP+     E+ R+     + 
Sbjct: 119 RHNIPMALGTKAKVVIPPRPLHDPTDELAIVLYDPTVDGDIPEQHEDLESFRQNAVDTKK 178

Query: 171 AQKENDGGNEEQ----ARPTRRTATH-PEKLSNGLRNKTLRELLGTVTE--TPKFPSVPV 223
           +QK  D  +++Q    + P    + H P+ LSNG++NKTL+ELLG+  +  + KFP+VPV
Sbjct: 179 SQKGKDSESQDQKAKESSPNSAPSIHHPKMLSNGVKNKTLKELLGSSEDNTSKKFPNVPV 238

Query: 224 VIDPRLARILRPHQVEGVRFLYRCVTGLAMKDFLDTQAVL--AAGEVQDDGTGKDP---G 278
           VIDP+LA+ILRPHQVEGVRFLYRCVTGL MKDFLD + VL  ++  ++   T  D    G
Sbjct: 239 VIDPKLAKILRPHQVEGVRFLYRCVTGLVMKDFLDAKTVLDSSSQSMEKADTQADSNITG 298

Query: 279 SKDSEPIVVEVLEEXXXXXXXXXXXXSPEILDANAAMTRESNRGAYGCIMADEMGLGKTL 338
           SK   P+  +V                  + D         NRGAYGCIMADEMGLGKTL
Sbjct: 299 SK--SPVETDV----------------SSLKDVIKINENSRNRGAYGCIMADEMGLGKTL 340

Query: 339 QCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDALSPLAIDGRKSSL 398
           QC+ALMWT+L+QG QGR +I+KCIIVCPSSLVNNWANEI KWLGP +LS LAIDG+KSSL
Sbjct: 341 QCLALMWTMLKQGPQGRRSIDKCIIVCPSSLVNNWANEIDKWLGPGSLSSLAIDGKKSSL 400

Query: 399 SNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCKVGLMLADEGHRLKNGDS 458
           +NG+VA SV  WA AQGRN+VKPVLIISY+TLRRNVE LK C+VGLMLADEGHRLKN DS
Sbjct: 401 NNGNVADSVSHWASAQGRNIVKPVLIISYDTLRRNVEQLKNCEVGLMLADEGHRLKNADS 460

Query: 459 LTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFRKNFEIPILRGRD 518
           LTFT+LDSI CPRRVILSGTPIQNDLSEYFALLNFSNPGLLG+R  FRKNFE+PIL+ RD
Sbjct: 461 LTFTALDSIRCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGSRNDFRKNFELPILQSRD 520

Query: 519 ADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHILFVNLSPMQKAIYEH 578
           + ATD+E+  G+ +L +LS IVSKFIIRRTN+IL+KYLPCKYEH++F+NL+P Q+++Y+H
Sbjct: 521 SLATDEEVTLGKDRLRQLSNIVSKFIIRRTNNILAKYLPCKYEHVIFINLTPFQQSLYQH 580

Query: 579 FVRSREVAKLMKGTGSQPLKAIGLLKKLCNHPDLLDLPDEIAGSTNLIPDDYQSAMTHNS 638
           F+ SR V K++KG  +QPLKAIGLLKKLCNHPDLL+L ++I GS  LIPDDYQS++  +S
Sbjct: 581 FIESRAVKKIVKGDSNQPLKAIGLLKKLCNHPDLLELSEDIPGSEELIPDDYQSSV--DS 638

Query: 639 RGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLISNYTQTLDLIEKMCRYNHYGVL 698
           R  R+   +QT  SSKF++L RFL+KIK ESNDKIVLISNYTQTLDLIEKMC  NHYGVL
Sbjct: 639 RTSRNRSVIQTAFSSKFSVLARFLYKIKTESNDKIVLISNYTQTLDLIEKMCFSNHYGVL 698

Query: 699 RLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQ 758
           RLDGTM INKRQKLVD+FNDP G+EFIFLLSSKAGGCGINLIGANRLIL+DPDWNPAADQ
Sbjct: 699 RLDGTMNINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILLDPDWNPAADQ 758

Query: 759 QALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVEEKEDVERLFSSENL 818
           QALARVWRDGQKKDCFIYRFI+TG+IEEKI QR SMKMSLSSCVV+EKEDVERLFSS+NL
Sbjct: 759 QALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVDEKEDVERLFSSDNL 818

Query: 819 RPLFQFDSNTHMRYPPTYHCKRCRDGKQMIKAPAMLYGDATTWNHLNHDALLKTNDHLLR 878
           + LF+ D+ T      TY+CKRC++GKQ++KAP MLYGDAT+WNHLNHDAL KTNDHLL+
Sbjct: 819 KQLFKLDTKTICDTHETYNCKRCKNGKQILKAPVMLYGDATSWNHLNHDALAKTNDHLLK 878

Query: 879 N 879
           N
Sbjct: 879 N 879

>CAGL0I04224g complement(369858..372686) highly similar to sp|P32863
           Saccharomyces cerevisiae YGL163c RAD54, start by
           similarity
          Length = 942

 Score = 1143 bits (2956), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 586/935 (62%), Positives = 699/935 (74%), Gaps = 65/935 (6%)

Query: 1   MAKRKLPDRPPNGSGAGERPSVRPRRLDSGRAYSTLTQPFRVPLNSERTR----HGERYG 56
           MA+R+LPDRPPNG GAGERP + PR ++   + S LT+PF+VP+ S+R++    + +   
Sbjct: 1   MARRRLPDRPPNGIGAGERPRLVPRPINVDESISKLTKPFKVPVKSQRSQTVPANSDLSR 60

Query: 57  VRATRRAVTTYAEEGGARSEENDVGGK---------------RIDALSEQRVSKDAQRLA 101
            R  R+   T +  G     +++V GK               R+DALS +R+ +D  RL 
Sbjct: 61  QRQLRQRSQTVSYAGLDVDSKDEVDGKENIYDELGERVIKKRRVDALSARRLMEDPTRLD 120

Query: 102 GIERTLRRSFSVPIKGYVPRHNIPLALGMKMRVVAPPRPLHDPTEEFAIVLYDPTVDGE- 160
            IE TL++SF VPIKGYV RH++PL LG K++V+  PRPLHDPT+EFAIVLYDP+VDGE 
Sbjct: 121 TIEVTLKKSFHVPIKGYVQRHSLPLTLGTKVKVIPEPRPLHDPTDEFAIVLYDPSVDGEM 180

Query: 161 -IPDETPREEPAQKENDGGNEEQARPTRRTATHPEKLSNGLRNKTLRELLGTVTETP--- 216
            I D+T   +  Q   D  N ++A   +    HP+ LSNG++NKTL+ELLG     P   
Sbjct: 181 IIQDDTETVQNVQSSEDQ-NAQEAEAEKSKYKHPKILSNGVKNKTLQELLGNSPFNPTES 239

Query: 217 ---KFPSVPVVIDPRLARILRPHQVEGVRFLYRCVTGLAMKDFLDTQAVLAAGEVQD-DG 272
              KF +VPVVIDP+LA+ILRPHQVEGV+FLYRCVTGL MKDFLD Q    +  +   + 
Sbjct: 240 MKKKFANVPVVIDPKLAKILRPHQVEGVKFLYRCVTGLVMKDFLDQQLASQSSNINFLEC 299

Query: 273 TGKDPGSKDSEPI-----------------------VVEVLEEXXXXXXXXXXXXSPEIL 309
           +  D  SK+  PI                          V  +              + L
Sbjct: 300 SDDDVCSKEVSPIDGGGAHDNSEANNDEAGNAIQNAKKNVKSKKQKKTITKKQQSENDFL 359

Query: 310 DANAAMTRESNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSL 369
           +A    ++ +NRGAYGCIMADEMGLGKTLQCIALMWTLLRQG QG+  I KCIIVCPSSL
Sbjct: 360 EA-LKKSQSNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSL 418

Query: 370 VNNWANEIVKWLGPDALSPLAIDGRKSSLSNG--SVAQSVRQWAIAQGRNVVKPVLIISY 427
           VNNWANE+VKWLGP+ LSPLA+DG+KSSL++G  SVA++++ WA AQGRN+VKPVLIISY
Sbjct: 419 VNNWANELVKWLGPNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISY 478

Query: 428 ETLRRNVENLKGCKVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEY 487
           +TLRRNV+ L+  +VGL+LADEGHRLKNGDSLTFT+LDSINCPRRVILSGTPIQNDLSEY
Sbjct: 479 DTLRRNVKQLQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEY 538

Query: 488 FALLNFSNPGLLGTRAQFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRR 547
           FALLNFSNPGLLGTR +FR+NFEIPILR RDADATD ++ +GE KL  LS IVSKFIIRR
Sbjct: 539 FALLNFSNPGLLGTRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRR 598

Query: 548 TNDILSKYLPCKYEHILFVNLSPMQKAIYEHFVRSREVAKLMKGTG-SQPLKAIGLLKKL 606
           TNDILSKYLPCKYEH++FVNL+P QK +Y   ++SR++ K++KG G SQPLKAIG+LKKL
Sbjct: 599 TNDILSKYLPCKYEHVIFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGSQPLKAIGVLKKL 658

Query: 607 CNHPDLLDLPDEIAGSTNL-IPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKI 665
           CNHPDL+ L +E+    +L IPDDY S  T  SR      +VQT  S KFAILERFL KI
Sbjct: 659 CNHPDLIKLDEELDNYNDLDIPDDY-SIPTGKSR------DVQTQFSGKFAILERFLHKI 711

Query: 666 KHESNDKIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFI 725
           K ES+DKIVLISNYTQTLDLIE+MCR  HY  +RLDGTM+INKRQKLVD+FNDP G+EFI
Sbjct: 712 KTESDDKIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFI 771

Query: 726 FLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIE 785
           FLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFI+TG+IE
Sbjct: 772 FLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIE 831

Query: 786 EKISQRPSMKMSLSSCVVEEKEDVERLFSSENLRPLFQFDSNTHMRYPPTYHCKRC-RDG 844
           EKI QR SMKMSLSSCVV+ KEDVERLFS +NLR LFQF+  T      T+ CKRC + G
Sbjct: 832 EKIYQRQSMKMSLSSCVVDAKEDVERLFSVDNLRQLFQFNDKTICDTHETFQCKRCNKHG 891

Query: 845 KQMIKAPAMLYGDATTWNHLNHDALLKTNDHLLRN 879
           +Q+++A AMLYGDATTWNHLNH AL KTNDHLL+N
Sbjct: 892 QQIMRAAAMLYGDATTWNHLNHKALEKTNDHLLKN 926

>Scas_668.18
          Length = 875

 Score = 1137 bits (2942), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 577/914 (63%), Positives = 683/914 (74%), Gaps = 90/914 (9%)

Query: 1   MAKRKLPDRPPNGSGAGERPSVRPRRLDSGRAYSTLTQPFRVP--------LNSERTRHG 52
           MA+RKLPDRPPNG G G+RP + PR ++   + STL++PF+VP        L+SE  +  
Sbjct: 1   MARRKLPDRPPNGIGFGDRPRLVPRPINVQNSISTLSKPFKVPYKTAKPRALSSEHEKEV 60

Query: 53  ERYGVRATRRAVTTYAEEG------GARSEENDVG-----GKRIDALSEQRVSKDAQRLA 101
            +   R  R+   T +  G       A  +EN +       +R DALS  R++ D  RL 
Sbjct: 61  VQVNGRILRKRSHTVSYSGLDISSAAADVDENSLTFSQSTKRRKDALSASRLANDPTRLH 120

Query: 102 GIERTLRRSFSVPIKGYVPRHNIPLALGMKMRVVAPPRPLHDPTEEFAIVLYDPTVDGEI 161
            IE TL+RSF+VPIKGY+ RH++PL LG K +++  PRPLHDPT+EFAIVLYDP+VDG++
Sbjct: 121 SIEFTLKRSFTVPIKGYIQRHSLPLTLGTKKKIIMEPRPLHDPTDEFAIVLYDPSVDGDM 180

Query: 162 --------PDETPREEPAQKENDGGNEEQARPTRRTATHPEKLSNGLRNKTLRELLGTVT 213
                        ++   +K  D  +EE    +++ A HP+ ++NG+RNK+L+ELLG+  
Sbjct: 181 IMHDNSQDVRNDKKDSTKEKGTDSKDEETKTGSKKFA-HPKLMTNGVRNKSLKELLGSSE 239

Query: 214 E---TPKFPSVPVVIDPRLARILRPHQVEGVRFLYRCVTGLAMKDFLDTQAVLAAGEVQD 270
           E     KFP+VPVVIDP+L +ILRPHQVEGV+FLYRCVTGL MKDFLD +AV        
Sbjct: 240 EDEAKKKFPNVPVVIDPKLTKILRPHQVEGVKFLYRCVTGLVMKDFLDAEAV-------- 291

Query: 271 DGTGKDPGSKDSEPIVVEVLEEXXXXXXXXXXXXSPEILDANAAMTRESNRGAYGCIMAD 330
                                                  +     T ++NRGAYGCIMAD
Sbjct: 292 ---------------------------------------NTGIVKTEQNNRGAYGCIMAD 312

Query: 331 EMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDALSPLA 390
           EMGLGKTLQCIALMWTLLRQG QG+  I+KCIIVCPSSLVNNWANE+VKWLGP  LSPLA
Sbjct: 313 EMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPGTLSPLA 372

Query: 391 IDGRKSSLSNG--SVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCKVGLMLAD 448
           +DG+KSSL++G  +VA++V  WA A GRN+VKPVLIISYETLRRNV+ L+ C VGLMLAD
Sbjct: 373 VDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQLRNCDVGLMLAD 432

Query: 449 EGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFRKN 508
           EGHRLKNGDSLTFT+LDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTR++FRKN
Sbjct: 433 EGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRKN 492

Query: 509 FEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHILFVNL 568
           FE+PILR RDAD+TD+EI  GE +L +LS IVSKFIIRRTNDILSKYLPCKYEH++FVNL
Sbjct: 493 FELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTNDILSKYLPCKYEHVIFVNL 552

Query: 569 SPMQKAIYEHFVRSREVAKLMKGTG-SQPLKAIGLLKKLCNHPDLLDLPDEIAGSTNL-I 626
            P QK +Y   ++SR+V K++KG G +QPLKAIG+LKKLCNHP+L++L +EI    +L I
Sbjct: 553 KPFQKDVYHRLLKSRDVNKMVKGVGGTQPLKAIGVLKKLCNHPNLINLDEEIDDFDDLEI 612

Query: 627 PDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLISNYTQTLDLI 686
           PD+Y      N +G +S  +VQ   S KFAILERFL KIK ES+DKIVLISNYTQTLDLI
Sbjct: 613 PDEY------NMQGSKSR-DVQPQFSGKFAILERFLHKIKTESDDKIVLISNYTQTLDLI 665

Query: 687 EKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGINLIGANRLI 746
           EKMCR  HY  +RLDGTMTINKRQKLVD+FNDP G+EFIFLLSSKAGGCGINLIGANRLI
Sbjct: 666 EKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLI 725

Query: 747 LMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVEEK 806
           LMDPDWNPAADQQALARVWRDGQKKDCFIYRFI+TGSIEEKI QR SMKMSLSSCVV+ K
Sbjct: 726 LMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLSSCVVDAK 785

Query: 807 EDVERLFSSENLRPLFQFDSNTHMRYPPTYHCKRCR-DGKQMIKAPAMLYGDATTWNHLN 865
           EDVERLFSS+NLR LFQ++  T      TYHCKRC   GKQ +++ AMLYGD TTWNHLN
Sbjct: 786 EDVERLFSSDNLRQLFQYNDKTICETHETYHCKRCNAAGKQSVRSTAMLYGDPTTWNHLN 845

Query: 866 HDALLKTNDHLLRN 879
           H AL KTNDHLL+N
Sbjct: 846 HAALEKTNDHLLQN 859

>YGL163C (RAD54) [1826] chr7 complement(193711..196407)
           DNA-dependent ATPase of the Snf2p family, required for
           mitotic recombination and DNA repair of X-ray damage
           [2697 bp, 898 aa]
          Length = 898

 Score = 1137 bits (2941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 586/921 (63%), Positives = 695/921 (75%), Gaps = 81/921 (8%)

Query: 1   MAKRKLPDRPPNGSGAGERPSVRPRRLDSGRAYSTLTQPFRVPLNSER---------TRH 51
           MA+R+LPDRPPNG GAGERP + PR ++   + + LT+PFRVP  +           T  
Sbjct: 1   MARRRLPDRPPNGIGAGERPRLVPRPINVQDSVNRLTKPFRVPYKNTHIPPAAGRIATGS 60

Query: 52  GERYGVRATRR--AVTTY------AEEGGARSEE---NDVGGKRIDALSEQRVSKDAQRL 100
               G R+ R+  A   Y      A+E    S++   + +  +R DALS QR++KD  RL
Sbjct: 61  DNIVGGRSLRKRSATVCYSGLDINADEAEYNSQDISFSQLTKRRKDALSAQRLAKDPTRL 120

Query: 101 AGIERTLRRSFSVPIKGYVPRHNIPLALGMKMRVVAPPRPLHDPTEEFAIVLYDPTVDGE 160
           + I+ TLRRSF+VPIKGYV RH++PL LGMK ++   PRPLHDPT+EFAIVLYDP+VDGE
Sbjct: 121 SHIQYTLRRSFTVPIKGYVQRHSLPLTLGMKKKITPEPRPLHDPTDEFAIVLYDPSVDGE 180

Query: 161 I----------PDETPREEPAQKENDGGNEE----QARPTRRTATHPEKLSNGLRNKTLR 206
           +           +E+ +   + +E D  N+E    + RPT+R   HP  ++NG+RNK LR
Sbjct: 181 MIVHDTSMDNKEEESKKMIKSTQEKDNINKEKNSQEERPTQRIGRHPALMTNGVRNKPLR 240

Query: 207 ELLG----TVTETPKFPSVPVVIDPRLARILRPHQVEGVRFLYRCVTGLAMKDFLDTQAV 262
           ELLG    +     KF SVPVVIDP+LA+ILRPHQVEGVRFLYRCVTGL MKD+L+ +A 
Sbjct: 241 ELLGDSENSAENKKKFASVPVVIDPKLAKILRPHQVEGVRFLYRCVTGLVMKDYLEAEAF 300

Query: 263 LAAGEVQDDGTGKDPGSKDSEPIVVEVLEEXXXXXXXXXXXXSPEILDANAAMTRESNRG 322
             + E        DP   D + +                           +  T ++NRG
Sbjct: 301 NTSSE--------DPLKSDEKALT-------------------------ESQKTEQNNRG 327

Query: 323 AYGCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLG 382
           AYGCIMADEMGLGKTLQCIALMWTLLRQG QG+  I+KCIIVCPSSLVNNWANE++KWLG
Sbjct: 328 AYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLG 387

Query: 383 PDALSPLAIDGRKSSLSNG--SVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGC 440
           P+ L+PLA+DG+KSS+  G  +V+Q++  WA AQGRN+VKPVLIISYETLRRNV+ LK C
Sbjct: 388 PNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLKNC 447

Query: 441 KVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLG 500
            VGLMLADEGHRLKNGDSLTFT+LDSI+CPRRVILSGTPIQNDLSEYFALL+FSNPGLLG
Sbjct: 448 NVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLG 507

Query: 501 TRAQFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKY 560
           +RA+FRKNFE PILRGRDADATDKEI  GE +L +LS IVSKFIIRRTNDIL+KYLPCKY
Sbjct: 508 SRAEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYLPCKY 567

Query: 561 EHILFVNLSPMQKAIYEHFVRSREVAKLMKGTG-SQPLKAIGLLKKLCNHPDLLDLPDEI 619
           EH++FVNL P+Q  +Y   ++SREV K++KG G SQPL+AIG+LKKLCNHP+LL+  DE 
Sbjct: 568 EHVIFVNLKPLQNELYNKLIKSREVKKVVKGVGGSQPLRAIGILKKLCNHPNLLNFEDEF 627

Query: 620 AGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLISNY 679
               +L     +    +N  G ++  +VQT +S+KF+ILERFL KIK ES+DKIVLISNY
Sbjct: 628 DDEDDL-----ELPDDYNMPGSKAR-DVQTKYSAKFSILERFLHKIKTESDDKIVLISNY 681

Query: 680 TQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGINL 739
           TQTLDLIEKMCRY HY  +RLDGTM+INKRQKLVD+FNDP G+EFIFLLSSKAGGCGINL
Sbjct: 682 TQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINL 741

Query: 740 IGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLS 799
           IGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFI+TG+IEEKI QR SMKMSLS
Sbjct: 742 IGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLS 801

Query: 800 SCVVEEKEDVERLFSSENLRPLFQFDSNTHMRYPPTYHCKRCR-DGKQMIKAPAMLYGDA 858
           SCVV+ KEDVERLFSS+NLR LFQ + NT      TYHCKRC   GKQ+ +APAMLYGDA
Sbjct: 802 SCVVDAKEDVERLFSSDNLRQLFQKNENTICETHETYHCKRCNAQGKQLKRAPAMLYGDA 861

Query: 859 TTWNHLNHDALLKTNDHLLRN 879
           TTWNHLNHDAL KTNDHLL+N
Sbjct: 862 TTWNHLNHDALEKTNDHLLKN 882

>Kwal_14.1537
          Length = 842

 Score = 1053 bits (2723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/846 (65%), Positives = 634/846 (74%), Gaps = 39/846 (4%)

Query: 1   MAKRKLPDRPPNGSGAGERPSVRPRRLDSGRAYSTLTQPFRVPLNS-----ERTRHGERY 55
           MA+RKLPDRPPNG GAG+RPS+RPR+LDS  A++TLT+PF+VPL                
Sbjct: 1   MARRKLPDRPPNGIGAGQRPSLRPRQLDSLAAHATLTRPFKVPLRKLEPNCAANPANAAI 60

Query: 56  GVRATRRAVTTYA------EEGGARSEENDVGGKRIDALSEQRVSKDAQRLAGIERTLRR 109
           G R TR     Y       E   + SE      KR DALS +R+S+D  RL  I+  LRR
Sbjct: 61  GKRTTRSKTHVYELTETAPEFEHSESESGLKRAKRPDALSARRLSRDPDRLRKIDSLLRR 120

Query: 110 SFSVPIKGYVPRHNIPLALGMKMRVVAPPRPLHDPTEEFAIVLYDPTVDGEIPDE--TPR 167
           SF+VPIKGYVPRHNIPL+LG K ++V  PRPLHDPTEEFAIVLYDP+VDG  P+     R
Sbjct: 121 SFTVPIKGYVPRHNIPLSLGTKPKIVLGPRPLHDPTEEFAIVLYDPSVDGPTPELLIQMR 180

Query: 168 EEPAQKENDGGNEEQARPTRRT------------ATHPEKLSNGLRNKTLRELLGTVTET 215
            +  +  +     +    TR T             +HP+KLSNGL NKTLRELLG     
Sbjct: 181 SQLPKSSSASALSKPRGSTRATQLSPTPPPPSPHPSHPKKLSNGLPNKTLRELLGDRQVD 240

Query: 216 PKFPSVPVVIDPRLARILRPHQVEGVRFLYRCVTGLAMKDFLDTQAVLAAGEVQDDGTGK 275
            KF SVPVVIDP L +ILRPHQVEGVRFLYRCVTGL MKD+LD QA+L   +       +
Sbjct: 241 EKFASVPVVIDPLLVKILRPHQVEGVRFLYRCVTGLVMKDYLDQQALLQNADAATTSKEQ 300

Query: 276 DPGSKDSEPIVVEVLEEXXXXXXXXXXXXSP---EILDANAAMTRES-----NRGAYGCI 327
            P +        E+L                   + LD  A     S     NRGAYGCI
Sbjct: 301 TPPADHLPSPPAELLPSPPADPAHTLTSDEKLPNQELDTPAPTDESSSEVSQNRGAYGCI 360

Query: 328 MADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDALS 387
           MADEMGLGKTLQCIAL+WTLLRQG QG+PTI+KCIIVCPSSLVNNWANEIVKWLG   L+
Sbjct: 361 MADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTLA 420

Query: 388 PLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCKVGLMLA 447
            L IDG+KSSL+NG+VAQ+VR WA+A+GR+VVKPVLIISYETLRRNVE+L  C++GL+LA
Sbjct: 421 SLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEHLNNCEIGLLLA 480

Query: 448 DEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFRK 507
           DEGHRLKN +S TFT+LDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTR++FR+
Sbjct: 481 DEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRR 540

Query: 508 NFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHILFVN 567
           NFE PIL  RDADATD EIA G  KL  LS IVSKFIIRRTNDILSKYLPCKYEH+LFVN
Sbjct: 541 NFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKYLPCKYEHVLFVN 600

Query: 568 LSPMQKAIYEHFVRSREVAKLMKG--TGSQPLKAIGLLKKLCNHPDLLDLPDEIAGSTNL 625
           L P Q+++YE  ++ R+V   +K   T SQPLK IG LKKLCNHPDLL LP+++ GS ++
Sbjct: 601 LKPFQRSVYELMLKCRDVKLAVKDGTTPSQPLKHIGALKKLCNHPDLLQLPEDVEGSEDV 660

Query: 626 IPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLISNYTQTLDL 685
           IP+DY+++ T + RG   H EVQT +S KF+IL RFL KIK ES+DKIV+ISNYTQTLD+
Sbjct: 661 IPEDYRNS-TLSKRG---HAEVQTWYSGKFSILNRFLHKIKTESDDKIVIISNYTQTLDV 716

Query: 686 IEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGINLIGANRL 745
           IE+MCR + Y V+RLDGTMTINKRQKLVD+FND  G+EFIFLLSSKAGGCGINLIGANRL
Sbjct: 717 IERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRL 776

Query: 746 ILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVEE 805
           ILMDPDWNPAADQQALARVWRDGQKKDCFIYRFI TG+IEEKI QR SMKMSLSSCVV+E
Sbjct: 777 ILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSLSSCVVDE 836

Query: 806 KEDVER 811
           KEDVER
Sbjct: 837 KEDVER 842

>Scas_718.40
          Length = 926

 Score =  380 bits (976), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 245/640 (38%), Positives = 335/640 (52%), Gaps = 104/640 (16%)

Query: 221 VPVVIDPRLARILRPHQVEGVRFLYRCVTGLAMKDFLDTQAVLAAGEVQDDGTGKDPGSK 280
           V V++DP L ++LRPHQ EGV+F+Y CV GLA              E  +D TGK     
Sbjct: 247 VDVIVDPLLGKLLRPHQREGVKFMYDCVMGLATN----------HQETDEDNTGK----- 291

Query: 281 DSEPIVVEVLEEXXXXXXXXXXXXSPEILDANAAMTRESNRGAYGCIMADEMGLGKTLQC 340
                                            ++  E +    GC++ADEMGLGKTL  
Sbjct: 292 ---------------------------------SLILEKDSDIGGCLLADEMGLGKTLMT 318

Query: 341 IALMWTLLRQG---------SQGRPT---IEKCIIVCPSSLVNNWANEIVKWLGPDALSP 388
           I L+WTLL+Q            G P      K ++VCP +L+ NW  E  KWL  + +  
Sbjct: 319 ITLIWTLLKQSPSLKNIACSQSGVPLHGLCRKILVVCPVTLIGNWKREFAKWLNLNRIGI 378

Query: 389 LAIDGRKS-SLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCK--VGLM 445
           L +  R +  +   +V   +R     Q       VL+I YE L    E L G +  + L+
Sbjct: 379 LTLSSRNTPEMDKTAVKNFLRVQRTFQ-------VLVIGYEKLLSVSEELHGSRDLIDLL 431

Query: 446 LADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQF 505
           + DEGHRLKNG S     L ++   R+++LSGTPIQNDL+E++ +++F NPG+LG+   F
Sbjct: 432 ICDEGHRLKNGSSKVLNVLKNLEIKRKILLSGTPIQNDLNEFYTIIDFLNPGILGSYPYF 491

Query: 506 RKNFEIPILRGRDADATDKE--IAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHI 563
           +K F  PI RGRD +    E  I  GE +  E+  I  KF +RRTN ILSKYLP K + I
Sbjct: 492 KKRFIAPITRGRDTENRHNEDIIELGEGRSKEMIDITRKFTLRRTNAILSKYLPPKTDII 551

Query: 564 LFVNLSPMQKAIYEHFVRSREVAKLMKGTGSQPLKAIGLLKKLCNHPDLLDLPDEIAGST 623
           LF   +  Q   +   + SR        + +  L  I L KK+CN P             
Sbjct: 552 LFCKPTQSQLLAFNDIL-SRSRIDFANLSFNSSLGLITLFKKICNSP------------- 597

Query: 624 NLIPDD--YQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIK-HESNDKIVLISNYT 680
            LI DD  YQS +  +  G       ++ +S K  IL   L KIK + +N+K+V++SNYT
Sbjct: 598 TLIGDDSYYQSKIRPD--GVIQERYDRSLNSGKLKILMTLLEKIKGNTNNEKVVIVSNYT 655

Query: 681 QTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFN-DPSGEEFIFLLSSKAGGCGINL 739
           QTLD+I+ +         RLDG+    +R  +V+ FN +PS   F FLLS+K+GG G+NL
Sbjct: 656 QTLDIIQNLMNSAQMVSCRLDGSTPAKQRDSIVNTFNRNPS--IFAFLLSAKSGGVGLNL 713

Query: 740 IGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLS 799
           IGA+RLIL D DWNP+ D QA++R+ RDGQKK C+IYR ITTG I+EKI QR  MK SLS
Sbjct: 714 IGASRLILFDNDWNPSIDLQAMSRIHRDGQKKHCYIYRLITTGCIDEKILQRQLMKHSLS 773

Query: 800 SCVVEEKEDV------ERLFSSENLRPLFQF----DSNTH 829
              ++           + LF+ E+L+ LF       SNTH
Sbjct: 774 KKFLDSSYTTGKTGSNDDLFTKEDLKDLFTIMETTKSNTH 813

>YBR073W (RDH54) [263] chr2 (383172..385946) Protein required for
           mitotic diploid-specific recombination and repair and
           for meiosis [2775 bp, 924 aa]
          Length = 924

 Score =  371 bits (952), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 239/638 (37%), Positives = 344/638 (53%), Gaps = 101/638 (15%)

Query: 221 VPVVIDPRLARILRPHQVEGVRFLYRCVTGLAMKDFLDTQAVLAAGEVQDDGTGKDPGSK 280
           V V++DP L + LRPHQ EGV+F+Y C+ GLA                            
Sbjct: 250 VDVIVDPLLGKFLRPHQREGVKFMYDCLMGLA---------------------------- 281

Query: 281 DSEPIVVEVLEEXXXXXXXXXXXXSPEILDANAAMTRESNRGAYGCIMADEMGLGKTLQC 340
              P +                  +P+I     ++  E++    GC++AD+MGLGKTL  
Sbjct: 282 --RPTI-----------------ENPDIDCTTKSLVLENDSDISGCLLADDMGLGKTLMS 322

Query: 341 IALMWTLLRQ---------GSQGRPTIEKC---IIVCPSSLVNNWANEIVKWLGPDALSP 388
           I L+WTL+RQ            G P    C   ++VCP +L+ NW  E  KWL    +  
Sbjct: 323 ITLIWTLIRQTPFASKVSCSQSGIPLTGLCKKILVVCPVTLIGNWKREFGKWLNLSRIGV 382

Query: 389 LAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCK--VGLML 446
           L +  R S   +     +VR +   Q       VLII YE L    E L+  K  + +++
Sbjct: 383 LTLSSRNSPDMD---KMAVRNFLKVQR---TYQVLIIGYEKLLSVSEELEKNKHLIDMLV 436

Query: 447 ADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFR 506
            DEGHRLKNG S    +L S++  R+++L+GTPIQNDL+E+F +++F NPG+LG+ A F+
Sbjct: 437 CDEGHRLKNGASKILNTLKSLDIRRKLLLTGTPIQNDLNEFFTIIDFINPGILGSFASFK 496

Query: 507 KNFEIPILRGRD-ADATDKEI-AAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHIL 564
           + F IPI R RD A+  ++E+   GE +  E+ +I  +FI+RRTN IL KYLP K + IL
Sbjct: 497 RRFIIPITRARDTANRYNEELLEKGEERSKEMIEITKRFILRRTNAILEKYLPPKTDIIL 556

Query: 565 FVNLSPMQKAIYEHFVRSREVAKLMKG--TGSQPLKAIGLLKKLCNHPDLLDLPDEIAGS 622
           F      Q   ++  ++    A+L  G  T S  L  I LLKK+CN P L+       GS
Sbjct: 557 FCKPYSQQILAFKDILQG---ARLDFGQLTFSSSLGLITLLKKVCNSPGLV-------GS 606

Query: 623 TNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLISNYTQT 682
                D Y  +   +++   S+   ++ +S K  +L   L  I+  + +K+V++SNYTQT
Sbjct: 607 -----DPYYKSHIKDTQSQDSYS--RSLNSGKLKVLMTLLEGIRKGTKEKVVVVSNYTQT 659

Query: 683 LDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFN-DPSGEEFIFLLSSKAGGCGINLIG 741
           LD+IE +         RLDG++   +R  +V  FN +P+   F FLLS+K+GG G+NL+G
Sbjct: 660 LDIIENLMNMAGMSHCRLDGSIPAKQRDSIVTSFNRNPA--IFGFLLSAKSGGVGLNLVG 717

Query: 742 ANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSC 801
            +RLIL D DWNP+ D QA++R+ RDGQKK CFIYR +TTG I+EKI QR  MK SLS  
Sbjct: 718 RSRLILFDNDWNPSVDLQAMSRIHRDGQKKPCFIYRLVTTGCIDEKILQRQLMKNSLSQK 777

Query: 802 VVEEKE------DVERLFSSENLRPLFQF----DSNTH 829
            + + E        + LF+ E+L+ LF       SNTH
Sbjct: 778 FLGDSEMRNKESSNDDLFNKEDLKDLFSVHTDTKSNTH 815

>AGL212W [4100] [Homologous to ScYBR073W (RDH54) - SH]
           complement(295808..298519) [2712 bp, 903 aa]
          Length = 903

 Score =  361 bits (927), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 231/630 (36%), Positives = 328/630 (52%), Gaps = 98/630 (15%)

Query: 221 VPVVIDPRLARILRPHQVEGVRFLYRCVTGLAMKDFLDTQAVLAAGEVQDDGTGKDPGSK 280
           V VV+DP L++ LR HQ  G++F+Y CV GLA              E  DD T       
Sbjct: 241 VEVVVDPILSKKLRQHQRTGIKFMYDCVRGLA------------RSEKDDDRT------- 281

Query: 281 DSEPIVVEVLEEXXXXXXXXXXXXSPEILDANAAMTRESNRGAYGCIMADEMGLGKTLQC 340
                                             M  E +    GC++ADEMGLGKT   
Sbjct: 282 ---------------------------------VMILEYDSDVKGCLLADEMGLGKTCMT 308

Query: 341 IALMWTLLRQ------------GSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDALSP 388
           IAL+WTLL+Q            G   +   +K ++VCP +L+ NW  E +KWL  + +  
Sbjct: 309 IALIWTLLKQHPRPSSVPCSQLGVALQGICQKVLVVCPVTLIGNWKKEFIKWLPMNRIGI 368

Query: 389 LAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCK--VGLML 446
           L +  + +   +      VR +   Q       VLI+ YE L      L   K  + L++
Sbjct: 369 LTLSSKNTPEKD---KNDVRNFLRVQR---TYQVLILGYEKLLNVFSELDQAKSKLDLLI 422

Query: 447 ADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFR 506
            DEGHRLKN  S     L  +   R+VIL+GTPIQNDL+E++ ++NF NPG+LGT A F+
Sbjct: 423 CDEGHRLKNSSSKILKCLTDLEIERKVILTGTPIQNDLNEFYTIINFINPGILGTFAHFK 482

Query: 507 KNFEIPILRGRDADA--TDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHIL 564
           + +  PI R RD +    D+ ++ GE +  +L +I  KFI+RRT+ I++ YLP + + ++
Sbjct: 483 RVYITPITRARDVNNKHNDQIVSLGESRSQDLIEITKKFILRRTSSIIADYLPPRTDIVV 542

Query: 565 FVNLSPMQ-KAIYEHFVRSREVAKLMKGTGSQPLKAIGLLKKLCNHPDLLDLPDEIAGST 623
           F   +  Q  A  +  V +R   + M    S  L  I L KK+CN P L+          
Sbjct: 543 FCKPTQHQLDAFNQVLVGTRVDFQNMSFNSS--LGLITLFKKICNSPSLVS--------- 591

Query: 624 NLIPDDYQSAMTHNSRGGRSHVEV-QTTHSSKFAILERFLFKIKHES-NDKIVLISNYTQ 681
               D Y  +  +   GG   + + Q+T S K  +L   L +I H S N+K+V+ISNYTQ
Sbjct: 592 ---SDSYFQSKVN---GGTPALRIAQSTTSGKLKVLMSLLHQIAHRSDNEKVVVISNYTQ 645

Query: 682 TLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGINLIG 741
           TLD+I  +        LRLDG+    +R  +V+ FN  S   F FLLS+K+GG G+NL+G
Sbjct: 646 TLDIIGNLMSSASLSYLRLDGSTPAKERDAIVNDFN-RSQTIFGFLLSAKSGGVGLNLVG 704

Query: 742 ANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSC 801
           A+RLIL D DWNP+ D QA++R+ RDGQKK CFIYR +TTG I+EKI QR  MK +LS  
Sbjct: 705 ASRLILFDNDWNPSVDLQAMSRIHRDGQKKPCFIYRLVTTGCIDEKIFQRQLMKNNLSKK 764

Query: 802 VVEEKED---VERLFSSENLRPLFQFDSNT 828
            +++  D    + +F  E+L+ LF   S T
Sbjct: 765 FLDDHCDDKSSDNVFEQEDLKDLFSVQSGT 794

>Kwal_27.10513
          Length = 900

 Score =  360 bits (923), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 235/637 (36%), Positives = 334/637 (52%), Gaps = 108/637 (16%)

Query: 223 VVIDPRLARILRPHQVEGVRFLYRCVTGLAMKDFLDTQAVLAAGEVQDDGTGKDPGSKDS 282
           VV+DP L++ LRPHQ  GV+F+Y C+ GL+                +DDGT      + +
Sbjct: 241 VVVDPILSKHLRPHQRIGVKFMYDCILGLSRPSC-----------YEDDGTFSTKLKRTN 289

Query: 283 EPIVVEVLEEXXXXXXXXXXXXSPEILDANAAMTRESNRGAYGCIMADEMGLGKTLQCIA 342
           E                                         GC++ADEMGLGKTL  I 
Sbjct: 290 E---------------------------------------IQGCLLADEMGLGKTLMTIT 310

Query: 343 LMWTLLRQ--------GSQGRPTIE----KCIIVCPSSLVNNWANEIVKWLGPDALSPLA 390
           L+WTLL+Q         SQ   +++    K ++VCP +L+ NW  E  KWL  + +  L 
Sbjct: 311 LVWTLLKQTPIPSKANSSQNGISLQGLCNKILVVCPVTLIGNWKREFSKWLNVNRIGILT 370

Query: 391 IDGRKSSLSNGSVAQ-SVRQWAIAQGRNVVKPVLIISYETLRRNVENL--KGCKVGLMLA 447
           +    SS SN    + +VR +   Q       VL+I YE L    E L     K+ L++ 
Sbjct: 371 L----SSKSNAEKDKLTVRNFLRVQR---TYQVLVIGYEKLLSVTEELLEAKSKIDLVIC 423

Query: 448 DEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFRK 507
           DEGHRLKNG S T  ++ S+  PR+++L+GTPIQNDL+E+F + +F N G+LGT ++F++
Sbjct: 424 DEGHRLKNGQSKTLKAISSLEVPRKIMLTGTPIQNDLAEFFTIADFLNDGILGTFSKFKR 483

Query: 508 NFEIPILRGRDADATDKEIA--AGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHILF 565
           +F  PI R RD +     +    G  K  EL +I   F +RRT + +SK+LP K + +LF
Sbjct: 484 DFINPITRARDLNNKHNNLIQEKGRDKTQELIEITKNFTLRRTAETISKFLPSKTDVVLF 543

Query: 566 VNLSPMQKAIYEHFVRSREVAKL--MKGTGSQPLKAIGLLKKLCNHPDLLDLPDEIAGST 623
              +  Q    + F ++   A+L   + T +  L  I L KK+CN P L+          
Sbjct: 544 CKPTSGQ---LDAFRKTLSAAQLDFSRLTFNSSLGLITLFKKICNSPSLIS--------- 591

Query: 624 NLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHES-NDKIVLISNYTQT 682
                  Q +    +    S V++    S K  +L   L  ++  S  +K+V++SNYTQT
Sbjct: 592 -------QDSYYLETIKPNSEVKISAPDSGKLRVLMALLDNLRKLSPQEKVVIVSNYTQT 644

Query: 683 LDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFND-PSGEEFIFLLSSKAGGCGINLIG 741
           LD+I+ M   N     RLDG+     R K+V+ FN  PS   F FLLS+K+GG G+NLIG
Sbjct: 645 LDIIQNMICSNSLSFTRLDGSTANKDRDKIVNSFNTVPS--IFAFLLSAKSGGMGLNLIG 702

Query: 742 ANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSC 801
           A+RLIL D DWNPA D QA++R+ RDGQK++C+IYR +TTG I+EKI QR   K SLSS 
Sbjct: 703 ASRLILFDNDWNPAIDLQAMSRIHRDGQKRECYIYRLLTTGCIDEKIFQRQLAKTSLSSK 762

Query: 802 VVEEKEDV-----ERLFSSENLRPLFQF----DSNTH 829
            + +  D      + LF SE+L+ LF       SNTH
Sbjct: 763 FMGDSADSNTESGDDLFGSEDLKDLFTVHATTSSNTH 799

>KLLA0F11814g complement(1089699..1092494) similar to sp|P38086
           Saccharomyces cerevisiae YBR073w RDH54 required for
           mitotic diploid-specific recombination and repair and
           meiosis, start by similarity
          Length = 931

 Score =  355 bits (910), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 213/555 (38%), Positives = 312/555 (56%), Gaps = 73/555 (13%)

Query: 311 ANAAMTRESNRGAYGCIMADEMGLGKTLQCIALMWTLLRQ----------GSQGRPTIEK 360
            + +M  E +    GC++ADEMGLGKTL  I L+WTLL+Q          G      I K
Sbjct: 301 GDESMILERDDDIKGCLLADEMGLGKTLMTITLIWTLLKQTPYPTIINQRGVTLAGEISK 360

Query: 361 CIIVCPSSLVNNWANEIVKWLGPDALSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVK 420
            +IVCP +L+ NW  E  KWL  + +  L +  R S   +            AQ R+ +K
Sbjct: 361 VLIVCPVTLIGNWKKEFKKWLPMNRIGVLTLHSRNSPTEDK-----------AQVRSFLK 409

Query: 421 -----PVLIISYETLRRNVENLKGCK--VGLMLADEGHRLKNGDSLTFTSLDSINCPRRV 473
                 VLI+ YE L    + L+  K  + L++ DEGHRLKN DS     L S++  +++
Sbjct: 410 VPRTYQVLIVGYEKLLSIKDELQNEKRNLDLVICDEGHRLKNKDSKILKVLQSLDIEKKI 469

Query: 474 ILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFRKNFEIPILRGRDADATDKE--IAAGEV 531
           +LSGTPIQNDL E++ +++F NPG+LG+  +F++ + +PI R RD +A   +  +  G +
Sbjct: 470 VLSGTPIQNDLEEFYTIIDFINPGILGSFGRFKREYILPIARSRDVNAKQNQTLVEQGLL 529

Query: 532 KLHELSQIVSKFIIRRTNDILSKYLPCKYEHILFVNLSPMQKAIYEHFVRSREVAKLMKG 591
           +  +L +I  +FI+RRTN+IL +YLP + + I+F   +  Q   + H + +         
Sbjct: 530 RSDQLIEITKRFILRRTNEILQQYLPPRTDLIIFCKPTAEQVEAF-HKILTEGQLNFSNM 588

Query: 592 TGSQPLKAIGLLKKLCNHPDLLDLPDEIAGSTNLIPDD--YQSAMTHNSRGGRSHVEVQT 649
           T +  L  I L KK+CN             ST LI  D  Y+  ++          +VQT
Sbjct: 589 TFNSSLGLITLFKKICN-------------STRLIKTDPYYEERLS----------QVQT 625

Query: 650 THSS------KFAILERFLFKIKHESNDKIVLISNYTQTLDLIEKMCRYNHYGVLRLDGT 703
           + +S      K  IL   L ++K ++++K+V+ISNYTQTLD+IE  C    Y   RLDG+
Sbjct: 626 SSTSGKFTSGKLRILLSLLHELKTKTDEKVVVISNYTQTLDIIEGHCSSEGYTSARLDGS 685

Query: 704 MTINKRQKLVDKFN-DPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALA 762
                R ++V  FN DPS   F+FLLS+K+GG G+NLIGA+RL+L D DWNP+ D QA++
Sbjct: 686 TATKTRDQIVTSFNNDPSI--FVFLLSAKSGGVGLNLIGASRLVLFDNDWNPSIDLQAMS 743

Query: 763 RVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVEEKEDVER----LFSSENL 818
           R+ RDGQ++ CFIYR +TTG I+EKI QR  MK++LS   ++   D  +    LF  E L
Sbjct: 744 RIHRDGQRRPCFIYRLVTTGCIDEKILQRQLMKIALSKKFLDSATDQSKNDDDLFQQEEL 803

Query: 819 RPLFQFD----SNTH 829
           + LF  +    SNTH
Sbjct: 804 KDLFTINLSTLSNTH 818

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 57/120 (47%), Gaps = 19/120 (15%)

Query: 149 AIVLYDPTVDGEIPDETPREEPAQKENDGGNEEQARPTRRTATHPEKLSNGLRNKTLREL 208
           A +   P +   IP  T + +P +K  +G  E +  P ++       + + L   + +EL
Sbjct: 181 ATIESKPPIQTFIPKITTKFKPLRKHLNG--EPKVPPAQKQLVDQPTVKSALPPLS-QEL 237

Query: 209 LGTVTETPKFP----------------SVPVVIDPRLARILRPHQVEGVRFLYRCVTGLA 252
           +G +T +P F                  V V++DP L++ LRPHQ EGV+FLY CV  + 
Sbjct: 238 IGQITYSPLFDPVSIKDPLIMNKTENHKVSVIVDPLLSKTLRPHQREGVKFLYDCVMNMV 297

>CAGL0M01958g complement(238113..240875) similar to sp|P38086
           Saccharomyces cerevisiae YBR073w RDH54, hypothetical
           start
          Length = 920

 Score =  353 bits (907), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 257/733 (35%), Positives = 373/733 (50%), Gaps = 116/733 (15%)

Query: 165 TPREEPAQKENDGGNEEQARPTRRTATHP-EKLSNGLRNKTLRELLGTVTETPKFPSVPV 223
           T +  P  +     N++ A+  R   T P +K  +     T+   L  +  T +   V +
Sbjct: 200 TLKTNPNARPISSMNKQIAKTNRPENTVPTQKFRSLFDCNTIENPL--IMNTFQGSEVDI 257

Query: 224 VIDPRLARILRPHQVEGVRFLYRCVTGLAMKDFLDTQAVLAAGEVQDDGTGKDPGSKDSE 283
           ++DP L ++LR HQ  GV+F+Y C+ GL               E  DD + +        
Sbjct: 258 IVDPLLCKMLRNHQRIGVKFMYDCLLGLETN---------LTAESTDDKSCR-------- 300

Query: 284 PIVVEVLEEXXXXXXXXXXXXSPEILDANAAMTRESNRGAYGCIMADEMGLGKTLQCIAL 343
                                          + R+S+    GCI+AD+MGLGKTL  I L
Sbjct: 301 -------------------------------LERDSD--IKGCILADDMGLGKTLMTITL 327

Query: 344 MWTLLRQ---------GSQGRP---TIEKCIIVCPSSLVNNWANEIVKWLGPDALSPLAI 391
           +WTLL+Q            G P    I K +IVCP +L+ NW  E  KWLG + +  L +
Sbjct: 328 IWTLLKQTPFASKVQCSQLGVPLSGMISKVVIVCPVTLIGNWKREFKKWLGLNRIGILTL 387

Query: 392 DGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENL--KGCKVGLMLADE 449
           +  K+++    +  SVR +      N    VLI+ YE +    E L  +  K+ L++ DE
Sbjct: 388 NP-KNNVDMDKI--SVRNFIKV---NRTYQVLILGYEKVLTVQEELLKQKDKLDLLICDE 441

Query: 450 GHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFRKNF 509
           GHRLKNG S     L S++  ++VIL+GTPIQNDL+E+F +++F NPG+LGT A F+K +
Sbjct: 442 GHRLKNGASKILKVLKSLDIDKKVILTGTPIQNDLNEFFTIIDFVNPGVLGTYASFKKLY 501

Query: 510 EIPILRGRDADA--TDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHILFVN 567
             PI R RD +     K I  GE K ++L +   +FI+RR+N+ILSK+LP K + ILF  
Sbjct: 502 INPISRARDINNKFNTKVIEQGEEKSNQLIEFTKRFILRRSNNILSKFLPPKTDIILFCR 561

Query: 568 LSPMQKAIYEHFVRSREVAKLMKGTGSQPLKAIGLLKKLCNHPDLLDLPDEIAGSTNLIP 627
            +  Q   +   + +  V  +   T +  L  I L+KK+CN P LL              
Sbjct: 562 PTIEQIKAFRDIIENVRV-DMNNITFNTSLGLINLMKKVCNSPSLL-------------C 607

Query: 628 DD--YQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHES-NDKIVLISNYTQTLD 684
           +D  YQS +  N       V  ++  S K  +L   L +IK  S  +K+V++SNYTQ+LD
Sbjct: 608 NDPYYQSNVDSNI----FTVSNKSNSSGKLTVLLELLLEIKATSPMEKVVIVSNYTQSLD 663

Query: 685 LIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGINLIGANR 744
           +I+ +   N     RLDG     +R  LV+ FN+ +   F FLLS+KAGG G+NLIGA+R
Sbjct: 664 IIQGLMNSNQLSNCRLDGATPAKQRDMLVNTFNN-NPNIFGFLLSAKAGGVGLNLIGASR 722

Query: 745 LILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMS-----LS 799
           L+L D DWNPA D QA++R+ R+GQK+ C+IYR ITTG I+EKI QR  MK +     LS
Sbjct: 723 LVLFDNDWNPAVDLQAMSRIHREGQKRPCYIYRLITTGCIDEKILQRQLMKHNLTRKFLS 782

Query: 800 SCVVEEKEDVERLFSSENLRPLFQFDSNTHMRYPPTYHCKRCR---------DGKQMIKA 850
           S   +     + LF   +L+ LF    NT        H   CR         D ++++KA
Sbjct: 783 SNTSDTGSANDDLFDKSDLKDLFTIHQNTK----SNTHDLICRCDGLGEEFDDDEEVLKA 838

Query: 851 PAMLYGDATTWNH 863
           PA L G    W++
Sbjct: 839 PA-LDGSFEQWSN 850

>KLLA0E22726g complement(2018248..2021349) similar to sp|P40352
           Saccharomyces cerevisiae YJR035w RAD26 DNA repair and
           recombination protein, start by similarity
          Length = 1033

 Score =  292 bits (748), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 183/535 (34%), Positives = 273/535 (51%), Gaps = 65/535 (12%)

Query: 325 GCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGP- 383
           G I+ DEMGLGKT+Q IA + TL        P     ++VCP++++  W NE   W  P 
Sbjct: 285 GGIIGDEMGLGKTIQIIAFLATLHHSRKLNGP----VLVVCPATVMKQWCNEFHTWWPPF 340

Query: 384 --------------------DALSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVL 423
                               + L  + +     + +     +  +     + R  VK +L
Sbjct: 341 RAVILHSIGAGMNKGTQIPEEELEKMLMTSNYGTFTYNDYEKKEKTRTSLESRKSVKKLL 400

Query: 424 ----------IISYETLRRNVENLKGCKVGLMLADEGHRLKNGDSLTFTSLDSINCPRRV 473
                     I +Y  LR + E L   + G  + DEGH+++N DS    +   +    R+
Sbjct: 401 EKVITDGHIIITTYVGLRLHSEALLNVRWGYAILDEGHKIRNPDSDISLTCKQLKTQNRI 460

Query: 474 ILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFRKNFEIPILRGRDADATDKEIAAGEVKL 533
           ILSGTPIQN+L+E ++L +F  PG LGT   F++ F  PI  G  A+A++ ++  G    
Sbjct: 461 ILSGTPIQNNLTELWSLFDFVYPGKLGTLPVFQQQFANPINMGGYANASNIQVKTGYKCA 520

Query: 534 HELSQIVSKFIIRRTNDILSKYLPCKYEHILFVNLSPMQKAIYEHFVRSREVAKLMKGTG 593
             L  ++S +++RR    ++K LP K E +LF  L+  QK+ Y  F+ S E+ K+ KG  
Sbjct: 521 VALRDLISPYLLRRVKSDVAKDLPKKNEMVLFCKLTQYQKSKYLEFLHSDELMKIRKGK- 579

Query: 594 SQPLKAIGLLKKLCNHPDLLDLPDEIAGSTNLIPDDYQSAMTHN-SRGGRSHVEVQTTHS 652
            Q L  I +L+K+CNHPDLLDL  +         +DY+ A   N +R G+  V  Q    
Sbjct: 580 RQVLYGIDILRKICNHPDLLDLKRKKM-------NDYEDADYGNPARSGKMQVVKQ---- 628

Query: 653 SKFAILERFLFKIKHESNDKIVLISNYTQTLDLIEKMCRY-----NHYGVLRLDGTMTIN 707
                    L  + H    K +L +   Q LD++++   Y     +    LR+DGT  I 
Sbjct: 629 ---------LLLLWHSQGHKTLLFTQSRQMLDILQEFISYKDPELSDLKFLRMDGTTNIG 679

Query: 708 KRQKLVDKFNDPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRD 767
            RQ LVDKFN+   +  +FLL+++ GG GINL GANR+I+ DPDWNP+ D QA  R WR 
Sbjct: 680 SRQSLVDKFNNEPYD--VFLLTTRVGGLGINLTGANRIIIFDPDWNPSTDMQARERAWRI 737

Query: 768 GQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVEEKEDVERLFSSENLRPLF 822
           GQK++  IYR +  GSIEEKI  R   K  LS+ ++++ +  +R F   +L  LF
Sbjct: 738 GQKREVTIYRLMIAGSIEEKIYHRQIFKQFLSNKILKDPKQ-KRFFKMNDLHDLF 791

>Scas_549.4
          Length = 1079

 Score =  285 bits (729), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 181/539 (33%), Positives = 274/539 (50%), Gaps = 77/539 (14%)

Query: 325 GCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWL--- 381
           G I+ DEMGLGKT+Q IA + +L   G    P     +IVCP++++  W NE+  W    
Sbjct: 324 GGIIGDEMGLGKTIQIIAFLASLHHSGLLNGP----VLIVCPATVMKQWCNELHHWWPPL 379

Query: 382 ------------------------------GPDALSPLAIDGR---KSSLSNGSVAQSVR 408
                                          P+ L+      R   K+SL +    QS+ 
Sbjct: 380 RTIILHSTGSGMSTKKNFSEEELEQAMMNANPNELTCEDFQNRSKTKASLESTFNIQSLI 439

Query: 409 QWAIAQGRNVVKPVLIISYETLRRNVENLKGCKVGLMLADEGHRLKNGDSLTFTSLDSIN 468
              I  G      ++I +Y  LR + E L        + DEGH+++N DS    +   I 
Sbjct: 440 DKVINDGH-----IIITTYVGLRIHSEQLLKVNWAYAVLDEGHKIRNPDSDISLTCKKIK 494

Query: 469 CPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFRKNFEIPILRGRDADATDKEIAA 528
            P R+ILSGTPIQN+L E ++L +F  PG LGT   F++ F +PI  G  A+AT+ ++  
Sbjct: 495 TPNRIILSGTPIQNNLIELWSLFDFIYPGKLGTLPVFQQQFVMPINAGGYANATNIQVQT 554

Query: 529 GEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHILFVNLSPMQKAIYEHFVRSREVAKL 588
           G      L  ++S +++RR    ++K LP K E +LF  L+  QK  Y  F+ S E+ ++
Sbjct: 555 GVKCATALRNLISPYLLRRVKSDVAKDLPEKKEMVLFCKLTQYQKNRYLEFLNSNELTQI 614

Query: 589 MKGTGSQPLKAIGLLKKLCNHPDLLDLPDEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQ 648
            +G     L  I +L+K+CNHPDLL+  +            Y++   +  R G+  V  Q
Sbjct: 615 -RGGRRHVLYGIDILRKICNHPDLLEREER----------QYETDYGNPKRSGKMQVVKQ 663

Query: 649 TTHSSKFAILERFLFKIKHESNDKIVLISNYTQTLDLIEKMCRYNHYGV-----LRLDGT 703
                        L  + H+   K +L +   Q LD++E+  ++    +     LR+DGT
Sbjct: 664 -------------LLLLWHKEGHKTLLFTQSRQMLDILEQFIQFKDSDLSVLKYLRMDGT 710

Query: 704 MTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALAR 763
             I+KRQ LVD+FN+   +  +FLL+++ GG G+NL GANR+I+ DPDWNP+ D QA  R
Sbjct: 711 SNISKRQGLVDQFNNEDYD--VFLLTTRVGGLGVNLTGANRIIIYDPDWNPSTDMQARER 768

Query: 764 VWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVEEKEDVERLFSSENLRPLF 822
            WR GQK++  IYR + +GSIEEKI  R   K  L++ ++ + +  +R F    LR LF
Sbjct: 769 AWRIGQKREVSIYRLMVSGSIEEKIYHRQIFKQFLTNKILTDPKQ-KRFFKMNELRDLF 826

>Sklu_2125.3 YJR035W, Contig c2125 6474-9632
          Length = 1052

 Score =  283 bits (724), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 182/536 (33%), Positives = 271/536 (50%), Gaps = 71/536 (13%)

Query: 325 GCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGP- 383
           G I+ DEMGLGKT+Q I+ + +L   G    P     +IVCP++++  W NE   W  P 
Sbjct: 305 GGIIGDEMGLGKTIQIISFLASLHHSGMLDGP----ILIVCPATVMKQWCNEFHTWWPPF 360

Query: 384 --------------------DALSPLAIDGRKSSLSNGSVAQSVRQWAIAQGR-NVVK-- 420
                               D L  + ++      S      S +  +  + + N+ K  
Sbjct: 361 RAVILHSIGSGMSNKEKLSEDRLEEMLMNSNPEEFSYVDYTDSKKTKSTMESKLNLTKLV 420

Query: 421 -------PVLIISYETLRRNVENLKGCKVGLMLADEGHRLKNGDSLTFTSLDSINCPRRV 473
                   VLI +Y  LR + + L   K G  + DEGH+++N DS    +   +    RV
Sbjct: 421 DKVVNDGHVLITTYVGLRLHADELLKVKWGYAVLDEGHKIRNPDSDISLTCKQLKTSNRV 480

Query: 474 ILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFRKNFEIPILRGRDADATDKEIAAGEVKL 533
           ILSGTPIQN+L+E ++L +F  PG LGT   F++ F IPI  G  A+AT+ ++  G    
Sbjct: 481 ILSGTPIQNNLTELWSLFDFIFPGRLGTLPVFQQQFAIPINMGGYANATNIQVQTGYKCA 540

Query: 534 HELSQIVSKFIIRRTNDILSKYLPCKYEHILFVNLSPMQKAIYEHFVRSREVAKLMKGTG 593
             L  ++S +++RR    ++K LP K E +LF  L+  Q+  Y  F+ S ++ K+  G  
Sbjct: 541 VALRDLISPYLLRRVKTDVAKDLPKKNEMVLFCKLTQYQRNKYLQFLNSGDLVKIKNGK- 599

Query: 594 SQPLKAIGLLKKLCNHPDLLDLPDEIAGSTNLIPDDYQSAMTHNS--RGGRSHVEVQTTH 651
            Q L  I +L+K+CNHPD+            L+ D   S  ++    R G+  V  Q   
Sbjct: 600 RQVLYGIDILRKICNHPDI------------LVRDMRHSEESYGDPKRSGKMQVVKQ--- 644

Query: 652 SSKFAILERFLFKIKHESNDKIVLISNYTQTLDLIEKMCRY-----NHYGVLRLDGTMTI 706
                     L K+  E   K +L +   Q LD++EK   Y     +    LR+DGT  I
Sbjct: 645 ----------LLKLWKEQGHKTLLFTQSRQMLDILEKFISYRDPELSSLTYLRMDGTTNI 694

Query: 707 NKRQKLVDKFNDPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWR 766
             RQ LVDKFN+   +  +FLL+++ GG G+NL GANR+I+ DPDWNP+ D QA  R WR
Sbjct: 695 AARQHLVDKFNNELYD--VFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDLQARERAWR 752

Query: 767 DGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVEEKEDVERLFSSENLRPLF 822
            GQK++  IYR +  GSIEEKI  R   K  L++ ++++ +  +R F    L+ LF
Sbjct: 753 IGQKREVTIYRLMIAGSIEEKIYHRQIFKQFLTNKILKDPKQ-KRFFKMNELQDLF 807

>CAGL0I01694g complement(141422..144637) similar to sp|P40352
           Saccharomyces cerevisiae YJR035w RAD26 DNA repair and
           recombination protein, start by similarity
          Length = 1071

 Score =  278 bits (711), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 184/565 (32%), Positives = 278/565 (49%), Gaps = 82/565 (14%)

Query: 325 GCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGP- 383
           G I+ DEMGLGKT+Q  A +  L        P     +IVCP++++  W NEI +W  P 
Sbjct: 317 GGIIGDEMGLGKTIQVTAFLAALHHSNLLSGP----VLIVCPATVMKQWCNEIHQWWPPF 372

Query: 384 --------------------DALSPLAIDGR---------------KSSLSNGSVAQSVR 408
                               D +  + I                  KS +  G   Q++ 
Sbjct: 373 RAVILHSIGAGMNDKSNLTEDEIENMIIKSELENTDFHDYENASKLKSKVETGMHMQNLI 432

Query: 409 QWAIAQGRNVVKPVLIISYETLRRNVENLKGCKVGLMLADEGHRLKNGDSLTFTSLDSIN 468
              +A G      ++I +Y  LR + + L        + DEGH+++N DS    +   + 
Sbjct: 433 SKVVADGH-----IIITTYVGLRIHSDKLLNVNWSYCVLDEGHKIRNPDSEISLTCKKLK 487

Query: 469 CPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFRKNFEIPILRGRDADATDKEIAA 528
           C  R+ILSGTPIQN+L E ++L +F  PG LGT   F++ F  PI  G  A+AT+ ++  
Sbjct: 488 CKNRIILSGTPIQNNLVELWSLFDFIYPGRLGTLPVFQQQFVQPINMGGYANATNTQVQT 547

Query: 529 GEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHILFVNLSPMQKAIYEHFVRSREVAKL 588
           G      L  ++S +++RR    ++K LP K E +LF  L+  Q+  Y  F+ S E++++
Sbjct: 548 GYRCAVALRDLISPYLLRRVKADVAKDLPKKKEMVLFCKLTEFQRRKYLEFLSSDELSQI 607

Query: 589 MKGTGSQPLKAIGLLKKLCNHPDLLDLPDEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQ 648
            KG     L  I +L+K+CNHPDLLD  D I  +         S      R G+  V  Q
Sbjct: 608 -KGGKRHVLYGIDILRKICNHPDLLD-RDYIKNT---------SGYGDPKRSGKMQVVKQ 656

Query: 649 TTHSSKFAILERFLFKIKHESNDKIVLISNYTQTLDLIEKMCRYNH-----YGVLRLDGT 703
                        L K+      K +L +   Q LD++E+  ++          LR+DGT
Sbjct: 657 -------------LLKLWKSEGHKTLLFTQSRQMLDILEEFIKFKEPELSDIRYLRMDGT 703

Query: 704 MTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALAR 763
            +I  RQ LVD+FN+ S +  +FLL+++ GG G+NL GANR+I+ DPDWNP+ D QA  R
Sbjct: 704 TSIQVRQTLVDRFNNESYD--VFLLTTRVGGLGVNLTGANRIIIYDPDWNPSTDLQARER 761

Query: 764 VWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVEEKEDVERLFSSENLRPLF- 822
            WR GQK++  IYR + +G+IEEKI  R   K  L + V+ + +  +R F ++ L+ LF 
Sbjct: 762 AWRIGQKREVSIYRLMISGTIEEKIYHRQIFKQFLMNKVLSDPKQ-KRFFKTKELQDLFS 820

Query: 823 ----QFDSNTHMRYPPTYHCKRCRD 843
               Q  S   +      H K+ +D
Sbjct: 821 LGGEQGYSTETLNEEVEKHTKKLKD 845

>YJR035W (RAD26) [2931] chr10 (497269..500526) Putative helicase
           involved in transcription-coupled repair in some strain
           backgrounds, may have a role in chromatin remodeling,
           homolog of Cockayne syndrome B gene ERCC-6 [3258 bp,
           1085 aa]
          Length = 1085

 Score =  276 bits (706), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 179/536 (33%), Positives = 271/536 (50%), Gaps = 69/536 (12%)

Query: 325 GCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGP- 383
           G I+ DEMGLGKT+Q IA +  L   G    P     +IVCP++++  W NE   W  P 
Sbjct: 317 GGIIGDEMGLGKTIQVIAFIAALHHSGLLTGP----VLIVCPATVMKQWCNEFQHWWPPL 372

Query: 384 ----------------------DALSPLAIDGRKSSLSNGSVAQSVR-QWAIAQGRNVVK 420
                                 + L  L ++ + S  S      S R + A+    ++ K
Sbjct: 373 RTVILHSMGSGMASDQKFKMDENDLENLIMNSKPSDFSYEDWKNSTRTKKALESSYHLDK 432

Query: 421 ---------PVLIISYETLRRNVENLKGCKVGLMLADEGHRLKNGDSLTFTSLDSINCPR 471
                     +LI +Y  LR + + L   K    + DEGH+++N DS    +   +    
Sbjct: 433 LIDKVVTDGHILITTYVGLRIHSDKLLKVKWQYAVLDEGHKIRNPDSEISLTCKKLKTHN 492

Query: 472 RVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFRKNFEIPILRGRDADATDKEIAAGEV 531
           R+ILSGTPIQN+L+E ++L +F  PG LGT   F++ F IPI  G  A+AT+ ++  G  
Sbjct: 493 RIILSGTPIQNNLTELWSLFDFIFPGKLGTLPVFQQQFVIPINIGGYANATNIQVQTGYK 552

Query: 532 KLHELSQIVSKFIIRRTNDILSKYLPCKYEHILFVNLSPMQKAIYEHFVRSREVAKLMKG 591
               L  ++S +++RR    ++K LP K E +LF  L+  Q++ Y  F+ S ++ ++  G
Sbjct: 553 CAVALRDLISPYLLRRVKADVAKDLPQKKEMVLFCKLTKYQRSKYLEFLHSSDLNQIQNG 612

Query: 592 TGSQPLKAIGLLKKLCNHPDLLDLPDEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTH 651
                L  I +L+K+CNHPDLLD                +    HN   G          
Sbjct: 613 K-RNVLFGIDILRKICNHPDLLD----------------RDTKRHNPDYG------DPKR 649

Query: 652 SSKFAILERFLFKIKHESNDKIVLISNYTQTLDLIEKMCR-----YNHYGVLRLDGTMTI 706
           S K  ++++ L  + H+   K +L +   Q LD++E+         +H   LR+DGT  I
Sbjct: 650 SGKMQVVKQLLL-LWHKQGYKALLFTQSRQMLDILEEFISTKDPDLSHLNYLRMDGTTNI 708

Query: 707 NKRQKLVDKFNDPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWR 766
             RQ LVD+FN+ S +  +FLL+++ GG G+NL GANR+I+ DPDWNP+ D QA  R WR
Sbjct: 709 KGRQSLVDRFNNESFD--VFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDMQARERAWR 766

Query: 767 DGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVEEKEDVERLFSSENLRPLF 822
            GQK++  IYR +  GSIEEKI  R   K  L++ ++ + +  +R F    L  LF
Sbjct: 767 IGQKREVSIYRLMVGGSIEEKIYHRQIFKQFLTNRILTDPKQ-KRFFKIHELHDLF 821

>AEL065C [2441] [Homologous to ScYJR035W (RAD26) - SH]
           (511520..514597) [3078 bp, 1025 aa]
          Length = 1025

 Score =  269 bits (688), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 172/536 (32%), Positives = 266/536 (49%), Gaps = 67/536 (12%)

Query: 325 GCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGP- 383
           G I+ DEMGLGKT+Q ++ + +L   G    P     ++VCP++++  W +E   W  P 
Sbjct: 283 GGIVGDEMGLGKTIQIVSFLASLHHSGKLKGP----VLVVCPATVMKQWCSEFQTWWPPF 338

Query: 384 --------------------DALSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKP-- 421
                               + L  L +    +  S    A   R     + R  ++   
Sbjct: 339 RAVILHSIGAGMITRKKMTEEQLEELLMRDESNEFSYEQYANLGRTKKQLEARRGIESLV 398

Query: 422 --------VLIISYETLRRNVENLKGCKVGLMLADEGHRLKNGDSLTFTSLDSINCPRRV 473
                   +LI +Y  L+ + + L        + DEGH+++N D+    +   +  P R+
Sbjct: 399 QKVVDDGHILITTYLGLQIHSDLLLHVNWDYAVLDEGHKIRNPDAGISLTCKRLRTPHRI 458

Query: 474 ILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFRKNFEIPILRGRDADATDKEIAAGEVKL 533
           ILSGTPIQN+L+E ++L +F  PG LGT   F++ F  PI  G  A+AT+ ++  G    
Sbjct: 459 ILSGTPIQNNLTELWSLFDFIFPGKLGTLPVFQQQFANPINAGGYANATNIQVQTGYKCA 518

Query: 534 HELSQIVSKFIIRRTNDILSKYLPCKYEHILFVNLSPMQKAIYEHFVRSREVAKLMKGTG 593
             L  ++S +++RR  + ++K LP K E +LF  ++  QK  Y  F+ S ++ K+  G  
Sbjct: 519 VALRDLISPYLLRRVKNDVAKDLPKKNEFVLFCKMTQFQKEKYLQFLNSEDMIKIKNGR- 577

Query: 594 SQPLKAIGLLKKLCNHPDLLDLPDEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSS 653
            Q L  I +L+K+CNHPDLL+              D++    H    G          S 
Sbjct: 578 RQVLYGIDILRKICNHPDLLE-------------RDFRK---HEPSFG------DPRRSG 615

Query: 654 KFAILERFLFKIKHESNDKIVLISNYTQTLDLIEKMCRYNH-----YGVLRLDGTMTINK 708
           K  ++++ L   K + + K +L +   Q LD++E    +          LR+DGT  I  
Sbjct: 616 KMTVIKQLLLTWKKQGH-KALLFTQSRQMLDILEAYISHKDPELAGLQYLRMDGTTNIAH 674

Query: 709 RQKLVDKFNDPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDG 768
           RQ LVD+FN+  G   +FLL+++ GG G+NL GANR+I+ DPDWNP+ D QA  R WR G
Sbjct: 675 RQALVDRFNN--GPYHLFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDLQARERAWRIG 732

Query: 769 QKKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVEEKEDVERLFSSENLRPLFQF 824
           QK+D  IY  +  GSIEEKI  R   K  L++ V+ + +  +R F    L  LF F
Sbjct: 733 QKRDVTIYLLMVAGSIEEKIYHRQIFKQFLTNKVLSDPKQ-KRFFKMNELHDLFSF 787

>Kwal_34.16082
          Length = 726

 Score =  241 bits (616), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 156/472 (33%), Positives = 235/472 (49%), Gaps = 66/472 (13%)

Query: 325 GCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGP- 383
           G I+ DEMGLGKT+Q IA + +L   G    P     +IVCP++++  W  E   W  P 
Sbjct: 283 GGIIGDEMGLGKTIQIIAFLASLHHSGKLDGP----VLIVCPATVLRQWCKEFHTWWPPF 338

Query: 384 --------------------DALSPLAIDGRKSSLSNGSVAQSVR-----QWAIAQGRNV 418
                               + L  L ++     LS  +   S R     +  +A+ + +
Sbjct: 339 RTVILHSIGAGMTQKDTISEEKLEELFMNSNPEELSYDAYMDSKRTKSTLESGMARSKLI 398

Query: 419 VKPV-----LIISYETLRRNVENLKGCKVGLMLADEGHRLKNGDSLTFTSLDSINCPRRV 473
            K V     LI +Y  LR + +NL   +    + DEGH+++N D+    +   +    R+
Sbjct: 399 NKVVSEGHILITTYVGLRIHADNLLNVRWSYAVLDEGHKIRNPDADISLTCKKLKTKNRI 458

Query: 474 ILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFRKNFEIPILRGRDADATDKEIAAGEVKL 533
           ILSGTPIQN+L+E ++L +F  PG LGT   F++ F IPI  G  A+AT+ ++  G    
Sbjct: 459 ILSGTPIQNNLTELWSLFDFIYPGRLGTLPVFQQQFSIPINVGGYANATNIQVQTGYKCA 518

Query: 534 HELSQIVSKFIIRRTNDILSKYLPCKYEHILFVNLSPMQKAIYEHFVRSREVAKLMKGTG 593
             L  ++S +++RR    ++K LP K E +LF  L+  Q+  Y  F+ S ++ K+  G  
Sbjct: 519 IALRNLISPYLLRRIKADVAKDLPKKNEMVLFCKLTQFQRRKYLQFLNSEDLTKIKNGK- 577

Query: 594 SQPLKAIGLLKKLCNHPDLLDLPDEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSS 653
            Q L  I +L+K+CNHPDLL+              + +S+     R G+  V  Q     
Sbjct: 578 RQVLFGIDILRKICNHPDLLEKDKR----------ENESSYGDPKRSGKMQVVKQ----- 622

Query: 654 KFAILERFLFKIKHESNDKIVLISNYTQTLDLIEKMCRYN-----HYGVLRLDGTMTINK 708
                   L ++ H    K +L +   Q LD++EK   Y          LR+DGT  I  
Sbjct: 623 --------LLRLWHSQGHKTLLFTQSRQMLDILEKFISYKDPELEDLTYLRMDGTTNIGS 674

Query: 709 RQKLVDKFNDPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQA 760
           RQ LVD FN+  G   +FLL+++ GG G+NL GANR+I+ DPDWNP+ D QA
Sbjct: 675 RQALVDSFNN--GLYDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDMQA 724

>CAGL0C01683g 178695..182042 highly similar to sp|P38144
           Saccharomyces cerevisiae YBR245c ISW1 or tr|Q08773
           Saccharomyces cerevisiae YOR304w ISW2, hypothetical
           start
          Length = 1115

 Score =  239 bits (611), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 157/500 (31%), Positives = 260/500 (52%), Gaps = 57/500 (11%)

Query: 312 NAAMTRESNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVN 371
           N  ++ + NR A   I+ADEMGLGKTLQ I+ +  L        P     +++ P S +N
Sbjct: 184 NWLVSLDKNRIA--GILADEMGLGKTLQTISFLGYLRYIKKIPGP----FLVIAPKSTLN 237

Query: 372 NWANEIVKWLGPDALSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLR 431
           NW  EI KW  P+ ++   + G K        A+ ++   +A   +VV    I SYE + 
Sbjct: 238 NWLREINKW-TPE-VNAFILQGDKEER-----ARLIQDKFMACDFDVV----IASYEIII 286

Query: 432 RNVENLKGCKVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALL 491
           R     +      ++ DE HR+KN +S+    L   +   R++++GTP+QN+L E +ALL
Sbjct: 287 REKAAFRKMNWEYIMIDEAHRIKNEESMLSQVLREFHSKNRLLITGTPLQNNLHELWALL 346

Query: 492 NFSNPGLLGTRAQFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRT-ND 550
           NF  P +      F + F       ++ D  D+E       + +L  ++  F++RR  +D
Sbjct: 347 NFLLPDIFSDSQDFDEWF------SKETDEEDQEKI-----VKQLHTVLQPFLLRRIKSD 395

Query: 551 ILSKYLPCKYEHILFVNLSPMQKAIYEHFVRSREVAKLMKGTGSQP-----LKAIGLLKK 605
           + +  LP K E  ++V +SPMQK  Y   +  +++  +   +GS+      L  +  L+K
Sbjct: 396 VETSLLPKK-ELNVYVGMSPMQKKWYRQIL-EKDIDAVNADSGSKESKTRLLNIVMQLRK 453

Query: 606 LCNHPDLLDLPDEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKI 665
            CNHP L D      G+    P      + +NS               K  +L++ L K+
Sbjct: 454 CCNHPYLFD------GAEPGPPYTTDEHLVYNS--------------EKLKVLDKLLRKL 493

Query: 666 KHESNDKIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFI 725
           K E+  ++++ S  ++ LD++E  C +  Y   R+DG+     R + +D++N P  ++F+
Sbjct: 494 K-EAGSRVLIFSQMSRVLDILEDYCYFREYEYCRIDGSTAHEDRIEAIDEYNAPDSKKFL 552

Query: 726 FLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIE 785
           FLL+++AGG GINL  A+ ++L D DWNP AD QA+ R  R GQKK   ++RF+T  S+E
Sbjct: 553 FLLTTRAGGLGINLTTADVVVLFDSDWNPQADLQAMDRAHRIGQKKQVRVFRFVTDNSVE 612

Query: 786 EKISQRPSMKMSLSSCVVEE 805
           EKI +R + K+ L   V+++
Sbjct: 613 EKILERATQKLRLDQLVIQQ 632

>Scas_652.17
          Length = 1025

 Score =  237 bits (604), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 158/491 (32%), Positives = 247/491 (50%), Gaps = 53/491 (10%)

Query: 320 NRGAYGCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVK 379
           ++     I+ADEMGLGKTLQ IA +  L        P     +++ P S +NNW  EI K
Sbjct: 128 HKNGLAGILADEMGLGKTLQTIAFLGYLKYMEGINGP----FLVIAPKSTLNNWLREINK 183

Query: 380 WLGPDALSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKG 439
           W  PD +    + G K        A  +++  +    ++V    + SYE + R     K 
Sbjct: 184 W-TPD-VKAFVLQGDKQER-----ASLIKEKLMTCDFDIV----VASYEIIIREKAAFKK 232

Query: 440 CKVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLL 499
                ++ DE HR+KN +SL    L       R++++GTP+QN+L E +ALLNF  P + 
Sbjct: 233 FNWEYIIIDEAHRIKNEESLLSQVLREFTSRNRLLITGTPLQNNLHELWALLNFLLPDIF 292

Query: 500 GTRAQFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRT-NDILSKYLPC 558
            +   F   F         +  T +E     VK  +L  ++  F++RR  ND+ +  LP 
Sbjct: 293 SSSQDFDDWF---------SSETTEEDQDKVVK--QLHTVLQPFLLRRIKNDVETSLLPK 341

Query: 559 KYEHILFVNLSPMQKAIYEHFVRSREVA----KLMKGTGSQPLKAIGLLKKLCNHPDLLD 614
           K E  L+V +S MQK  Y+  +     A       K + ++ L  +  L+K CNHP L D
Sbjct: 342 K-ELNLYVGMSNMQKKWYKKILEKDLDAVNGENSSKESKTRLLNIVMQLRKCCNHPYLFD 400

Query: 615 LPDEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIV 674
                 G+    P      + +NS+              K  +L++ L K+K E   +++
Sbjct: 401 ------GAEPGPPYTTDEHLVYNSK--------------KLQVLDKLLKKMK-EDGSRVL 439

Query: 675 LISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGG 734
           + S  ++ LD++E  C +  Y   R+DG+     R K +D +N P  ++FIFLL+++AGG
Sbjct: 440 IFSQMSRVLDILEDYCFFRGYKYCRIDGSTDHEDRIKSIDDYNAPDSDKFIFLLTTRAGG 499

Query: 735 CGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSM 794
            GINL  A+ ++L D DWNP AD QA+ R  R GQKK   ++RF+T  S+EEKI +R + 
Sbjct: 500 LGINLTSADIVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRFVTDNSVEEKILERATQ 559

Query: 795 KMSLSSCVVEE 805
           K+ L   V+++
Sbjct: 560 KLRLDQLVIQQ 570

>YOR304W (ISW2) [5088] chr15 (884510..887872) Protein required for
           Ume6p-dependent transcriptional repression of several
           meiotic genes, has chromatin remodeling activity, has
           strong similarity to Drosophila nucleosome remodeling
           factor ISWI (Imitator SWI) [3363 bp, 1120 aa]
          Length = 1120

 Score =  233 bits (595), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 151/484 (31%), Positives = 254/484 (52%), Gaps = 53/484 (10%)

Query: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
           I+ADEMGLGKTLQ I+ +  L        P     +I+ P S ++NW  E +KW  P+ +
Sbjct: 206 ILADEMGLGKTLQTISFLGYLRYVKQIEGP----FLIIVPKSTLDNWRREFLKW-TPN-V 259

Query: 387 SPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCKVGLML 446
           + L + G K + ++  + +++    I + R     VLI SYE + R    LK      ++
Sbjct: 260 NVLVLHGDKDTRAD--IVRNI----ILEARF---DVLITSYEMVIREKNALKRLAWQYIV 310

Query: 447 ADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFR 506
            DE HR+KN  S     +       R++++GTP+QN+L E +ALLNF  P + G    F 
Sbjct: 311 IDEAHRIKNEQSALSQIIRLFYSKNRLLITGTPLQNNLHELWALLNFLLPDIFGDSELFD 370

Query: 507 KNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHILFV 566
           + FE      ++    D+EI      + +L  +++ F++RR    + K L  K E  ++V
Sbjct: 371 EWFE------QNNSEQDQEIV-----IQQLHSVLNPFLLRRVKADVEKSLLPKIETNVYV 419

Query: 567 NLSPMQKAIYEHFVRSREVAKLMKGTGSQP-----LKAIGLLKKLCNHPDLLDLPDEIAG 621
            ++ MQ   Y+  +  +++  +    G +      L  +  L+K CNHP L +      G
Sbjct: 420 GMTDMQIQWYKSLL-EKDIDAVNGAVGKREGKTRLLNIVMQLRKCCNHPYLFE------G 472

Query: 622 STNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLISNYTQ 681
           +    P      +  N              S K  IL++ L ++K E   ++++ S  ++
Sbjct: 473 AEPGPPYTTDEHLIFN--------------SGKMIILDKLLKRLK-EKGSRVLIFSQMSR 517

Query: 682 TLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGINLIG 741
            LD++E  C +  +   R+DG+ +  +R + +D++N P+ E+F+FLL+++AGG GINL+ 
Sbjct: 518 LLDILEDYCYFRDFEYCRIDGSTSHEERIEAIDEYNKPNSEKFVFLLTTRAGGLGINLVT 577

Query: 742 ANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSC 801
           A+ +IL D DWNP AD QA+ R  R GQKK   +YRF+T  +IEEK+ +R + K+ L   
Sbjct: 578 ADTVILFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVIERAAQKLRLDQL 637

Query: 802 VVEE 805
           V+++
Sbjct: 638 VIQQ 641

>CAGL0I09614g 917707..920826 highly similar to tr|Q08773
           Saccharomyces cerevisiae YOR304w ISW2 or sp|P38144
           Saccharomyces cerevisiae YBR245c ISW1, hypothetical
           start
          Length = 1039

 Score =  229 bits (585), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 148/484 (30%), Positives = 248/484 (51%), Gaps = 53/484 (10%)

Query: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
           I+ADEMGLGKTLQ I+ +  L        P     +++ P S ++NW  E  KW  P+ +
Sbjct: 155 ILADEMGLGKTLQTISFLGYLRYVKKIEGP----FLVIVPKSTLDNWRREFFKW-TPN-V 208

Query: 387 SPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCKVGLML 446
           S   + G K         Q + Q  + + R     VLI SYE + R    LK      ++
Sbjct: 209 STTVLQGTKEQ------RQDILQNIVLEARF---DVLITSYEMVIREKGYLKRLAWEYIV 259

Query: 447 ADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFR 506
            DE HR+KN  S     +       R++++GTP+QN+L E +ALLNF  P + G    F 
Sbjct: 260 IDEAHRIKNEQSALSQIIRLFYSKNRLLITGTPLQNNLHELWALLNFLLPDVFGDSEVFD 319

Query: 507 KNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHILFV 566
             F+         + +D++    EV + +L  +++ F++RR    + K L  K E  ++V
Sbjct: 320 DWFQ--------QNNSDQD---QEVVVQQLHAVLNPFLLRRIKADVEKSLLPKIETNVYV 368

Query: 567 NLSPMQKAIYEHFVRSREVAKLMKGTGSQP-----LKAIGLLKKLCNHPDLLDLPDEIAG 621
            ++ MQ   Y+  +  +++  +    G +      L  +  L+K CNHP L +      G
Sbjct: 369 GMTDMQVQWYKSLL-EKDIDAVNGAVGKREGKTRLLNIVMQLRKCCNHPYLFE------G 421

Query: 622 STNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLISNYTQ 681
           +    P      +  N+               K  +L++ L ++K E   ++++ S  ++
Sbjct: 422 AEPGPPYTTDEHLIFNA--------------GKMIVLDKLLKRLK-EKGSRVLIFSQMSR 466

Query: 682 TLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGINLIG 741
            LD++E  C + +Y   R+DG+ +  +R   +D++N P+ E+F+FLL+++AGG GINL+ 
Sbjct: 467 LLDILEDYCYFRNYNYCRIDGSTSHEERIDAIDEYNKPNSEKFVFLLTTRAGGLGINLVT 526

Query: 742 ANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSC 801
           A+ ++L D DWNP AD QA+ R  R GQKK   +YRF+T  +IEEK+ +R + K+ L   
Sbjct: 527 ADTVVLFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVLERAAQKLRLDQL 586

Query: 802 VVEE 805
           V+++
Sbjct: 587 VIQQ 590

>Kwal_14.1600
          Length = 1102

 Score =  229 bits (584), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 150/492 (30%), Positives = 252/492 (51%), Gaps = 55/492 (11%)

Query: 320 NRGAYGCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVK 379
           +R     I+ADEMGLGKTLQ I+ +  L     +  P     +++ P S +NNW  EI +
Sbjct: 151 HRNNLAGILADEMGLGKTLQTISFLGYLRYVEKKPGP----FVVIAPKSTLNNWLREINR 206

Query: 380 WLGPDALSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKG 439
           W  PD +    + G K        A+ V    +A   ++V    + SYE + +   + K 
Sbjct: 207 W-TPD-VRAFILQGDKEER-----AKLVANKLMACDFDIV----VASYEIIIKEKASFKK 255

Query: 440 CKVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLL 499
                ++ DE HR+KN +S+    L       R++++GTP+QN+L E +ALLNF  P + 
Sbjct: 256 IAWEYIVIDEAHRIKNEESMLSQVLREFTSRNRLLITGTPLQNNLHELWALLNFLLPDVF 315

Query: 500 GTRAQFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRR-TNDILSKYLPC 558
                F   F        ++   DK    G++ + +L  ++  F++RR  N++ +  LP 
Sbjct: 316 SDSQAFDDWF------SSESSEDDK----GKI-VKQLHTVLQPFLLRRLKNEVETSLLPK 364

Query: 559 KYEHILFVNLSPMQKAIYEHFVRSREVAKLMKGTGSQP-----LKAIGLLKKLCNHPDLL 613
           K E  L++ +S MQK  Y+  +  +++  +    G++      L  +  L+K CNHP L 
Sbjct: 365 K-ELNLYIGMSSMQKRWYKQIL-EKDIDAVNGANGNKESKTRLLNVMMQLRKCCNHPYLF 422

Query: 614 DLPDEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKI 673
           D      G+    P      + +NS              +K  +L++ L K K E + ++
Sbjct: 423 D------GAEPGPPYTTDEHLVYNS--------------AKLKVLDKLLRKFKEEGS-RV 461

Query: 674 VLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAG 733
           ++ S  ++ LD++E  C +  Y   R+DG+     R + +D++N P  ++F+FLL+++AG
Sbjct: 462 LIFSQMSRVLDILEDYCFFRQYEYCRIDGSTAHEDRIEAIDEYNAPDSKKFVFLLTTRAG 521

Query: 734 GCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPS 793
           G GINL  A+ ++L D DWNP AD QA+ R  R GQKK   ++R +T  S+EEKI +R +
Sbjct: 522 GLGINLTTADIVVLYDSDWNPQADLQAMDRAHRIGQKKQVRVFRLVTDNSVEEKILERAT 581

Query: 794 MKMSLSSCVVEE 805
            K+ L   V+++
Sbjct: 582 QKLRLDQLVIQQ 593

>YER164W (CHD1) [1592] chr5 (505387..509793) Protein involved in
           ATP-dependent nucleosome remodeling activity, member of
           the Chromodomain-Helicase-DNA-binding (CHD) family [4407
           bp, 1468 aa]
          Length = 1468

 Score =  230 bits (586), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 159/487 (32%), Positives = 249/487 (51%), Gaps = 50/487 (10%)

Query: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
           I+ADEMGLGKT+Q +A +  L+    Q  P     IIV P S +  W +   KW  PD L
Sbjct: 398 ILADEMGLGKTVQTVAFISWLIFARRQNGP----HIIVVPLSTMPAWLDTFEKW-APD-L 451

Query: 387 SPLAIDGRKSSLSNGSVAQSVRQWAI-----AQGRNVVK-PVLIISYETLRRNVENLKGC 440
           + +   G + S        ++R++       A+G+  +K  VL+ +YE + ++   L   
Sbjct: 452 NCICYMGNQKS------RDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKDRAELGSI 505

Query: 441 KVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLG 500
           K   M  DE HRLKN +S  + SL+S     R++++GTP+QN++ E  AL+NF  PG   
Sbjct: 506 KWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPG--- 562

Query: 501 TRAQFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKY 560
              +F  + EI      D +  D+E    E  +H+L + +  FI+RR    + K LP K 
Sbjct: 563 ---RFTIDQEI------DFENQDEE---QEEYIHDLHRRIQPFILRRLKKDVEKSLPSKT 610

Query: 561 EHILFVNLSPMQKAIYEHFVRSREVAKLM--KGTGSQPLKAIGLLKKLCNHPDLLDLPDE 618
           E IL V LS +Q   Y++ +     A     KG     L  +  LKK  NHP L D  +E
Sbjct: 611 ERILRVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMNELKKASNHPYLFDNAEE 670

Query: 619 IAGSTNLIPDDYQSAMTHNS--RGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLI 676
                 ++       MT  +  RG           S K  +L++ L ++K + + ++++ 
Sbjct: 671 -----RVLQKFGDGKMTRENVLRG-------LIMSSGKMVLLDQLLTRLKKDGH-RVLIF 717

Query: 677 SNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCG 736
           S   + LD++            RLDGT+   +R+  +D FN P   +F+FLLS++AGG G
Sbjct: 718 SQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLG 777

Query: 737 INLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKM 796
           INL+ A+ +++ D DWNP AD QA+AR  R GQK    +YR ++  ++EE++ +R   KM
Sbjct: 778 INLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKM 837

Query: 797 SLSSCVV 803
            L   ++
Sbjct: 838 ILEYAII 844

>CAGL0M04807g complement(514847..520039) similar to sp|P22082
            Saccharomyces cerevisiae YOR290c SNF2 or sp|P32597
            Saccharomyces cerevisiae YIL126w STH1, hypothetical start
          Length = 1730

 Score =  230 bits (586), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 156/488 (31%), Positives = 246/488 (50%), Gaps = 49/488 (10%)

Query: 327  IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
            I+ADEMGLGKT+Q I+L+  L    +   P     +I+ P S + NW++E  KW      
Sbjct: 824  ILADEMGLGKTIQTISLLTYLYEMKNIKGP----FLIIVPLSTLPNWSSEFAKW------ 873

Query: 387  SPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCKVGLML 446
               A   R  S       + ++Q  I  G       +I ++E + +    L   K   M+
Sbjct: 874  ---APKLRTISYKGSPNERKMKQAQIKSGE---FDAVITTFEYIIKERAILSKVKWVHMI 927

Query: 447  ADEGHRLKNGDSLTFTSLDSI-NCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQF 505
             DEGHR+KN  S    +L++  +   R+IL+GTP+QN+L E +ALLNF  P +  +   F
Sbjct: 928  IDEGHRMKNAQSKLSLTLNTFYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSAKSF 987

Query: 506  RKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHILF 565
             + F  P       D  +       + +  L +++  F++RR    + K LP K E ++ 
Sbjct: 988  DEWFNTPFANTGGQDKIELSEEETLLIIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVIK 1047

Query: 566  VNLSPMQKAIYEHFVRSREV-------AKL--MKGTGSQPLKAIGLLKKLCNHPDLLDLP 616
              +S +Q A+Y+  ++ +++        KL  ++G  +Q ++    LKK+CNHP + +  
Sbjct: 1048 CKMSALQHAMYQQMLKHKQLFIGDQKKNKLVGLRGFNNQLMQ----LKKICNHPFVFE-- 1101

Query: 617  DEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLI 676
             E+    N   D   + M      G            KF +LER L K+K  S  ++++ 
Sbjct: 1102 -EVEDHINPTRD---TNMNIWRVAG------------KFELLERILPKLK-ASRHRVLIF 1144

Query: 677  SNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCG 736
               TQ +D++E   RY     LRLDG    ++R +L+  FNDP+ E F F+LS++AGG G
Sbjct: 1145 FQMTQIMDIMEDFLRYIDIKYLRLDGHTRSDERGELLKLFNDPNSEYFCFILSTRAGGLG 1204

Query: 737  INLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKM 796
            +NL  A+ +I+ D DWNP  D QA  R  R GQK +  I R ITT S+EE I +R   K+
Sbjct: 1205 LNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRIIRLITTNSVEEVILERAYKKL 1264

Query: 797  SLSSCVVE 804
             +   V++
Sbjct: 1265 DIDGKVIQ 1272

>KLLA0F24838g complement(2309842..2313030) similar to sgd|S0005831
           Saccharomyces cerevisiae YOR304w ISW2, hypothetical
           start
          Length = 1062

 Score =  227 bits (579), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 153/488 (31%), Positives = 248/488 (50%), Gaps = 61/488 (12%)

Query: 327 IMADEMGLGKTLQCIALMWTL-LRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDA 385
           I+ADEMGLGKTLQ I+ +  L   +G +G       I++ P S ++NW  E  KW  P+ 
Sbjct: 158 ILADEMGLGKTLQSISFLGYLRYIKGIEG-----PYIVIVPKSTLDNWQREFAKW-TPEV 211

Query: 386 LSPLA---IDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCKV 442
            + +     D RK  +    +  +               VLI SYE + +    LK    
Sbjct: 212 KTVILQGDKDFRKELIETKILTCNF-------------DVLITSYEMVLKEKLTLKRFAW 258

Query: 443 GLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTR 502
             +L DE HR+KN  S     +       R++++GTP+QN+L E +ALLNF  P + G  
Sbjct: 259 EYILIDEAHRIKNEQSALSQVIRLFYSKNRLLITGTPLQNNLHELWALLNFLLPDVFGDS 318

Query: 503 AQFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEH 562
             F + F+     G++ D         EV + +L  ++  F++RR    + K L  K E 
Sbjct: 319 EVFDEWFQ---QNGKEEDQ--------EVVVQQLHSVLQPFLLRRVKSEVEKSLLPKKEI 367

Query: 563 ILFVNLSPMQKAIYEHFVRSREVAKLMKGTGSQP-----LKAIGLLKKLCNHPDLLDLPD 617
            L+V ++ MQ   Y+  +  +++  +    G +      L  +  L+K CNHP L +   
Sbjct: 368 NLYVGMTDMQIEWYKSLL-EKDIDAVNGAVGKREGKTRLLNIVMQLRKCCNHPYLFE--- 423

Query: 618 EIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLIS 677
              G+    P      +  N              S K  +L++ L K K E   ++++ S
Sbjct: 424 ---GAEPGPPYTTDEHLVFN--------------SGKMIVLDK-LLKKKKEQGSRVLIFS 465

Query: 678 NYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGI 737
             ++ LD++E  C +  Y   R+DG+ + ++R + +D++N P+ E+FIFLL+++AGG GI
Sbjct: 466 QMSRLLDILEDYCYFRGYEYCRIDGSTSHDERVEAIDEYNKPNSEKFIFLLTTRAGGLGI 525

Query: 738 NLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMS 797
           NL+ A+ ++L D DWNP AD QA+ R  R GQKK  F+YRF+T  +IEEK+ +R + K+ 
Sbjct: 526 NLVTADTVVLYDSDWNPQADLQAMDRAHRIGQKKQVFVYRFVTENAIEEKVIERAAQKLR 585

Query: 798 LSSCVVEE 805
           L   V+++
Sbjct: 586 LDQLVIQQ 593

>KLLA0E23804g 2108059..2113680 similar to sp|P32333 Saccharomyces
            cerevisiae YPL082c MOT1 transcriptional accessory
            protein, start by similarity
          Length = 1873

 Score =  228 bits (582), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 168/543 (30%), Positives = 267/543 (49%), Gaps = 63/543 (11%)

Query: 320  NRGAYGCIMADEMGLGKTLQCIALMWT--LLRQGSQGRPTIEKC-----IIVCPSSLVNN 372
            N+     I+ D+MGLGKTLQ I ++ +   LR     +   EK      +I+CP SL  +
Sbjct: 1302 NKYHLHGILCDDMGLGKTLQTICIIASDQYLRSEDYKKTQSEKTRPLPSLIICPPSLTGH 1361

Query: 373  WANEIVKWLGPDALSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRR 432
            W  E  ++  P  L+ L   G            SVR     QG+     +++ SY+  R 
Sbjct: 1362 WEQEFQQY-SP-TLNVLVYAG----------GPSVR--YPLQGQVPTADIVVTSYDVARN 1407

Query: 433  NVENLKGCKVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLN 492
            +V+ LK       + DEGH +KN  S    ++  IN   R++L+GTPIQN++ E ++L +
Sbjct: 1408 DVDFLKKYDYNYCVLDEGHIIKNSQSKLAKAVKLINSNHRLVLTGTPIQNNVVELWSLFD 1467

Query: 493  FSNPGLLGTRAQFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDIL 552
            F  PG LGT   F++ F  PI   R++  + KE  AG + L  L + V  F++RR  + +
Sbjct: 1468 FLMPGFLGTEKMFQERFAKPIASSRNSKTSSKEQEAGALALEALHKQVLPFMLRRLKEEV 1527

Query: 553  SKYLPCKYEHILFVNLSPMQKAIYEHFVRSRE--VAKLMKGTG-----SQPLKAIGLLKK 605
               LP K     +  LS +QK +Y  FV+ ++  V K ++ T          +A+  ++K
Sbjct: 1528 LSDLPPKIIQDYYCELSDLQKQLYNDFVKKQKNVVEKDIENTAEVENKQHIFQALQYMRK 1587

Query: 606  LCNHPDLLDLPDEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFK- 664
            LCNHP L+          N     +Q   ++ S+ G    ++   H+ K   L+  L + 
Sbjct: 1588 LCNHPSLV---------LNSSHPQFQQVQSYLSQTGMDLHDI--GHAPKLEALKTLLLEC 1636

Query: 665  ------IKHESND-----------KIVLISNYTQTLDLIEKMCRYNHY---GVLRLDGTM 704
                  ++ +SN            ++++       LD++E      H      +RLDG++
Sbjct: 1637 GIGIQDVEKKSNKNPSIDNVISQHRVLIFCQLKDMLDMVENDLLKKHLPSVTFMRLDGSV 1696

Query: 705  TINKRQKLVDKFN-DPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALAR 763
                RQK+V KFN DPS +    LL++K GG G+NL GA+ +I ++ DWNP  D QA+ R
Sbjct: 1697 DSRDRQKVVRKFNEDPSID--CLLLTTKVGGLGLNLTGADTVIFVEHDWNPMNDLQAMDR 1754

Query: 764  VWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVEEKEDVERLFSSENLRPLFQ 823
              R GQKK   +YR IT G++EEKI      KM+++S +V ++       ++  L  LF 
Sbjct: 1755 AHRLGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIASTIVNQQNAGLGSMNTHQLLDLFD 1814

Query: 824  FDS 826
             D+
Sbjct: 1815 ADN 1817

>Kwal_26.9164
          Length = 1454

 Score =  226 bits (575), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 160/490 (32%), Positives = 247/490 (50%), Gaps = 53/490 (10%)

Query: 327  IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
            I+ADEMGLGKT+Q I+L+  L    +   P++    ++ P S + NW +E  KW      
Sbjct: 624  ILADEMGLGKTIQTISLLTYLYEVKNVRGPSL----VIVPLSTLTNWDSEFDKW------ 673

Query: 387  SPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCKVGLML 446
            +P+    RK +       +  +Q  I  G+     V++ ++E + +    L   K   M+
Sbjct: 674  APVI---RKVAYKGSPNERKSKQGIIRSGQF---DVVLTTFEYIIKERALLSKIKWVHMI 727

Query: 447  ADEGHRLKNGDS-LTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQF 505
             DEGHR+KN  S L+ T  +  +   R+IL+GTP+QN+L E +ALLNF  P +  +   F
Sbjct: 728  IDEGHRMKNAQSKLSLTLNNYYHTDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSF 787

Query: 506  RKNFEIPILR--GRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHI 563
             + F  P     G+D  A  +E     + +  L +++  F++RR    + K LP K E +
Sbjct: 788  DEWFNTPFANTGGQDKIALSEEETL--LVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKV 845

Query: 564  LFVNLSPMQKAIYEHFVRSRE--VAKL-------MKGTGSQPLKAIGLLKKLCNHPDLLD 614
            L   +S +Q+ +YE  ++ R   +  L       M+G  +Q    I  LKK+CNHP + +
Sbjct: 846  LKCKMSALQQKLYEQMLKHRRLFIGDLNSNKNVGMRGFNNQ----IMQLKKICNHPFVFE 901

Query: 615  LPDEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIV 674
               E+    N  P    +A      G             KF +LER L K K  +  +I+
Sbjct: 902  ---EVEDQIN--PTRETNANIWRVAG-------------KFELLERILPKFK-ATGHRIL 942

Query: 675  LISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGG 734
            +    TQ +D++E   R ++   LRLDG    + R  L++ FN P+ E F FLLS++AGG
Sbjct: 943  IFFQMTQIMDIMEDFLRLSNMKYLRLDGHTKSDDRTLLLNLFNAPNSEYFCFLLSTRAGG 1002

Query: 735  CGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSM 794
             G+NL  A+ +I+ D DWNP  D QA  R  R GQK +  I R IT  S+EE I  R   
Sbjct: 1003 LGLNLQSADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITENSVEEVILDRAHK 1062

Query: 795  KMSLSSCVVE 804
            K+ +   V++
Sbjct: 1063 KLDIDGKVIQ 1072

>Kwal_56.23442
          Length = 1435

 Score =  226 bits (575), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 155/492 (31%), Positives = 243/492 (49%), Gaps = 60/492 (12%)

Query: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
           I+ADEMGLGKT+Q +A +  L+    Q  P     ++V P S +  W     KW  PD L
Sbjct: 379 ILADEMGLGKTVQTVAFISWLIYARRQNGP----HLVVVPLSTMPAWQETFEKW-APD-L 432

Query: 387 SPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKP-----------VLIISYETLRRNVE 435
           + +   G + S             AI +G     P           VL+ +YE + ++  
Sbjct: 433 NCIYFVGNQKSRD-----------AIREGEFFTNPQAKTKKHAKFNVLLTTYEYILKDRA 481

Query: 436 NLKGCKVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSN 495
            L   K   +  DE HRLKN +S  + SL+S     R++++GTP+QN++ E  AL+NF  
Sbjct: 482 ELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLM 541

Query: 496 PGLLGTRAQFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKY 555
           PG      +F  + EI           + + A  E  + +L   +  FI+RR    + K 
Sbjct: 542 PG------RFTIDQEIDF---------ENQDAEQETYIRDLHSRLQPFILRRLKKDVEKS 586

Query: 556 LPCKYEHILFVNLSPMQKAIYEHFVRSREVAKLM---KGTGSQPLKAIGLLKKLCNHPDL 612
           LP K E IL V LS +Q   Y++ + ++  + L    KG     L  +  LKK  NHP L
Sbjct: 587 LPSKTERILRVELSDVQTDYYKNIL-TKNYSALSAGSKGAHFSLLNIMNELKKASNHPYL 645

Query: 613 LDLPDEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSS-KFAILERFLFKIKHESND 671
            D+ +           D   A   + R  R ++      SS K  +L++ L ++K + + 
Sbjct: 646 FDMAE-----------DRVLAKFGDGRMSRENILRGLIMSSGKMVLLDQLLTRLKKDGH- 693

Query: 672 KIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSK 731
           ++++ S   + LD++            RLDGT+   +R+  +D FN P   +F+FLLS++
Sbjct: 694 RVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTR 753

Query: 732 AGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQR 791
           AGG GINL+ A+ +I+ D DWNP AD QA+AR  R GQK    +YRF++  ++EE++ +R
Sbjct: 754 AGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLER 813

Query: 792 PSMKMSLSSCVV 803
              KM L   ++
Sbjct: 814 ARKKMILEYAII 825

>Scas_662.7
          Length = 1342

 Score =  225 bits (574), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 152/488 (31%), Positives = 238/488 (48%), Gaps = 48/488 (9%)

Query: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
           I+ADEMGLGKT+Q I+L+  L  +     P     +++ P S + NW  E  KW  P +L
Sbjct: 483 ILADEMGLGKTIQSISLITYLFEEKKDPGP----YLVIVPLSTITNWTLEFEKW-AP-SL 536

Query: 387 SPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCKVGLML 446
           + +   G  +   N  +   VR             VL+ +YE + ++   L   +   M+
Sbjct: 537 NTVIYKGTPNQRRN--LQHQVRIGNF--------DVLLTTYEYIIKDRALLAKHEWTHMI 586

Query: 447 ADEGHRLKNGDS-LTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQF 505
            DEGHR+KN  S L++T         R+IL+GTP+QN+L E +ALLNF  P +  +   F
Sbjct: 587 IDEGHRMKNAQSKLSYTITHYYKTRHRLILTGTPLQNNLPELWALLNFVLPKIFNSAKTF 646

Query: 506 RKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHILF 565
              F  P       +  +       + +  L +++  F++RR    + K LP K E ++ 
Sbjct: 647 EDWFNTPFANTGTGEKLELTEEETLLVIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVVK 706

Query: 566 VNLSPMQKAIYEHFVRSREVAKLMKGTGSQPLKAIGL---------LKKLCNHPDLLDLP 616
             LS +Q+ +YE  ++      L  G G++     G+         L+K+CNHP + D  
Sbjct: 707 CKLSGLQQQLYEQMLKHN---ALFLGEGTEGATKSGIKGLNNKIMQLRKICNHPFVFD-- 761

Query: 617 DEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLI 676
            E+ G  N  P    S + +   G             KF +L R L K K  +  ++++ 
Sbjct: 762 -EVEGVIN--PTRANSNLLYRVSG-------------KFELLNRVLPKFK-AAGHRVLMF 804

Query: 677 SNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCG 736
              TQ +D++E   R      +RLDG+   + R  +++ FN P  + F FLLS++AGG G
Sbjct: 805 FQMTQVMDIMEDFLRMKDLKYMRLDGSTKADDRTGMLNDFNAPDSDYFCFLLSTRAGGLG 864

Query: 737 INLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKM 796
           +NL  A+ +I+ D DWNP  D QA  R  R GQK +  I R ITT S+EE I +R   K+
Sbjct: 865 LNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKL 924

Query: 797 SLSSCVVE 804
            +   V++
Sbjct: 925 DIDGKVIQ 932

>Kwal_23.4777
          Length = 1301

 Score =  225 bits (573), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 153/488 (31%), Positives = 237/488 (48%), Gaps = 48/488 (9%)

Query: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
           I+ADEMGLGKT+Q I+L+  L    ++  P     +++ P S + NW  E  KW  P +L
Sbjct: 478 ILADEMGLGKTIQSISLITYLRETKNEPGP----FLVIVPLSTITNWTLEFEKW-AP-SL 531

Query: 387 SPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCKVGLML 446
           + +   G  +     S+   +R             VL+ +YE + ++   L       M+
Sbjct: 532 ATIVYKGTPNQ--RKSMQHQIRIGNFE--------VLLTTYEYIIKDRSLLAKHDWSHMI 581

Query: 447 ADEGHRLKNGDS-LTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQF 505
            DEGHR+KN  S L+FT         R+IL+GTP+QN+L E +ALLNF  P +  +   F
Sbjct: 582 IDEGHRMKNAQSKLSFTLTRYYRTRNRLILTGTPLQNNLPELWALLNFVLPKIFNSAKTF 641

Query: 506 RKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHILF 565
            + F  P       +  +       + +  L +++  F++RR    + K LP K E ++ 
Sbjct: 642 DEWFNTPFANTGGQEKLELTEEETLLVIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVVK 701

Query: 566 VNLSPMQKAIYEHFVRSREVAKLMKGTGSQPLKAIGL---------LKKLCNHPDLLDLP 616
             LS +Q  +Y+  ++      L  G G++     G+         L+K+CNHP + D  
Sbjct: 702 CKLSGLQHQLYQQMLKHN---ALFFGAGTEGATKGGIKGLNNKIMQLRKICNHPFVFD-- 756

Query: 617 DEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLI 676
            E+ G  N  P    S + +   G             KF +L+R L K K  +  ++++ 
Sbjct: 757 -EVEGIIN--PSRANSPLLYRVAG-------------KFELLDRILLKFKV-TGHRVLMF 799

Query: 677 SNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCG 736
              TQ +D++E   R      LRLDG      R  ++  FN P+ E F FLLS++AGG G
Sbjct: 800 FQMTQVMDIMEDFLRMRGLKYLRLDGATKTEDRTGMLKLFNAPNSEYFCFLLSTRAGGLG 859

Query: 737 INLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKM 796
           +NL  A+ +I+ D DWNP  D QA  R  R GQK +  I R ITT S+EE I +R   K+
Sbjct: 860 LNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERALQKL 919

Query: 797 SLSSCVVE 804
            +   V++
Sbjct: 920 DIDGKVIQ 927

>KLLA0F04521g complement(435649..439683) similar to sp|P32597
            Saccharomyces cerevisiae YIL126w STH1 subunit of the RSC
            complex, start by similarity
          Length = 1344

 Score =  225 bits (573), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 158/521 (30%), Positives = 245/521 (47%), Gaps = 55/521 (10%)

Query: 327  IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
            I+ADEMGLGKT+Q I+L+  L    ++ +P     +++ P S + NW  E  KW  P +L
Sbjct: 535  ILADEMGLGKTIQSISLISYLYEIKNERQP----FLVIVPLSTITNWTIEFEKW-AP-SL 588

Query: 387  SPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCKVGLML 446
              +   G  +        +   Q  I  G      V++ +YE + ++   L       M+
Sbjct: 589  RTIVYKGNPNQ-------RKALQHTIKMGNF---DVVLTTYEYIIKDRPLLAKHDWAHMI 638

Query: 447  ADEGHRLKNGDS-LTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQF 505
             DEGHR+KN  S L++T         R+IL+GTP+QN+L E +ALLNF  P +  +   F
Sbjct: 639  IDEGHRMKNAQSKLSYTLTHYYKTKNRLILTGTPLQNNLPELWALLNFVLPKIFNSSKTF 698

Query: 506  RKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHILF 565
             + F  P       +  +       + +  L +++  F++RR    + K LP K E ++ 
Sbjct: 699  DEWFNTPFANTGTQEKLEMTEEETLLVIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVVK 758

Query: 566  VNLSPMQKAIYEHFVRSREVAKLMKGTGSQPLKAIGL---------LKKLCNHPDLLDLP 616
              LS +Q+ +YE  ++         G G++     G+         L+K+CNHP + D  
Sbjct: 759  CKLSSLQQQLYEQMLKHN---AFFIGAGTEGATKAGIKGLNNKVMQLRKICNHPFVFDEV 815

Query: 617  DEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLI 676
            + +   T                  R +  +    S KF +L+R L K K  S  ++++ 
Sbjct: 816  ENVINPT------------------RENSSILYRVSGKFELLDRVLPKFKA-SGHRVLMF 856

Query: 677  SNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCG 736
               TQ +D++E   R      +RLDG      R  ++  FN P  E F FLLS++AGG G
Sbjct: 857  FQMTQVMDIMEDFLRMRDLKYMRLDGGTKAEDRTGMLKLFNAPDSEYFCFLLSTRAGGLG 916

Query: 737  INLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKM 796
            +NL  A+ +I+ D DWNP  D QA  R  R GQK +  I R ITT S+EE I +R   K+
Sbjct: 917  LNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKL 976

Query: 797  SLSSCVVE-----EKEDVERLFSSENLRPLFQFDSNTHMRY 832
             +   V++      K   E     E LR L + D+N    Y
Sbjct: 977  DIDGKVIQAGKFDNKSTAEE--QEEFLRRLLEGDTNKDDEY 1015

>Scas_597.8
          Length = 1065

 Score =  224 bits (570), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 151/495 (30%), Positives = 246/495 (49%), Gaps = 61/495 (12%)

Query: 320 NRGAYGCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKC----IIVCPSSLVNNWAN 375
           ++     I+ADEMGLGKTLQ I+ +  L          +EK     +++ P S +NNW  
Sbjct: 147 HKSKLAGILADEMGLGKTLQTISFLGYL--------RYVEKIPGPFLVIAPKSTLNNWLR 198

Query: 376 EIVKWLGPDALSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVE 435
           EI KW  P+ ++   + G K        AQ V+   +A   ++V    + SYE + R   
Sbjct: 199 EINKW-TPE-VNAFILQGDKEER-----AQLVKDKLLACDFDIV----VASYEIIIREKS 247

Query: 436 NLKGCKVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSN 495
             +      ++ DE HR+KN +SL    L       R++++GTP+QN+L E +ALLNF  
Sbjct: 248 AFRKIDWQYIIIDEAHRIKNEESLLSQVLREFTSSNRLLITGTPLQNNLHELWALLNFLL 307

Query: 496 PGLLGTRAQFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRR-TNDILSK 554
           P +      F   F         +  T +E     VK  +L  ++  F++RR  ND+ + 
Sbjct: 308 PDIFSDSQDFDDWF---------SSETTEEDQEKVVK--QLHTVLQPFLLRRLKNDVETS 356

Query: 555 YLPCKYEHILFVNLSPMQKAIYEHF----VRSREVAKLMKGTGSQPLKAIGLLKKLCNHP 610
            LP K E  L+V +S MQK  Y+      + +   + + K + ++ L  +  L+K CNHP
Sbjct: 357 LLP-KQELNLYVGMSNMQKKWYKQILEKDIDAVNGSNVNKESKTRLLNIVMQLRKCCNHP 415

Query: 611 DLLDLPDEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESN 670
            L D      G+    P      + +NS   +   ++                    E  
Sbjct: 416 YLFD------GAEPGPPYTTDEHLVYNSAKLKVLDKLLKKMK---------------EEG 454

Query: 671 DKIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSS 730
            ++++ S  ++ LD++E  C +  Y   R+DG+     R + +D++N+P  ++FIFLL++
Sbjct: 455 SRVLIFSQMSRVLDILEDYCFFRGYEYCRIDGSTDHEDRIRAIDEYNEPGSKKFIFLLTT 514

Query: 731 KAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQ 790
           +AGG GINL  AN ++L D DWNP AD QA+ R  R GQK+   ++R +T  S+EEKI +
Sbjct: 515 RAGGLGINLTSANIVVLFDSDWNPQADLQAMDRAHRIGQKRQVKVFRLVTDNSVEEKILE 574

Query: 791 RPSMKMSLSSCVVEE 805
           R + K+ L   V+++
Sbjct: 575 RATQKLRLDQLVIQQ 589

>YOR290C (SNF2) [5074] chr15 complement(855144..860255) Component of
            SWI-SNF global transcription activator complex, acts to
            assist gene-specific activators through chromatin
            remodeling, involved in sensitivity to UV irradiation
            [5112 bp, 1703 aa]
          Length = 1703

 Score =  224 bits (571), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 151/488 (30%), Positives = 240/488 (49%), Gaps = 49/488 (10%)

Query: 327  IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
            I+ADEMGLGKT+Q I+L+  L    +   P     +++ P S ++NW++E  KW      
Sbjct: 789  ILADEMGLGKTIQTISLLTYLYEMKNIRGP----YLVIVPLSTLSNWSSEFAKW------ 838

Query: 387  SPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCKVGLML 446
               A   R  S       +  +Q  I  G      V++ ++E + +    L   K   M+
Sbjct: 839  ---APTLRTISFKGSPNERKAKQAKIRAGE---FDVVLTTFEYIIKERALLSKVKWVHMI 892

Query: 447  ADEGHRLKNGDS-LTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQF 505
             DEGHR+KN  S L+ T     +   R+IL+GTP+QN+L E +ALLNF  P +  +   F
Sbjct: 893  IDEGHRMKNAQSKLSLTLNTHYHADYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSF 952

Query: 506  RKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHILF 565
             + F  P       D  +       + +  L +++  F++RR    + K LP K E ++ 
Sbjct: 953  DEWFNTPFANTGGQDKIELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVVK 1012

Query: 566  VNLSPMQKAIYEHFVRSREVAKLMKGTGSQPLKAIGL---------LKKLCNHPDLLDLP 616
              +S +Q+ +Y+  ++ R   +L  G  +   K +GL         LKK+CNHP + +  
Sbjct: 1013 CKMSALQQIMYQQMLKYR---RLFIGDQNNK-KMVGLRGFNNQIMQLKKICNHPFVFEEV 1068

Query: 617  DEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLI 676
            ++    T    DD                      + KF +L+R L K+K  +  ++++ 
Sbjct: 1069 EDQINPTRETNDDIWRV------------------AGKFELLDRILPKLK-ATGHRVLIF 1109

Query: 677  SNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCG 736
               TQ +D++E   RY +   LRLDG    ++R +L+  FN P  E   F+LS++AGG G
Sbjct: 1110 FQMTQIMDIMEDFLRYINIKYLRLDGHTKSDERSELLRLFNAPDSEYLCFILSTRAGGLG 1169

Query: 737  INLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKM 796
            +NL  A+ +I+ D DWNP  D QA  R  R GQK +  I R ITT S+EE I +R   K+
Sbjct: 1170 LNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTNSVEEVILERAYKKL 1229

Query: 797  SLSSCVVE 804
             +   V++
Sbjct: 1230 DIDGKVIQ 1237

>Kwal_34.15925
          Length = 1025

 Score =  223 bits (567), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 153/488 (31%), Positives = 248/488 (50%), Gaps = 61/488 (12%)

Query: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
           I+ADEMGLGKTLQ IA +  L        P I    ++ P S +NNW  E  KW  P+ +
Sbjct: 151 ILADEMGLGKTLQTIAFLGYLRYLKDIDGPHI----VIVPKSTLNNWKREFSKW-TPE-V 204

Query: 387 SPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKP----VLIISYETLRRNVENLKGCKV 442
             + + G K            RQ  +   +++V      VLI SYE + +    LK    
Sbjct: 205 EAVVLSGDKEE----------RQHLL---KDIVLECKFDVLITSYEMVIKEKSTLKRFMW 251

Query: 443 GLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTR 502
             ++ DE HR+KN  S     +   +   R++++GTP+QN+L E +ALLNF  P + G  
Sbjct: 252 QYIIVDEAHRIKNEQSTLSQIIRLFHSKSRLLITGTPLQNNLHELWALLNFLLPDVFGDS 311

Query: 503 AQFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEH 562
             F + FE           T+K+    +V + +L  ++S F++RR    +   L  K E 
Sbjct: 312 DAFDRWFE--------QSDTEKD---QDVVVQQLHTVLSPFLLRRLKSEVETSLLPKIET 360

Query: 563 ILFVNLSPMQKAIYEHFVRSREVAKLMKGTGSQP-----LKAIGLLKKLCNHPDLLDLPD 617
            L+V ++ MQ   Y+  +  +++  +    G +      L  +  L+K CNHP L +   
Sbjct: 361 NLYVGMTDMQVQWYKSLL-EKDLDAVNGAIGKREGNTRLLNIVMQLRKCCNHPYLFE--- 416

Query: 618 EIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLIS 677
              G+    P      +  N+               K  +L++ L K K E+  ++++ S
Sbjct: 417 ---GAEPGPPYTTDEHLIFNA--------------GKMIVLDKLL-KKKKEAGSRVLIFS 458

Query: 678 NYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGI 737
             ++ LD++E  C +  Y   R+DG+    +R + +D+FN+P  E+FIFLL+++AGG GI
Sbjct: 459 QMSRLLDILEDYCFFRDYDYCRIDGSTAHEERIEAIDQFNEPGSEKFIFLLTTRAGGLGI 518

Query: 738 NLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMS 797
           NL+ A+ +++ D DWNP AD QA+ R  R GQKK   +YRF+T  +IEEK+ +R + K+ 
Sbjct: 519 NLVTADTVVIYDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVIERAAQKLR 578

Query: 798 LSSCVVEE 805
           L   V+++
Sbjct: 579 LDQLVIQQ 586

>CAGL0L11770g 1254125..1258555 highly similar to sp|P32657
           Saccharomyces cerevisiae YER164w CHD1 transcriptional
           regulator, start by similarity
          Length = 1476

 Score =  223 bits (569), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 150/487 (30%), Positives = 247/487 (50%), Gaps = 50/487 (10%)

Query: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
           I+ADEMGLGKT+Q +A +  L+    Q  P     ++V P S +  W     KW  PD  
Sbjct: 413 ILADEMGLGKTVQTVAFISWLIFARRQNGP----HLVVVPLSTMPAWIETFEKW-APDID 467

Query: 387 SPLAIDGRKSSLSNGSVAQSVRQWAIAQGR---NVVKPVLIISYETLRRNVENLKGCKVG 443
               +  +KS      + +    ++  +G+    +   VL+ +YE + ++   L   K  
Sbjct: 468 VICYMGNQKSR----DIEREYEFYSNPKGKGKKQIKFNVLMTTYEYILKDRAELGSIKWQ 523

Query: 444 LMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRA 503
            +  DE HRLKN +S  + SL+S     R++++GTP+QN++ E  AL+NF  PG      
Sbjct: 524 FLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPG------ 577

Query: 504 QFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHI 563
           +F  + EI      D +  D+E    E  + +L + +  FI+RR    + K LP K E I
Sbjct: 578 RFTIDQEI------DFENQDEE---QEQYIRDLHKRLQPFILRRLKKDVEKSLPSKTERI 628

Query: 564 LFVNLSPMQKAIYEHFVRSREVAKLM---KGTGSQPLKAIGLLKKLCNHPDLLDLPDEIA 620
           L V LS +Q   Y++ + ++  + L    KG     L  +  L K  NHP L D  +E  
Sbjct: 629 LRVELSDVQTEYYKNIL-TKNYSALTAGAKGGRFSMLNIMNTLMKASNHPYLFDSAEEKV 687

Query: 621 ----GSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLI 676
               G+ N+  ++    +  +S               K  +L++ L ++K + + ++++ 
Sbjct: 688 LEKFGAGNMSRENILRGLIMSS--------------GKMVLLDKLLTRLKKDGH-RVLIF 732

Query: 677 SNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCG 736
           S   + LD++            RLDGT+  N+R+  +D FN P  ++F+FLLS++AGG G
Sbjct: 733 SQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLG 792

Query: 737 INLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKM 796
           INL+ A+ +I+ D DWNP AD QA+AR  R GQK    +YR ++  ++EE++ +R   KM
Sbjct: 793 INLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKM 852

Query: 797 SLSSCVV 803
            L   ++
Sbjct: 853 ILEYAII 859

>AER375C [2876] [Homologous to ScYIL126W (STH1) - SH]
           (1332505..1336371) [3867 bp, 1288 aa]
          Length = 1288

 Score =  223 bits (567), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 150/488 (30%), Positives = 239/488 (48%), Gaps = 48/488 (9%)

Query: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
           I+ADEMGLGKT+Q I+L+  L        P     +++ P S + NW  E  KW  P +L
Sbjct: 479 ILADEMGLGKTIQSISLITYLYEVKKDSGP----FLVIVPLSTITNWTLEFEKW-AP-SL 532

Query: 387 SPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCKVGLML 446
           + +   G  +     S+   VR             VL+ +YE + ++   L   +   M+
Sbjct: 533 TTVIYKGTPNQ--RRSLQHQVRIGDF--------DVLLTTYEYIIKDRSLLAKHEWSHMI 582

Query: 447 ADEGHRLKNGDS-LTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQF 505
            DEGHR+KN  S L++T         R+IL+GTP+QN+L E +ALLNF  P +  +   F
Sbjct: 583 IDEGHRMKNAQSKLSYTLTHYYKTRHRLILTGTPLQNNLPELWALLNFVLPKIFNSSKTF 642

Query: 506 RKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHILF 565
            + F  P       +  +       + +  L +++  F++RR    + K LP K E ++ 
Sbjct: 643 DEWFNTPFSNTGGQEKLELTEEEALLVIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVVK 702

Query: 566 VNLSPMQKAIYEHFVRSREVAKLMKGTGSQPLKAIGL---------LKKLCNHPDLLDLP 616
             LS +Q  +Y+  ++      L  G G++     G+         L+K+CNHP + D  
Sbjct: 703 CKLSGLQHQLYQQMLKHN---ALFVGAGTEGATKGGIKGLNNKIMQLRKICNHPFVFD-- 757

Query: 617 DEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLI 676
            E+ G  N  P    S++ +   G             KF +L+R L K K  +  ++++ 
Sbjct: 758 -EVEGVVN--PTRTNSSLLYRVSG-------------KFELLDRVLPKFK-ATGHRVLMF 800

Query: 677 SNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCG 736
              TQ +D++E   +  +   +RLDG     +R  +++ FN P  + F FLLS++AGG G
Sbjct: 801 FQMTQVMDIMEDFLQMKNLKYMRLDGATKAEERTGMLNAFNAPDSDYFCFLLSTRAGGLG 860

Query: 737 INLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKM 796
           +NL  A+ +I+ D DWNP  D QA  R  R GQK +  I R ITT S+EE I +R   K+
Sbjct: 861 LNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKL 920

Query: 797 SLSSCVVE 804
            +   V++
Sbjct: 921 DIDGKVIQ 928

>AFR562C [3754] [Homologous to ScYOR290C (SNF2) - SH]
            (1439983..1444257,1444339..1444398) [4335 bp, 1444 aa]
          Length = 1444

 Score =  223 bits (568), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 159/489 (32%), Positives = 238/489 (48%), Gaps = 50/489 (10%)

Query: 327  IMADEMGLGKTLQCIALMWTLLR-QGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDA 385
            I+ADEMGLGKT+Q I+L+  L   +G  G       +++ P S + NW  E  KW  P  
Sbjct: 583  ILADEMGLGKTIQTISLLTYLYEFKGIHG-----PFLVIVPLSTLTNWNAEFDKW-AP-T 635

Query: 386  LSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCKVGLM 445
            L  LA  G  S     S         I +  N    V++ ++E + +    L   K   M
Sbjct: 636  LRKLAFKGPPSERKALS--------GIIKSGNF--DVVLTTFEYIIKERPLLSKVKWVHM 685

Query: 446  LADEGHRLKNGDS-LTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQ 504
            + DEGHR+KN  S L+ T     +   R+IL+GTP+QN+L E +ALLNF  P +  +   
Sbjct: 686  IIDEGHRMKNAQSKLSLTLNQYYHTDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKS 745

Query: 505  FRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHIL 564
            F + F  P       D  +       + +  L +++  F++RR    + K LP K E +L
Sbjct: 746  FDEWFNTPFANTGGQDKIELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVL 805

Query: 565  FVNLSPMQKAIYEHFVRSREVAKLMKGTGSQPLKAIGL---------LKKLCNHPDLLDL 615
               +S +Q+ +YE  ++ R   +L         K +GL         LKK+CNHP + + 
Sbjct: 806  KCRMSALQQKLYEQMLKHR---RLFVVDDPSSKKMVGLRGFNNQIMQLKKICNHPFVFE- 861

Query: 616  PDEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVL 675
              E+    N  P+   +A      G             KF +LE+ L K K  S  ++++
Sbjct: 862  --EVEDQIN--PNRETNANIWRVAG-------------KFELLEKILPKFK-ASGHRVLI 903

Query: 676  ISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGC 735
                TQ +D++E   R+     LRLDG    + R  L++KFN P  + F FLLS++AGG 
Sbjct: 904  FFQMTQIMDIMEDFLRFCDMKYLRLDGHTKSDDRTALLNKFNAPGSDYFCFLLSTRAGGL 963

Query: 736  GINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMK 795
            G+NL  A+ +I+ D DWNP  D QA  R  R GQK +  I R IT  S+EE I +R   K
Sbjct: 964  GLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEVILERAHRK 1023

Query: 796  MSLSSCVVE 804
            + +   V++
Sbjct: 1024 LDIDGKVIQ 1032

>Scas_665.17
          Length = 1060

 Score =  221 bits (563), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 146/484 (30%), Positives = 245/484 (50%), Gaps = 53/484 (10%)

Query: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
           I+ADEMGLGKTLQ I+ +  L        P     +IV P S ++NW  E  KW  P+ +
Sbjct: 159 ILADEMGLGKTLQTISFLGYLRYVKKIDGP----FLIVVPKSTLDNWRREFNKW-TPE-V 212

Query: 387 SPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCKVGLML 446
           + + + G K           +    + + +     VLI SYE + +    LK      ++
Sbjct: 213 NAIVLHGDKEE------RHKILYDIVLEAKF---DVLITSYEMVIKEKNVLKKFAWQYIV 263

Query: 447 ADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFR 506
            DE HR+KN  S     +       R++++GTP+QN+L E +ALLNF  P + G    F 
Sbjct: 264 IDEAHRIKNEQSQLSQIIRLFYSKNRLLITGTPLQNNLHELWALLNFLLPDVFGDSGIFD 323

Query: 507 KNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHILFV 566
           + FE      ++    D+EI      + +L  +++ F++RR    + K L  K E  ++V
Sbjct: 324 EWFE------QNNSEQDQEIV-----VQQLHTVLNPFLLRRIKADVEKSLLPKIETNVYV 372

Query: 567 NLSPMQKAIYEHFVRSREVAKLMKGTGSQP-----LKAIGLLKKLCNHPDLLDLPDEIAG 621
            ++ MQ   Y+  +  +++  +    G +      L  +  L+K CNHP L +      G
Sbjct: 373 GMTEMQVKWYKSLL-EKDIDAVNGAVGKREGKTRLLNIVMQLRKCCNHPYLFE------G 425

Query: 622 STNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLISNYTQ 681
           +    P      +  N              + K  +L++ L ++K E   ++++ S  ++
Sbjct: 426 AEPGPPYTTDEHLVFN--------------AGKMIVLDKLLKRLK-EKGSRVLIFSQMSR 470

Query: 682 TLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGINLIG 741
            LD++E  C +  Y   R+DG+     R + +D++N P+ ++F+FLL+++AGG GINL+ 
Sbjct: 471 LLDILEDYCFFRGYEYCRIDGSTAHEDRIEAIDEYNKPNSDKFVFLLTTRAGGLGINLVT 530

Query: 742 ANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSC 801
           A+ +IL D DWNP AD QA+ R  R GQKK   +YRF+T  +IEEK+ +R + K+ L   
Sbjct: 531 ADTVILYDSDWNPQADLQAMDRAHRIGQKKQVTVYRFVTENAIEEKVIERAAQKLRLDQL 590

Query: 802 VVEE 805
           V+++
Sbjct: 591 VIQQ 594

>AFL040W [3153] [Homologous to ScYBR245C (ISW1) - SH]
           complement(363162..366422) [3261 bp, 1086 aa]
          Length = 1086

 Score =  220 bits (561), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 151/485 (31%), Positives = 243/485 (50%), Gaps = 55/485 (11%)

Query: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
           I+ADEMGLGKTLQ I  +   LR   + R      +++ P S +NNW  EI +W  PD +
Sbjct: 166 ILADEMGLGKTLQTITFL-GYLRYIEKKRGPF---LVIAPKSTLNNWQREINRW-TPD-V 219

Query: 387 SPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCKVGLML 446
               + G K        A+  ++  +A   +V     I SYE + R   + K      ++
Sbjct: 220 DAFILQGDKEER-----ARLCQERLLACNFDVA----IASYEIIIREKASFKKIDWEYIV 270

Query: 447 ADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFR 506
            DE HR+KN +S+    L   +   R++++GTP+QN+L E +ALLNF  P +    A F 
Sbjct: 271 IDEAHRIKNEESMLSQVLREFSSRNRLLITGTPLQNNLHELWALLNFLLPDIFSDSAAFD 330

Query: 507 KNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRT-NDILSKYLPCKYEHILF 565
           + F        +A   DK+       + +L  I+  F++RR  +D+ +  LP K E  L+
Sbjct: 331 EWF------SSEASDDDKDKI-----VKQLHTILQPFLLRRIKSDVETSLLPKK-ELNLY 378

Query: 566 VNLSPMQKAIYEHFVRSREVAKLMKGTGSQPLKAIGL-----LKKLCNHPDLLDLPDEIA 620
           V +S MQ+  Y+  +  +++  +    GS+  K   L     L+K CNHP L D      
Sbjct: 379 VGMSSMQRKWYKQIL-EKDLDAVNGSNGSKESKTRLLNIMMQLRKCCNHPYLFD------ 431

Query: 621 GSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLISNYT 680
           G+    P      + +NS   +   ++                    E   ++++ S  +
Sbjct: 432 GAEPGPPYTTDEHLVYNSAKLKVLDKLLKKLK---------------EDGSRVLIFSQMS 476

Query: 681 QTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGINLI 740
           + LD++E  C +  Y   R+DG+     R + +D++N P   +FIFLL+++AGG GINL 
Sbjct: 477 RLLDILEDYCYFRGYEYCRIDGSTAHEDRIEAIDEYNAPDSRKFIFLLTTRAGGLGINLT 536

Query: 741 GANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSS 800
            A+ ++L D DWNP AD QA+ R  R GQKK   ++R +T  S+EEKI +R + K+ L  
Sbjct: 537 TADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVTDNSVEEKILERATQKLRLDQ 596

Query: 801 CVVEE 805
            V+++
Sbjct: 597 LVIQQ 601

>KLLA0F06710g 645650..648940 similar to sp|P38144 Saccharomyces
           cerevisiae YBR245c ISW1, start by similarity
          Length = 1096

 Score =  219 bits (559), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 146/485 (30%), Positives = 236/485 (48%), Gaps = 55/485 (11%)

Query: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
           I+ADEMGLGKTLQ IA +  L     +  P     +++ P S +NNW  EI +W  P+ +
Sbjct: 163 ILADEMGLGKTLQTIAFLGYLRYIEKKNGP----FLVIAPKSTLNNWLREINRW-TPE-V 216

Query: 387 SPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCKVGLML 446
           S   + G K   S     +      +A   ++     + SYE + R   + K      ++
Sbjct: 217 SAFILQGDKEERS-----KLCHDKLLACDFDIC----VASYEIIIREKASFKKIDWEYVV 267

Query: 447 ADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFR 506
            DE HR+KN +S+    L   +   R++++GTP+QN+L E +ALLNF  P +    A F 
Sbjct: 268 IDEAHRIKNEESMLSQVLREFSSRNRLLITGTPLQNNLHELWALLNFLLPDIFADSATFD 327

Query: 507 KNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRT-NDILSKYLPCKYEHILF 565
           + F                       + +L  ++S F++RR  ND+    LP K E  ++
Sbjct: 328 EWFSSESSEEDKEKV-----------VKQLHTVLSPFLLRRIKNDVEGSLLPKK-ELNVY 375

Query: 566 VNLSPMQKAIYEHFVRSREVAKLMKGTGSQP-----LKAIGLLKKLCNHPDLLDLPDEIA 620
           V +S MQK  Y+  +  +++  +    G +      L  +  L+K CNHP L D      
Sbjct: 376 VGMSSMQKKWYKQIL-EKDIDAVNGSNGQKESKTRLLNIVMQLRKCCNHPYLFD------ 428

Query: 621 GSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLISNYT 680
           G+    P      + +NS   +   ++                    E   ++++ S  +
Sbjct: 429 GAEPGPPYTTDEHLVYNSAKLKVLDKLLKKFK---------------EQGSRVLIFSQMS 473

Query: 681 QTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGINLI 740
           + LD++E  C +  Y   R+DG+     R   +D +N P  ++FIFLL+++AGG GINL 
Sbjct: 474 RVLDILEDYCYFREYEYCRIDGSTAHEDRINAIDDYNAPDSKKFIFLLTTRAGGLGINLT 533

Query: 741 GANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSS 800
            A+ ++L D DWNP AD QA+ R  R GQKK   ++RF+T  S+EEKI +R + K+ L  
Sbjct: 534 TADIVVLYDSDWNPQADLQAMDRAHRIGQKKQVRVFRFVTDNSVEEKILERATQKLKLDQ 593

Query: 801 CVVEE 805
            V+++
Sbjct: 594 LVIQQ 598

>Scas_576.6
          Length = 1457

 Score =  219 bits (558), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 155/486 (31%), Positives = 248/486 (51%), Gaps = 48/486 (9%)

Query: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
           I+ADEMGLGKT+Q +A +  L+    Q  P     I+V P S +  W     KW  PD L
Sbjct: 404 ILADEMGLGKTVQTVAFISWLIYARRQNGP----HIVVVPLSTMPAWQETFDKW-APD-L 457

Query: 387 SPLAIDGRKSSLSNGSVAQSVRQWAI-----AQGRNVVK-PVLIISYETLRRNVENLKGC 440
           + +   G + S        ++R++       A+G+  +K  VL+ +YE + ++   L   
Sbjct: 458 NVICYMGNQRS------RDAIREFEFYTNPYAKGKKNIKFNVLLTTYEYILKDRSELGSI 511

Query: 441 KVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLG 500
           K   +  DE HRLKN +S  + SL+S     R++++GTP+QN++ E  AL+NF  PG   
Sbjct: 512 KWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTPLQNNIKELAALINFLMPG--- 568

Query: 501 TRAQFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKY 560
              +F  + EI      D +  D+E    E  + +L + +  FI+RR    + K LP K 
Sbjct: 569 ---RFTIDQEI------DFENQDEE---QEEYIRDLHKRLQPFILRRLKKDVEKSLPSKT 616

Query: 561 EHILFVNLSPMQKAIYEHFVRSREVAKLMKGTGSQPLKAIGL---LKKLCNHPDLLDLPD 617
           E IL V LS +Q   Y++ + ++  + L  G+       + +   LKK  NHP L D  +
Sbjct: 617 ERILRVELSDVQTEYYKNIL-TKNYSALTAGSKGGHFSLLNIMSELKKASNHPYLFDNAE 675

Query: 618 EIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLIS 677
           E          D Q +  +  RG           S K  +L++ L K+K + + ++++ S
Sbjct: 676 ERVLKK---FGDGQMSRENVLRG-------LIMSSGKMVLLDQLLNKLKKDGH-RVLIFS 724

Query: 678 NYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGI 737
              + LD++            RLDGT+   +R+  +D FN P   + +FLLS++AGG GI
Sbjct: 725 QMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGI 784

Query: 738 NLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMS 797
           NL+ A+ +I+ D DWNP AD QA+AR  R GQK    +YR ++  ++EE++ +R   KM 
Sbjct: 785 NLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMI 844

Query: 798 LSSCVV 803
           L   ++
Sbjct: 845 LEYAII 850

>KLLA0C17578g 1547890..1552467 similar to sp|P32657 Saccharomyces
           cerevisiae YER164w CHD1 transcriptional regulator, start
           by similarity
          Length = 1525

 Score =  219 bits (557), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 149/481 (30%), Positives = 244/481 (50%), Gaps = 38/481 (7%)

Query: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWL-GPDA 385
           I+ADEMGLGKT+Q ++ +  L+    Q  P     ++V P S +  W     KW  G + 
Sbjct: 410 ILADEMGLGKTVQTVSFISWLIYARRQNGP----HLVVVPLSTMPAWQETFDKWAPGLNC 465

Query: 386 LSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVK-PVLIISYETLRRNVENLKGCKVGL 444
           +  +     +  + +     + +    A+G+  +K  VL+ +YE + ++   L   K   
Sbjct: 466 VYYMGNQASRDLIQDYEFYTNPQ----AKGKKHLKFNVLLTTYEYILKDRSTLGSIKWQF 521

Query: 445 MLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQ 504
           +  DE HRLKN +S  + SL+S     R++++GTP+QN++ E  AL+NF  PG      +
Sbjct: 522 LAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPG------R 575

Query: 505 FRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHIL 564
           F  + EI      D +  D++    E  + +L + +  FI+RR    + K LP K E IL
Sbjct: 576 FTIDQEI------DFENQDEQ---QEEYIRDLHKRLQPFILRRLKKDVEKSLPSKTERIL 626

Query: 565 FVNLSPMQKAIYEHFVRSREVAKL--MKGTGSQPLKAIGLLKKLCNHPDLLDLPDEIAGS 622
            V LS +Q   Y++ +     A    +KG     L  +  LKK  NHP L D  +E   S
Sbjct: 627 RVELSDVQTEYYKNILTKNYSALTSGIKGGHVSLLNVMNELKKASNHPYLFDNAEERVLS 686

Query: 623 TNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLISNYTQT 682
                   +    H SR   + +      S K  +L++ L ++K + + ++++ S   + 
Sbjct: 687 --------KFGDGHKSR--ENILRGLIMSSGKMVLLDKLLTRLKKDGH-RVLIFSQMVRI 735

Query: 683 LDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGINLIGA 742
           LD++            RLDGT+   +R+  +D FN     +F+FLLS++AGG GINL+ A
Sbjct: 736 LDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGINLMTA 795

Query: 743 NRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSCV 802
           + +I+ D DWNP AD QA+AR  R GQK    +YRF++  ++EE++ +R   KM L   +
Sbjct: 796 DTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAI 855

Query: 803 V 803
           +
Sbjct: 856 I 856

>Scas_594.7
          Length = 1703

 Score =  218 bits (556), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 149/489 (30%), Positives = 238/489 (48%), Gaps = 51/489 (10%)

Query: 327  IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
            I+ADEMGLGKT+Q I+L+  L        P     +++ P S ++NW+NE  KW      
Sbjct: 835  ILADEMGLGKTIQTISLLTYLYETKHIHGP----YLVIVPLSTLSNWSNEFAKW------ 884

Query: 387  SPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCKVGLML 446
               A   R  S       +  +   I  G      V++ ++E + +    L   K   M+
Sbjct: 885  ---APTMRCISYKGSPNERKSKHAIIKSGEF---DVVLTTFEYIIKERALLSKVKWIHMI 938

Query: 447  ADEGHRLKNGDS-LTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQF 505
             DEGHR+KN  S L+ T     +   R+IL+GTP+QN+L E +ALLNF+ P +  +   F
Sbjct: 939  IDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFALPKIFNSVKSF 998

Query: 506  RKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHILF 565
             + F  P       D  +       + +  L +++  F++RR    + K LP K E ++ 
Sbjct: 999  DEWFNTPFANTGGQDKIELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVIK 1058

Query: 566  VNLSPMQKAIYEHFVRSREVAKLMKGTGSQPLKAIGL---------LKKLCNHPDLLD-L 615
              +S +Q+ +Y+  ++ R   +L  G  +   K +GL         LKK+CNHP + + +
Sbjct: 1059 CKMSALQQIMYQQMLKYR---RLFIGDHTNK-KMVGLRGFNNQLMQLKKICNHPFVFEEV 1114

Query: 616  PDEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVL 675
             D+I  +     + ++ A                    KF +LE+ L K+K  +  ++++
Sbjct: 1115 EDQINPTRETNANIWRVA-------------------GKFELLEKVLPKLK-ATGHRVLI 1154

Query: 676  ISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGC 735
                TQ +D++E   R+     LRLDG    + R  L+  FN P  E   F+LS++AGG 
Sbjct: 1155 FFQMTQIMDIVEDFLRFIDIKYLRLDGHTKSDDRSNLLKLFNAPDSEYLCFILSTRAGGL 1214

Query: 736  GINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMK 795
            G+NL  A+ +I+ D DWNP  D QA  R  R GQK +  I R IT  S+EE I +R   K
Sbjct: 1215 GLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITEHSVEEAILERAHKK 1274

Query: 796  MSLSSCVVE 804
            + +   V++
Sbjct: 1275 LDIDGKVIQ 1283

>KLLA0B08327g 742205..746809 similar to sp|P22082 Saccharomyces
            cerevisiae YOR290c SNF2 component of SWI/SNF global
            transcription activator complex, hypothetical start
          Length = 1534

 Score =  218 bits (555), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 152/488 (31%), Positives = 238/488 (48%), Gaps = 48/488 (9%)

Query: 327  IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
            I+ADEMGLGKT+Q I+L+  L        P     +++ P S + NW  E  KW      
Sbjct: 706  ILADEMGLGKTIQTISLLTYLYEAKGVHGP----FLVIVPLSTLTNWNAEFDKW------ 755

Query: 387  SPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCKVGLML 446
               A   RK +     + +  +Q  I   +N    V++ ++E + +    L   K    +
Sbjct: 756  ---APKLRKIAFKGPPMERKPKQALI---KNREFDVVLTTFEYIIKERPLLSKIKWVHTI 809

Query: 447  ADEGHRLKNGDS-LTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQF 505
             DEGHR+KN  S L+ T     +   R+IL+GTP+QN+L E +ALLNF  P +  +   F
Sbjct: 810  IDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSF 869

Query: 506  RKNFEIPILR--GRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHI 563
             + F  P     G+D  A  +E     + +  L +++  F++RR    + K LP K E +
Sbjct: 870  DEWFNTPFANTGGQDKIALSEEETL--LVIRRLHKVLRPFLLRRLKKDVEKDLPDKVEKV 927

Query: 564  LFVNLSPMQKAIYEHFVRSREVAKLMKGTGSQPLKA-------IGLLKKLCNHPDLLDLP 616
            L   +S +Q  +Y+  ++ R +  +   + +Q   +       I  L+K+CNHP + +  
Sbjct: 928  LKCKMSALQHKLYQQMLKHRRLF-IFDDSSNQKFSSSRGFNNQIMQLRKICNHPFVFEE- 985

Query: 617  DEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLI 676
                     + D    A   N    RS        + KF +LER L K K  +  ++++ 
Sbjct: 986  ---------VEDQINPARETNDTIWRS--------AGKFELLERILPKFK-ATGHRVLIF 1027

Query: 677  SNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCG 736
               TQ +D++E   RY     LRLDG    + R  L++ FN P+ + F FLLS++AGG G
Sbjct: 1028 FQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLG 1087

Query: 737  INLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKM 796
            +NL  A+ +I+ D DWNP  D QA  R  R GQK +  I R IT  S+EE I  +   K+
Sbjct: 1088 LNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKL 1147

Query: 797  SLSSCVVE 804
             +   V++
Sbjct: 1148 DIDGKVIQ 1155

>CAGL0H05533g 538045..543759 highly similar to sp|P32333 Saccharomyces
            cerevisiae YPL082c MOT1, start by similarity
          Length = 1904

 Score =  218 bits (555), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 171/546 (31%), Positives = 260/546 (47%), Gaps = 68/546 (12%)

Query: 320  NRGAYGCIMADEMGLGKTLQCIALMWT--LLRQGSQGRPTIEKC-----IIVCPSSLVNN 372
            N+     I+ D+MGLGKTLQ I ++ +   LRQ         +C     +IVCP SL  +
Sbjct: 1328 NKYHLHGILCDDMGLGKTLQTICIIASDQYLRQEEYKLSGNIECRPLPSLIVCPPSLTGH 1387

Query: 373  WANEIVKWLGPDALSPLAIDGRKSSLSNG--SVAQSVRQWAIAQGRNVVKPVLIISYETL 430
            W NE  ++      SP      K  +  G  SV Q +R+   +        ++I SY+  
Sbjct: 1388 WENEFEQY------SPFL----KIVVYAGGPSVRQPLRKQLSSAD------IIITSYDVA 1431

Query: 431  RRNVENLKGCKVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFAL 490
            R +++ +        + DEGH +KN  S    ++  I    R+IL+GTPIQN++ E ++L
Sbjct: 1432 RNDLDTISSYDYNYCVLDEGHLIKNAQSKLAKAVKLIKANHRLILTGTPIQNNVVELWSL 1491

Query: 491  LNFSNPGLLGTRAQFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTND 550
             +F  PG LGT   F++ F  PI   R++  + KE  AG + L  L + V  F++RR  +
Sbjct: 1492 FDFLMPGFLGTEKSFQERFAKPIAASRNSKTSSKEQEAGALALEALHKQVLPFMLRRLKE 1551

Query: 551  ILSKYLPCKYEHILFVNLSPMQKAIYEHFVRSRE--VAKLMKGTG-----SQPLKAIGLL 603
             +   LP K     +  LS +QK +YE F + ++  V K ++ T          +A+  +
Sbjct: 1552 DVLSDLPPKIIQDYYCELSDLQKQLYEDFAKKQKNVVEKDIQNTADVDSKQHIFQALQYM 1611

Query: 604  KKLCNHPDLLDLPDEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLF 663
            +KLCNHP L+         +N  P   Q        G   H      ++ K   L   LF
Sbjct: 1612 RKLCNHPALV--------LSNDHPQLKQIQNYLKQTGCDLH---DIRNAPKLTALRTLLF 1660

Query: 664  -----------KIKHE--------SNDKIVLISNYTQTLDLIEK--MCRYN-HYGVLRLD 701
                       K+  E        S  + ++       LD+IE     RY      +RLD
Sbjct: 1661 ECGIGEADMDKKVTGEQLLTGSVISQHRALIFCQLKDMLDMIENDLFKRYMPSVSYMRLD 1720

Query: 702  GTMTINKRQKLVDKFN-DPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQA 760
            G++    RQK+V KFN DPS +    LL++K GG G+NL GA+ +I ++ DWNP  D QA
Sbjct: 1721 GSVDPRDRQKVVRKFNEDPSID--CLLLTTKVGGLGLNLTGADTVIFVEHDWNPMNDLQA 1778

Query: 761  LARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVEEKEDVERLFSSENLRP 820
            + R  R GQKK   +YR +T G++EEKI      KM+++S VV ++        +  L  
Sbjct: 1779 MDRAHRLGQKKVVNVYRIVTKGTLEEKIMGLQKFKMNIASTVVNQQNSGLASMDTHQLLD 1838

Query: 821  LFQFDS 826
            LF  D+
Sbjct: 1839 LFDTDN 1844

>YBR245C (ISW1) [424] chr2 complement(708107..711496) Putative
           ATP-dependent chromatin remodeling factor, has strong
           similarity to Drosophila nucleosome remodeling factor
           ISWI [3390 bp, 1129 aa]
          Length = 1129

 Score =  216 bits (550), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 148/489 (30%), Positives = 246/489 (50%), Gaps = 63/489 (12%)

Query: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKC----IIVCPSSLVNNWANEIVKWLG 382
           I+ADEMGLGKTLQ I+ +  L          IEK     +++ P S +NNW  EI +W  
Sbjct: 218 ILADEMGLGKTLQTISFLGYL--------RYIEKIPGPFLVIAPKSTLNNWLREINRW-T 268

Query: 383 PDALSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCKV 442
           PD ++   + G K        A+ +++  +    +VV    I SYE + R    LK    
Sbjct: 269 PD-VNAFILQGDKEER-----AELIQKKLLGCDFDVV----IASYEIIIREKSPLKKINW 318

Query: 443 GLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTR 502
             ++ DE HR+KN +S+    L       R++++GTP+QN+L E +ALLNF  P +    
Sbjct: 319 EYIIIDEAHRIKNEESMLSQVLREFTSRNRLLITGTPLQNNLHELWALLNFLLPDIFSDA 378

Query: 503 AQFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRT-NDILSKYLPCKYE 561
             F   F         +++T+++      +LH    ++  F++RR  +D+ +  LP K E
Sbjct: 379 QDFDDWF--------SSESTEEDQDKIVKQLH---TVLQPFLLRRIKSDVETSLLPKK-E 426

Query: 562 HILFVNLSPMQKAIYEHFVRSREVAKLMKGTGSQP-----LKAIGLLKKLCNHPDLLDLP 616
             L+V +S MQK  Y+  +  +++  +    GS+      L  +  L+K CNHP L D  
Sbjct: 427 LNLYVGMSSMQKKWYKKIL-EKDLDAVNGSNGSKESKTRLLNIMMQLRKCCNHPYLFD-- 483

Query: 617 DEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLI 676
               G+    P      + +N+   +   ++                    E   ++++ 
Sbjct: 484 ----GAEPGPPYTTDEHLVYNAAKLQVLDKLLKKLK---------------EEGSRVLIF 524

Query: 677 SNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCG 736
           S  ++ LD++E  C + +Y   R+DG+     R + +D +N P  ++F+FLL+++AGG G
Sbjct: 525 SQMSRLLDILEDYCYFRNYEYCRIDGSTAHEDRIQAIDDYNAPDSKKFVFLLTTRAGGLG 584

Query: 737 INLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKM 796
           INL  A+ ++L D DWNP AD QA+ R  R GQKK   ++R +T  S+EEKI +R + K+
Sbjct: 585 INLTSADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVTDNSVEEKILERATQKL 644

Query: 797 SLSSCVVEE 805
            L   V+++
Sbjct: 645 RLDQLVIQQ 653

>AEL256C [2250] [Homologous to ScYPL082C (MOT1) - SH] (156109..161709)
            [5601 bp, 1866 aa]
          Length = 1866

 Score =  214 bits (544), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 163/540 (30%), Positives = 263/540 (48%), Gaps = 69/540 (12%)

Query: 327  IMADEMGLGKTLQCIALMWT--LLRQ-------GSQGRPTIEKCIIVCPSSLVNNWANEI 377
            I+ D+MGLGKTLQ I ++ +   LRQ         + RP     +IVCP SL  +W  E 
Sbjct: 1301 ILCDDMGLGKTLQTICIIASDQYLRQEDYKTTKSVETRPL--PSLIVCPPSLTGHWEQEF 1358

Query: 378  VKWLGPDALSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENL 437
             ++  P  L+ L   G  S+           ++ + +G+     +++ SY+  R +++ +
Sbjct: 1359 EQY-AP-FLTVLVYAGGPST-----------RYPL-RGKLGDADIVVTSYDVARNDIDII 1404

Query: 438  KGCKVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPG 497
                    + DEGH +KN  S    ++ SI    R+IL+GTPIQN++ E ++L +F  PG
Sbjct: 1405 SKHDYNYCVLDEGHIIKNSQSKLAKAVKSIRANHRLILTGTPIQNNVVELWSLFDFLMPG 1464

Query: 498  LLGTRAQFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLP 557
             LG+   F++ F  PI   R++  + KE  AG + L  L + V  F++RR  + +   LP
Sbjct: 1465 FLGSEKAFQERFAKPIAASRNSKTSSKEQEAGALALEALHKQVLPFMLRRLKEDVLSDLP 1524

Query: 558  CKYEHILFVNLSPMQKAIYEHFVR------SREVAKLMK-GTGSQPLKAIGLLKKLCNHP 610
             K     +  LS +Q+ +Y+ F +       R++   M+  + +   +A+  ++KLCNHP
Sbjct: 1525 PKIIQDYYCELSDLQRQLYKDFAKKQKNIVERDIENTMELESKNHIFQALQYMRKLCNHP 1584

Query: 611  DLLDLPDEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFK------ 664
             L+   D            Y     + S+ G    ++   H+ K   L   L +      
Sbjct: 1585 SLVLSKDH---------PQYNQVQDYLSQTGMDIHDI--AHAPKLGALRNLLLECGIGVQ 1633

Query: 665  ------IKHESNDKIV------LISNYTQTLDLIEKMCRYNHY----GVLRLDGTMTINK 708
                  I   S++ ++      +       LD+IE    +  Y      +RLDG++    
Sbjct: 1634 DVDQNSISLPSSENVISQHRALIFCQLKDMLDMIENDL-FKKYLPSVTYMRLDGSVESRD 1692

Query: 709  RQKLVDKFN-DPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRD 767
            RQK+V KFN DPS +    LL++K GG G+NL GA+ +I ++ DWNP  D QA+ R  R 
Sbjct: 1693 RQKVVRKFNEDPSID--CLLLTTKVGGLGLNLTGADTVIFIEHDWNPMNDLQAMDRAHRL 1750

Query: 768  GQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVEEKEDVERLFSSENLRPLFQFDSN 827
            GQKK   +YR IT GS+EEKI      KM+++S VV ++        +  L  LF  D++
Sbjct: 1751 GQKKVVNVYRIITKGSLEEKIMGLQKFKMNIASTVVNQQNAGLASMDTHQLLDLFDTDNS 1810

>YIL126W (STH1) [2550] chr9 (117992..122071) Component of abundant
           chromatin remodeling complex (RSC), involved in the
           response to DNA damage, DNA helicase of the Snf2p
           family, has a bromodomain [4080 bp, 1359 aa]
          Length = 1359

 Score =  213 bits (541), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 150/488 (30%), Positives = 240/488 (49%), Gaps = 48/488 (9%)

Query: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
           I+ADEMGLGKT+Q I+L+  L     + +  I   +++ P S + NW  E  KW  P +L
Sbjct: 492 ILADEMGLGKTIQSISLITYLY----EVKKDIGPFLVIVPLSTITNWTLEFEKW-AP-SL 545

Query: 387 SPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCKVGLML 446
           + +   G  +     S+   +R             VL+ +YE + ++   L       M+
Sbjct: 546 NTIIYKGTPNQ--RHSLQHQIRVGNF--------DVLLTTYEYIIKDKSLLSKHDWAHMI 595

Query: 447 ADEGHRLKNGDS-LTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQF 505
            DEGHR+KN  S L+FT         R+IL+GTP+QN+L E +ALLNF  P +  +   F
Sbjct: 596 IDEGHRMKNAQSKLSFTISHYYRTRNRLILTGTPLQNNLPELWALLNFVLPKIFNSAKTF 655

Query: 506 RKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHILF 565
              F  P       +  +       + +  L +++  F++RR    + K LP K E ++ 
Sbjct: 656 EDWFNTPFANTGTQEKLELTEEETLLIIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVIK 715

Query: 566 VNLSPMQKAIYEHFVRSREVAKLMKGTGSQPLKAIGL---------LKKLCNHPDLLDLP 616
             LS +Q+ +Y+  ++      L  G G++     G+         L+K+CNHP + D  
Sbjct: 716 CKLSGLQQQLYQQMLKHN---ALFVGAGTEGATKGGIKGLNNKIMQLRKICNHPFVFD-- 770

Query: 617 DEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLI 676
            E+ G  N                 R + ++    + KF +L+R L K K  S  ++++ 
Sbjct: 771 -EVEGVVN---------------PSRGNSDLLFRVAGKFELLDRVLPKFKA-SGHRVLMF 813

Query: 677 SNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCG 736
              TQ +D++E   R      +RLDG+    +R ++++ FN P  + F FLLS++AGG G
Sbjct: 814 FQMTQVMDIMEDFLRMKDLKYMRLDGSTKTEERTEMLNAFNAPDSDYFCFLLSTRAGGLG 873

Query: 737 INLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKM 796
           +NL  A+ +I+ D DWNP  D QA  R  R GQK +  I R ITT S+EE I +R   K+
Sbjct: 874 LNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKL 933

Query: 797 SLSSCVVE 804
            +   V++
Sbjct: 934 DIDGKVIQ 941

>AFR537W [3729] [Homologous to ScYOR304W (ISW2) - SH]
           complement(1400495..1400512,1400676..1403735) [3078 bp,
           1025 aa]
          Length = 1025

 Score =  210 bits (535), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 145/484 (29%), Positives = 243/484 (50%), Gaps = 53/484 (10%)

Query: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
           I+ADEMGLGKTLQ I+ +  L        P     I+V P S ++NW  E  KW  P+ +
Sbjct: 150 ILADEMGLGKTLQTISFLGYLRFIKDIDGP----FIVVVPKSTLDNWKREFAKW-TPE-V 203

Query: 387 SPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCKVGLML 446
           + + + G + + +     Q + +  +    +V    LI SYE + +    LK      ++
Sbjct: 204 NTIVLHGDRETRT-----QLIEERILTCDFDV----LITSYEMVIKEKAILKKFAWQYIV 254

Query: 447 ADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFR 506
            DE HR+KN  S     +       R++++GTP+QN+L E +ALLNF  P + G    F 
Sbjct: 255 IDEAHRIKNEQSTLSQIIRLFYSKSRLLITGTPLQNNLHELWALLNFLLPDVFGESEVFD 314

Query: 507 KNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHILFV 566
           + F+      ++  A D+EI      + +L  ++  F++RR    + K L  K E  ++V
Sbjct: 315 EWFQ------QNEKAQDQEIV-----VQQLHAVLQPFLLRRVKADVEKSLLPKIETNVYV 363

Query: 567 NLSPMQKAIYEHFVRSREVAKLMKGTGSQP-----LKAIGLLKKLCNHPDLLDLPDEIAG 621
            ++ MQ   Y   +  +++  +    G +      L  +  L+K CNHP L +      G
Sbjct: 364 GMTAMQLQWYRSLL-EKDIDAVNGAVGKREGKTRLLNIVMQLRKCCNHPYLFE------G 416

Query: 622 STNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLISNYTQ 681
           +    P      + +NS  G+              I+   L K K +   ++++ S  ++
Sbjct: 417 AEPGPPYTTDEHLIYNS--GK-------------MIVLDKLLKRKKKEGSRVLIFSQMSR 461

Query: 682 TLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGINLIG 741
            LD++E  C +  +   R+DG  +  +R   +D+FN    ++FIFLL+++AGG GINL+ 
Sbjct: 462 LLDILEDYCYFRDFEYCRIDGATSHEERIAAIDEFNAHDSKKFIFLLTTRAGGLGINLVT 521

Query: 742 ANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSC 801
           A+ ++L D DWNP AD QA+ R  R GQKK   +YR +T  +IEEK+ +R + K+ L   
Sbjct: 522 ADTVVLYDSDWNPQADLQAMDRAHRIGQKKQVHVYRLVTENAIEEKVIERAAQKLRLDQL 581

Query: 802 VVEE 805
           V+++
Sbjct: 582 VIQQ 585

>CAGL0G08756g complement(829778..833842) highly similar to sp|P32597
           Saccharomyces cerevisiae YIL126w STH1 subunit of the RSC
           complex, hypothetical start
          Length = 1354

 Score =  210 bits (534), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 151/488 (30%), Positives = 238/488 (48%), Gaps = 48/488 (9%)

Query: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
           I+ADEMGLGKT+Q I+L+  L     +  P     +++ P S + NW  E  KW  P +L
Sbjct: 475 ILADEMGLGKTIQSISLITYLYEVKQEPGP----YLVIVPLSTITNWTLEFEKW-AP-SL 528

Query: 387 SPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCKVGLML 446
           + +   G  +        +   Q  I  G      VL+ +YE + ++   L   +   M+
Sbjct: 529 TTIIYKGTPNQ-------RHALQHKIRSGNF---DVLLTTYEYIIKDKALLSKHEWSHMI 578

Query: 447 ADEGHRLKNGDS-LTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQF 505
            DEGHR+KN +S L+FT         R+IL+GTP+QN+L E +ALLNF  P +  +   F
Sbjct: 579 IDEGHRMKNANSKLSFTITKYYRTRNRLILTGTPLQNNLPELWALLNFVLPKIFNSAKTF 638

Query: 506 RKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHILF 565
              F  P       +  +       + +  L +++  F++RR    + K LP K E ++ 
Sbjct: 639 EDWFNTPFANTGTQEKLELTEEETLLVIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVVK 698

Query: 566 VNLSPMQKAIYEHFVRSREVAKLMKGTGSQPLKAIGL---------LKKLCNHPDLLDLP 616
             LS +Q+ +Y+  ++      L  G G++     G+         L+K+CNHP + D  
Sbjct: 699 CKLSGLQQQLYQQMLKHN---ALFVGAGTEGATKGGIKGLNNKIMQLRKICNHPFVFD-- 753

Query: 617 DEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLI 676
            E+    N  P    S + +   G             KF +L+R L K K  +  ++++ 
Sbjct: 754 -EVEAVVN--PSRGNSDLLYRVAG-------------KFELLDRILPKFKA-TGHRVLIF 796

Query: 677 SNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCG 736
              TQ +D++E   R      +RLDG+     R  ++ +FN  + E F FLLS++AGG G
Sbjct: 797 FQMTQVMDIMEDFLRMRDLKYMRLDGSTKAEDRNDMLKEFNVENSEYFCFLLSTRAGGLG 856

Query: 737 INLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKM 796
           +NL  A+ +I+ D DWNP  D QA  R  R GQK +  I R ITT S+EE I +R   K+
Sbjct: 857 LNLQSADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKL 916

Query: 797 SLSSCVVE 804
            +   V++
Sbjct: 917 DIDGKVIQ 924

>Scas_664.9
          Length = 1859

 Score =  209 bits (532), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 165/547 (30%), Positives = 255/547 (46%), Gaps = 85/547 (15%)

Query: 327  IMADEMGLGKTLQCIALMWT---LLRQGSQGRPTIEK----CIIVCPSSLVNNWANE--- 376
            I+ D+MGLGKTLQ I ++ +   L  +  +   ++E      +IVCP SL  +W NE   
Sbjct: 1289 ILCDDMGLGKTLQTICIIASDQYLRAEDYKKTNSVETRKLPSLIVCPPSLTGHWENEFEQ 1348

Query: 377  -------IVKWLGPDALSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYET 429
                   IV   GP    PL     +  L +  +                   +I SY+ 
Sbjct: 1349 YAPFLKIIVYAGGPSMRIPL-----RDELGSADI-------------------VITSYDV 1384

Query: 430  LRRNVENLKGCKVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFA 489
             R ++  +        + DEGH +KN  S    ++  I+   R+IL+GTPIQN++ E ++
Sbjct: 1385 ARNDLSIITKYDFNYCVLDEGHIIKNAQSKLAKAVKQISANHRLILTGTPIQNNVVELWS 1444

Query: 490  LLNFSNPGLLGTRAQFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTN 549
            L +F  PG LGT   F++ F  PI   R++  + KE  AG + L  L + V  F++RR  
Sbjct: 1445 LFDFLMPGFLGTEKMFQEKFAKPIAASRNSKTSSKEQEAGVLALEALHKQVLPFMLRRLK 1504

Query: 550  DILSKYLPCKYEHILFVNLSPMQKAIYEHFVRSRE--VAKLMKGT-----GSQPLKAIGL 602
            + +   LP K     +  LS +QK +Y+ F + ++  V K ++ T          +A+  
Sbjct: 1505 EDVLSDLPPKIIQDYYCELSDLQKQLYQDFAKKQKNVVEKDIENTTDTDNSQHIFQALQY 1564

Query: 603  LKKLCNHPDLLDLPDEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFL 662
            ++KLCNHP L+  P+         P   Q        G   H      ++ K   L   L
Sbjct: 1565 MRKLCNHPALVLSPNH--------PQLAQVQDYLKQTGIDLH---DVINAPKLNALRTLL 1613

Query: 663  FK-------IKHESN-------------DKIVLISNYTQTLDLIEK--MCRYN-HYGVLR 699
            F+       ++ +SN              + ++       LD++E     RY      +R
Sbjct: 1614 FECGIGEEDMERKSNPNQYLTGQNVISQHRALIFCQLKDMLDMVENDLFKRYMPSVTYMR 1673

Query: 700  LDGTMTINKRQKLVDKFN-DPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQ 758
            LDG++    RQK+V KFN DPS +    LL++K GG G+NL GA+ +I ++ DWNP  D 
Sbjct: 1674 LDGSVDPRDRQKVVRKFNEDPSID--CLLLTTKVGGLGLNLTGADTVIFVEHDWNPMNDL 1731

Query: 759  QALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVEEKEDVERLFSSENL 818
            QA+ R  R GQKK   +YR IT G++EEKI      KM+++S VV ++        +  L
Sbjct: 1732 QAMDRAHRLGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIASTVVNQQNSGLASMDTHQL 1791

Query: 819  RPLFQFD 825
              LF  D
Sbjct: 1792 LDLFDTD 1798

>CAGL0J02662g 261909..264443 similar to sp|P43610 Saccharomyces
           cerevisiae YFR038w, hypothetical start
          Length = 844

 Score =  206 bits (524), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 159/528 (30%), Positives = 246/528 (46%), Gaps = 73/528 (13%)

Query: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
           I+ADEMGLGKT+Q IAL+  +    ++G       +I  P S V+NW NE  K+  P+  
Sbjct: 241 ILADEMGLGKTIQSIALLSFIYEMDTKG-----PFLIAAPLSTVDNWMNEFAKF-APEI- 293

Query: 387 SPLAIDGRKSSLSNGSVAQSVRQWAIAQ--GRNVVKPVLIISYETLRRNVENLKGCKVGL 444
            P+     K    NG   Q  RQ  + +    N  + V++ SYE + R+   + G +   
Sbjct: 294 -PIL----KYYSQNG---QDARQKLLKKFFKNNNREGVIVTSYEMIIRDANIIMGEQWKF 345

Query: 445 MLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQ 504
           ++ DEGHRLKN +      L  IN   R++L+GTP+QN+LSE ++LLNF  P +      
Sbjct: 346 LIVDEGHRLKNINCRLIQELKRINTSNRLLLTGTPLQNNLSELWSLLNFILPDIFADFEI 405

Query: 505 FRKNFEIPILRGRDADATDKEIAAGEVK---LHELSQIVSKFIIRRTNDILSK-YLPCKY 560
           F K F+   L  +   A   ++   E++   +  L  I+  F++RR   ++ K  LP K 
Sbjct: 406 FNKWFDFKDLDLQSNSAKLNKLINDELEKNLISNLHTILKPFLLRRLKSVVLKDVLPPKR 465

Query: 561 EHILFVNLSPMQKAIYEHFVRSR----EVAKLMKGTGSQPLKAIGLLK----------KL 606
           E+I+   LSP+Q   Y   +  +       +L+K   +   + IG +           KL
Sbjct: 466 EYIVNCPLSPIQTKFYRMALSGKLKVTVFKELVKAFFTLNQEYIGTVSNKSIRDFIDYKL 525

Query: 607 CNHPDLLDLPDEIAGSTNLIPDDYQ---SAMTHNSRGGRSHVEVQTT------------- 650
              PD     D++      + D Y    +  T N R     ++++               
Sbjct: 526 SEEPD----EDKVTAVIKQMDDIYMEHLNTFTKNQRLQNMMMQLRQVVDSTLLFFFPYME 581

Query: 651 -----------HSSKFAILERF---LFKIKHESNDKIVLISNYTQTLDLIEKMCRYNHYG 696
                       S K  +L++    L K  H    KI++ S +   LDL+E     N + 
Sbjct: 582 PEDITLDYLLASSGKLQMLQKLAIPLIKKGH----KILIFSQFVGMLDLLEDWSELNSFN 637

Query: 697 VLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAA 756
            LR+DG +    R++ +D+FN    +  IFLLS++A G GINL+ A+ +I+ D DWNP  
Sbjct: 638 SLRIDGGVDNESRKEYIDEFNKKGDDHQIFLLSTRAAGLGINLVAADTVIIFDSDWNPQV 697

Query: 757 DQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVE 804
           D QA+ R  R GQ K   +YRF    +IE  I  R   K  L   V++
Sbjct: 698 DLQAMDRCHRIGQTKPVIVYRFCCDNTIEHVILTRAVNKRKLERMVIQ 745

>AGR123C [4434] [Homologous to ScYER164W (CHD1) - SH]
           (980963..985231) [4269 bp, 1422 aa]
          Length = 1422

 Score =  208 bits (530), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 149/488 (30%), Positives = 241/488 (49%), Gaps = 52/488 (10%)

Query: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
           I+ADEMGLGKT+Q ++ +  L+    Q  P     ++V P S +  W     KW  P+  
Sbjct: 378 ILADEMGLGKTVQTVSFISWLIFARRQNGP----HLVVVPLSTMPAWQETFEKW-APELN 432

Query: 387 SPLAIDGRKSSLSNGSVAQSVRQWAIAQG------RNVVKPVLIISYETLRRNVENLKGC 440
               +  +KS          +R++           +N+   VL+ +YE + ++   L   
Sbjct: 433 CVYYMGNQKSR-------DVIREYEFYTNPHTKGKKNIKFNVLLTTYEYILKDRLELGAI 485

Query: 441 KVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLG 500
           K   +  DE HRLKN +S  + SL S     R++++GTP+QN++ E  AL+NF  PG   
Sbjct: 486 KWQFLAVDEAHRLKNAESSLYESLSSFKVANRMLITGTPLQNNIKELAALVNFLMPG--- 542

Query: 501 TRAQFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKY 560
              +F  + EI      D +  D++    E  + +L + +  +I+RR    + K LP K 
Sbjct: 543 ---KFTIDQEI------DFENQDEK---QENYIRDLHKRLQPYILRRLKKDVEKSLPSKT 590

Query: 561 EHILFVNLSPMQKAIYEHFVRSREVAKL--MKGTGSQPLKAIGLLKKLCNHPDLLDLPDE 618
           E IL V LS +Q   Y++ +     A     KGT    L  +  LKK  NHP L      
Sbjct: 591 ERILRVELSDVQTEYYKNILTKNYNALTAGTKGTHFSLLNIMNELKKASNHPYLF----- 645

Query: 619 IAGSTNLIPDDYQSAMTHNSRGGRSHVEVQ---TTHSSKFAILERFLFKIKHESNDKIVL 675
              + N +       +     G RS   +       S K  +L++ L ++K + + ++++
Sbjct: 646 -GNAENRV-------LAKFGDGNRSRENILRGLIMSSGKMVLLDKLLTRLKKDGH-RVLI 696

Query: 676 ISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGC 735
            S   + LD++            RLDGT+  ++R+  +D FN P   +F+FLLS++AGG 
Sbjct: 697 FSQMVRMLDILGDYLSIKGINFQRLDGTVPSSQRRISIDHFNAPDSNDFVFLLSTRAGGL 756

Query: 736 GINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMK 795
           GINL+ A+ +I+ D DWNP AD QA+AR  R GQK    +YRF++  ++EE++ +R   K
Sbjct: 757 GINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKK 816

Query: 796 MSLSSCVV 803
           M L   ++
Sbjct: 817 MILEYAII 824

>YPL082C (MOT1) [5362] chr16 complement(398475..404078)
            Transcriptional Accessory Protein (TAF) involved in RNA
            polymerase II transcriptional repression through
            interaction with TATA-binding protein (TBP), member of
            the Snf2p family of DNA helicases [5604 bp, 1867 aa]
          Length = 1867

 Score =  207 bits (528), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 163/548 (29%), Positives = 261/548 (47%), Gaps = 67/548 (12%)

Query: 320  NRGAYGCIMADEMGLGKTLQCIALMWT---LLRQGSQGRPTIEK----CIIVCPSSLVNN 372
            N+     I+ D+MGLGKTLQ I ++ +   L ++  +   ++E      +I+CP SL  +
Sbjct: 1287 NKYHLHGILCDDMGLGKTLQTICIIASDQYLRKEDYEKTRSVESRALPSLIICPPSLTGH 1346

Query: 373  WANEIVKWLGPDALSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRR 432
            W NE       D  +P     +    + G   +   +  ++        +++ SY+  R 
Sbjct: 1347 WENEF------DQYAPFL---KVVVYAGGPTVRLTLRPQLSDA-----DIIVTSYDVARN 1392

Query: 433  NVENLKGCKVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLN 492
            ++  L   +    + DEGH +KN  S    ++  I    R+IL+GTPIQN++ E ++L +
Sbjct: 1393 DLAVLNKTEYNYCVLDEGHIIKNSQSKLAKAVKEITANHRLILTGTPIQNNVLELWSLFD 1452

Query: 493  FSNPGLLGTRAQFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDIL 552
            F  PG LGT   F++ F  PI   R++  + KE  AG + L  L + V  F++RR  + +
Sbjct: 1453 FLMPGFLGTEKMFQERFAKPIAASRNSKTSSKEQEAGVLALEALHKQVLPFMLRRLKEDV 1512

Query: 553  SKYLPCKYEHILFVNLSPMQKAIYEHFVRSRE--VAKLMKGT----GSQPL-KAIGLLKK 605
               LP K     +  L  +QK +Y  F + ++  V K ++ +    G Q + +A+  ++K
Sbjct: 1513 LSDLPPKIIQDYYCELGDLQKQLYMDFTKKQKNVVEKDIENSEIADGKQHIFQALQYMRK 1572

Query: 606  LCNHPDLLDLPDEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFK- 664
            LCNHP L+  P+         P   Q        G   H      ++ K + L   LF+ 
Sbjct: 1573 LCNHPALVLSPNH--------PQLAQVQDYLKQTGLDLH---DIINAPKLSALRTLLFEC 1621

Query: 665  -IKHESNDK------------------IVLISNYTQTLDLIEKMCRYNHY----GVLRLD 701
             I  E  DK                   ++       LD++E    +  Y      +RLD
Sbjct: 1622 GIGEEDIDKKASQDQNFPIQNVISQHRALIFCQLKDMLDMVENDL-FKKYMPSVTYMRLD 1680

Query: 702  GTMTINKRQKLVDKFN-DPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQA 760
            G++    RQK+V KFN DPS +    LL++K GG G+NL GA+ +I ++ DWNP  D QA
Sbjct: 1681 GSIDPRDRQKVVRKFNEDPSID--CLLLTTKVGGLGLNLTGADTVIFVEHDWNPMNDLQA 1738

Query: 761  LARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVEEKEDVERLFSSENLRP 820
            + R  R GQKK   +YR IT G++EEKI      KM+++S VV ++        +  L  
Sbjct: 1739 MDRAHRIGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIASTVVNQQNSGLASMDTHQLLD 1798

Query: 821  LFQFDSNT 828
            LF  D+ T
Sbjct: 1799 LFDPDNVT 1806

>KLLA0E04048g 375999..378479 similar to sp|P43610 Saccharomyces
           cerevisiae YFR038w, start by similarity
          Length = 826

 Score =  203 bits (517), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 153/521 (29%), Positives = 244/521 (46%), Gaps = 60/521 (11%)

Query: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
           I+ADEMGLGKT+Q IAL+  +    ++G       +I  P S V NW NE  ++  PD  
Sbjct: 219 ILADEMGLGKTIQSIALLAFIYEMDTKG-----PFLIAAPLSTVENWMNEFARF-APD-- 270

Query: 387 SPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCKVGLML 446
               I   K   S G  A+        +  N  + V+I SYE + R++E +   +   ++
Sbjct: 271 ----IPVLKYYNSEGQAARHAMMGKFFKN-NKGEGVIITSYEIIIRDIELILSYQWKFLI 325

Query: 447 ADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFR 506
            DEGHRLKN +      L  IN   R++L+GTP+QN+L E ++LLNF  P +      F 
Sbjct: 326 VDEGHRLKNINCKLIRELKRINTSNRLLLTGTPLQNNLGELWSLLNFILPNIFSDFEIFN 385

Query: 507 KNFEIPILRGRDADATDKEIAAGEVK---LHELSQIVSKFIIRR-TNDILSKYLPCKYEH 562
           K F+   L    +     +I   E++   +  L  I+  F++RR   ++L+  LP K E+
Sbjct: 386 KWFDFSDLNLESSSEKLTKIINDELEKNLISNLHTILKPFLLRRLKKNVLAGSLPPKREY 445

Query: 563 ILFVNLSPMQKAIYEHFVRSREVAKLMKGT------------GSQPLKAIGLLKKLCNHP 610
           I+   ++P+QK  Y+  ++      + K              G+   K+I    +     
Sbjct: 446 IITCPVTPLQKKYYKQALKGNLKQTIQKQAIKDFFTLNAEYIGTVSNKSIRDFIEWKLSA 505

Query: 611 DLLDLPDEIAGSTNLIPDDYQSAMTHNSRGGRSHVE----VQTTH--------------- 651
           D  D+P++  G    + D +      N R     ++    V +T+               
Sbjct: 506 DSQDIPNDNIGKMEKLYDMHIHKELLNKRLQNMMIQLRQIVNSTYLFYFPLLEPTDLTLE 565

Query: 652 -----SSKFAILERF---LFKIKHESNDKIVLISNYTQTLDLIEKMCRYNHYGVLRLDGT 703
                S K  +L++    L K KH    K+++ S +   LDLIE     N++   R+DG+
Sbjct: 566 NLLKTSGKLQVLQKLVPELIKKKH----KVLIFSQFVSMLDLIEDWSELNNFISCRIDGS 621

Query: 704 MTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALAR 763
           M  N R++ +++F+    +  +FLLS++A G GINL  A+ +I+ D DWNP  D QA+ R
Sbjct: 622 MQNNSRKEQIEEFSKKGSKANLFLLSTRAAGLGINLTAADSVIIFDSDWNPQVDLQAMDR 681

Query: 764 VWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVE 804
             R GQ K   +YR     +IE  I  R   K  L   V++
Sbjct: 682 AHRIGQTKPVIVYRLYCDNTIENVIMTRAVNKRKLEKLVIQ 722

>YAL019W (FUN30) [49] chr1 (114922..118317) Member of the Snf2p family
            of DNA-dependent ATPases, involved in resistance to UV
            radiation [3396 bp, 1131 aa]
          Length = 1131

 Score =  204 bits (518), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 172/541 (31%), Positives = 259/541 (47%), Gaps = 74/541 (13%)

Query: 325  GCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPD 384
             CI+AD+MGLGKT Q I+  +  L+Q ++  P     ++V PSS + NW  E  K+    
Sbjct: 592  SCILADDMGLGKTCQVISF-FAYLKQINEPGP----HLVVVPSSTLENWLREFQKFAPAL 646

Query: 385  ALSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETL----RRNVENLKGC 440
             + P            GS+ +      I + RN  K  +I++   L    + +V  LK  
Sbjct: 647  KIEPYY----------GSLQEREELRDILE-RNAGKYDVIVTTYNLAAGNKYDVSFLKNR 695

Query: 441  KVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLG 500
               +++ DEGH LKN  S  F  L  I    R++L+GTP+QN+L E  +LL F  P L  
Sbjct: 696  NFNVVVYDEGHMLKNSTSERFAKLMKIRANFRLLLTGTPLQNNLKELMSLLEFIMPNLFI 755

Query: 501  TRAQFRKNFEIPILRGRDADATDKE----IAAGEVKLHELSQIVSKFIIRRTNDILSKYL 556
            ++   +++F+  I + R     D +    + A E  +     ++  FI+RR  D + K+L
Sbjct: 756  SK---KESFD-AIFKQRAKTTDDNKNHNPLLAQEA-ITRAKTMMKPFILRRRKDQVLKHL 810

Query: 557  PCKYEHILFVNLSPMQKAIYEHFVRSREVAKLMKGTGSQPLKA--------------IGL 602
            P K+ HI +  L+ +QK IY+  ++     K M   G  P  A              I  
Sbjct: 811  PPKHTHIQYCELNAIQKKIYDKEIQIVLEHKRMIKDGELPKDAKEKSKLQSSSSKNLIMA 870

Query: 603  LKKLCNHPDLL--------------DLPDEIA----GSTNLIPDDYQSAMTH-------- 636
            L+K   HP L                + DE A    G+   I +D  S MT         
Sbjct: 871  LRKASLHPLLFRNIYNDKIITKMSDAILDEPAYAENGNKEYIKED-MSYMTDFELHKLCC 929

Query: 637  NSRGGRSHVEVQT---THSSKFAILERFLFKIKHESNDKIVLISNYTQTLDLIEKMCRYN 693
            N     S  ++       S K   L++ L  I  +  +K+++ S +TQ LD++E +    
Sbjct: 930  NFPNTLSKYQLHNDEWMQSGKIDALKKLLKTIIVDKQEKVLIFSLFTQVLDILEMVLSTL 989

Query: 694  HYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWN 753
             Y  LRLDG+  +N RQ L+DKF +   +  IF+LS+KAGG GINL+ AN +I+ D  +N
Sbjct: 990  DYKFLRLDGSTQVNDRQLLIDKFYE-DKDIPIFILSTKAGGFGINLVCANNVIIFDQSFN 1048

Query: 754  PAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVEEKEDVERLF 813
            P  D+QA  R  R GQ K+  I   IT  SIEEKI Q    K++L S + E+K+  + L 
Sbjct: 1049 PHDDRQAADRAHRVGQTKEVNITTLITKDSIEEKIHQLAKNKLALDSYISEDKKSQDVLE 1108

Query: 814  S 814
            S
Sbjct: 1109 S 1109

>ACR286C [1333] [Homologous to ScYAL019W (FUN30) - SH]
            (877337..880396) [3060 bp, 1019 aa]
          Length = 1019

 Score =  199 bits (506), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 157/537 (29%), Positives = 245/537 (45%), Gaps = 80/537 (14%)

Query: 325  GCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPD 384
             CI+ADEMGLGKT Q I+ +  L  Q   G       ++V PSS + NW  E  K+    
Sbjct: 491  SCILADEMGLGKTCQVISFLAYLKEQNHTG-----PHLVVVPSSTLENWLREFKKFCPQL 545

Query: 385  ALSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRN---VENLKGCK 441
             + P            GS  +      I +  +     ++ +Y     N   V  LK  +
Sbjct: 546  KIEPYY----------GSQQERAELRDILEENDGQYDAIVTTYNLASGNKADVSFLKNRQ 595

Query: 442  VGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGT 501
              +++ DEGH LKN  S  FT L  I+   R++L+GTP+QN+L E  +LL F  P L  +
Sbjct: 596  FNVVIYDEGHMLKNSMSERFTKLMKIHANFRLLLTGTPLQNNLRELMSLLEFIMPSLFVS 655

Query: 502  R-----AQFRKNFEIPILRGRDADAT-DKEIAAGEVKLHELSQIVSKFIIRRTNDILSKY 555
            +     A F++       R R +D+  D      +  +     I+  FI+RR  D + K+
Sbjct: 656  KKDELAAVFKQ-------RARTSDSNKDYNPLLAQEAIDRAKTIMKPFILRRRKDQVLKH 708

Query: 556  LPCKYEHILFVNLSPMQKAIYEHFVRSREVAKLMKGTGSQPLKA--------------IG 601
            LP K+ HI + +++P Q+AIY   +R     + M   G  P  A              I 
Sbjct: 709  LPAKHHHIEYCDMTPEQQAIYNREIRLVMEHRRMVRDGVLPTDAGERALVAQSTSKNLIM 768

Query: 602  LLKKLCNHPDLLD---LPDEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTH------- 651
             L+K   HP L       D IA  +  I  + + A +    G R ++    ++       
Sbjct: 769  ALRKAAIHPLLFRHHYSDDRIAEMSERILAEPEYADS----GNRDYIREDMSYMCDLELH 824

Query: 652  --SSKFAILERF------------------LFKIKHESNDKIVLISNYTQTLDLIEKMCR 691
                +F  L  F                  L +      +K ++ S +TQ LD++E +  
Sbjct: 825  RLCCRFPSLASFQLSEPTWMASGKVHRLQPLLRAAIARREKTLVFSLFTQVLDILELVLS 884

Query: 692  YNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGINLIGANRLILMDPD 751
                  LRLDG+  +N RQ L+D+F+  + +  +FLLS+KAGG GINL+ AN +I+ D  
Sbjct: 885  SLGIAFLRLDGSTPVNDRQALIDRFHTDT-DVPVFLLSTKAGGFGINLVCANHVIIFDQS 943

Query: 752  WNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVEEKED 808
            +NP  D+QA  R  R GQ ++  +   ++  ++EEKI Q    K++L S V + + D
Sbjct: 944  FNPHDDRQAADRAHRVGQTREVAVTTLVSRATVEEKILQLARHKLALDSSVSDRRAD 1000

>KLLA0F07513g 707516..710662 similar to sp|P31380 Saccharomyces
            cerevisiae YAL019w FUN30, start by similarity
          Length = 1048

 Score =  199 bits (506), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 154/519 (29%), Positives = 242/519 (46%), Gaps = 55/519 (10%)

Query: 325  GCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPD 384
             CI+ADEMGLGKT Q I+ +   L+Q     P +    +V PSS + NW  E  K+    
Sbjct: 522  SCILADEMGLGKTCQVISFL-AYLKQTHHNGPHL----VVVPSSTLENWLREFNKFCPHL 576

Query: 385  ALSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYET---LRRNVENLKGCK 441
             + P            GS  +      I +       V++ +Y      + +V  L+   
Sbjct: 577  KVEPYY----------GSQQERAELRDILEENEGQYDVIVTTYNLAAGTKYDVSFLRNRN 626

Query: 442  VGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGT 501
              +++ DEGH LKN  S  F  L  IN   R++L+GTP+QN+L E  +LL F  P L  +
Sbjct: 627  FDVVVYDEGHMLKNSMSERFNKLMKINAHFRLLLTGTPLQNNLKELMSLLEFIMPNLFVS 686

Query: 502  RAQFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYE 561
            +            R  DAD     + A E  +     ++  FI+RR  D + K+LP K+ 
Sbjct: 687  KKDDLATVFKQKTRTSDADKGYNPLLA-EHAIERAKTMMKPFILRRKKDQVLKHLPRKHN 745

Query: 562  HILFVNLSPMQKAIY--------EHFVRSREVAKLMKGTGSQPLKAIGLLKKLCNHPDLL 613
            HIL   ++ +QK +Y        EH  + +E  K+ K + +     I  L+K   HP L 
Sbjct: 746  HILHCEMTELQKTLYQQEIKQVMEHRRKIKEGVKMEKASRNVSKNLIMALRKASIHPLLF 805

Query: 614  ------DLPDEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHS--SKFAILERF---- 661
                   +  +++ +    P+ Y++      +   S++     H    KF  L +F    
Sbjct: 806  RHIYNDKIISKMSKAIIAEPEYYENGNIEYIKEDMSYMTDFELHKLCCKFPSLYKFKLQS 865

Query: 662  ---------------LFKIKHESNDKIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTI 706
                           L KI    ++K+++ S +TQ LD++E +    +   LRLDG   +
Sbjct: 866  DEWMNSGKVEQLKSVLHKIIDIQHEKVLVFSLFTQVLDILEFVLSTLNIKFLRLDGQTQV 925

Query: 707  NKRQKLVDKFNDPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWR 766
            N RQ L+D+F +      +FLLS+KAGG GINL+ AN +I+ D  +NP  D+QA  R  R
Sbjct: 926  NDRQSLIDRFYEDDTIP-VFLLSTKAGGFGINLVCANNVIIFDQSFNPHDDRQAADRAHR 984

Query: 767  DGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVEE 805
             GQ K+  +   I+  +IEEKI      K++L + + +E
Sbjct: 985  VGQTKEVQVTTLISRDTIEEKILHLAKNKLALDTHISQE 1023

>Kwal_26.7123
          Length = 1081

 Score =  198 bits (503), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 165/545 (30%), Positives = 254/545 (46%), Gaps = 88/545 (16%)

Query: 321  RGAYGCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKW 380
            R    CI+ADEMGLGKT Q IA + + L+Q ++  P     ++V PSS + NW  E  K+
Sbjct: 540  RNNLSCILADEMGLGKTCQVIAFL-SYLKQNNEPGP----HLVVVPSSTLENWLREFNKF 594

Query: 381  LGPDALSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRN---VENL 437
                 + P            GS  +      I +  +    V++ +Y     N   V  L
Sbjct: 595  CPDLKIEPYY----------GSQQERAELRDILEDNDGQYDVIVTTYNLASGNKYDVSFL 644

Query: 438  KGCKVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPG 497
            K     +++ DEGH LKN  S  FT L  I    R++L+GTP+QN+L E  +LL F  P 
Sbjct: 645  KNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEFIMPN 704

Query: 498  LLGTR-----AQFRKNFEIPILRGRDADAT-DKEIAAGEVKLHELSQIVSKFIIRRTNDI 551
            L  ++     A FR+       R R +D+  D      +  +     ++  FI+RR  D 
Sbjct: 705  LFISKKNDLSAVFRQ-------RARTSDSNKDYNPLLAQEAIARAKTMMKPFILRRRKDQ 757

Query: 552  LSKYLPCKYEHILFVNLSPMQKAIYEHFVRSREVAKLM---------------------- 589
            + K+LP K+  I +  +S +Q+ IY     +RE+ +++                      
Sbjct: 758  VLKHLPHKHSKIEYCEMSDVQRTIY-----NREIQQVLDHKRMLREREEEGSAEEPRPTK 812

Query: 590  KGTGSQPLKAIGL-LKKLCNHPDLLD------LPDEIA------------GSTNLIPDD- 629
            K  G+Q  K + + L+K   HP L        + D+++            G+   I +D 
Sbjct: 813  KNGGAQISKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEYIQEDM 872

Query: 630  -YQSAMTHN---SRGGRSHVEVQT-----THSSKFAILERFLFKIKHESNDKIVLISNYT 680
             Y +    +   +R   S  + Q       +S K   L + L  I     +K+++ S +T
Sbjct: 873  SYMNDFELHRLCTRFPDSLAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLVFSLFT 932

Query: 681  QTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGINLI 740
            Q LD++E      +   LRLDG+  +N RQ L+DKF+D      +F+LS+KAGG GINL+
Sbjct: 933  QMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIP-VFILSTKAGGFGINLV 991

Query: 741  GANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSS 800
             AN +I+ D  +NP  D+QA  R  R GQ K   I   IT  SIEEKI Q    K++L +
Sbjct: 992  CANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLALDT 1051

Query: 801  CVVEE 805
             + E+
Sbjct: 1052 YISED 1056

>Kwal_47.18077
          Length = 809

 Score =  195 bits (495), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 159/527 (30%), Positives = 244/527 (46%), Gaps = 72/527 (13%)

Query: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
           I+ADEMGLGKTLQ IAL+   + +   G P     +I  P S ++ W NE  ++  PD  
Sbjct: 202 ILADEMGLGKTLQSIALL-AFITEMDTGGP----FLIAAPLSTLDTWVNEFSRF-APD-- 253

Query: 387 SPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKP--VLIISYETLRRNVENLKGCKVGL 444
               I   K   + G   QS RQ  + +     K   V+I SYE + R++E +   +   
Sbjct: 254 ----IQVLKYYSTQG---QSYRQSLLKKFFKSTKGQGVVITSYEIIIRDIELILSYQWKF 306

Query: 445 MLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQ 504
           ++ DEGHR+KN +      L  IN   R++++GT +QN+LSE ++LLNF  P +      
Sbjct: 307 LIVDEGHRIKNINCKLIRELKRINTLNRLLITGTALQNNLSELWSLLNFIMPDIFADFEI 366

Query: 505 FRKNFEIPILRGRDADATDKEIAAGEVK---LHELSQIVSKFIIRRTNDI-LSKYLPCKY 560
           F K F+   L  + +      +   E++   +  L  I+  F++RR   + L+  LP K 
Sbjct: 367 FHKWFDFSDLELKSSSQGLNRLINDELEKNLISNLHAILKPFLLRRLKKVVLAGSLPPKR 426

Query: 561 EHILFVNLSPMQKAIYEHFVRSREVAKLMKGTGSQPLKAIGLLK-----KLCNHP--DLL 613
           E+I+   L+ +QK +Y    +S    KL +    Q +K   +L      ++ N    D +
Sbjct: 427 EYIVNCPLTSVQKKLY----KSALNGKLKQAIFKQAIKDFFVLNSDQIGQVSNKSIRDFM 482

Query: 614 DL--------PD-EIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTT-------------- 650
           +         PD EI    + +   +      N R     V+++                
Sbjct: 483 EWKLNANDEDPDTEILQQMDKLYKQHIHRALLNKRLQNPMVQLRQVVDSTLLFFFPFINP 542

Query: 651 ----------HSSKFAILERF---LFKIKHESNDKIVLISNYTQTLDLIEKMCRYNHYGV 697
                      S K  IL++    L K  H    K+++ + +   LDLIE  C  N   V
Sbjct: 543 EKLTLDFLLQSSGKLQILQQLVPPLIKKGH----KVLIFTQFVGMLDLIEDWCELNDVRV 598

Query: 698 LRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAAD 757
            R+DG+M    RQ+ +++FNDP      FL+S++AGG GINL  A+ +IL D DWNP  D
Sbjct: 599 CRIDGSMGNETRQEHIERFNDPDDSFDAFLISTRAGGLGINLTAADSVILFDSDWNPQVD 658

Query: 758 QQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVE 804
            QA  R  R GQ K   +YR     +IE  I  R + K  L   V++
Sbjct: 659 LQATDRTHRIGQTKPVIVYRLCCDNTIEHVILTRAASKRKLEKMVIQ 705

>ADL098C [1643] [Homologous to ScYFR038W (MEI4) - SH]
           (508448..510862) [2415 bp, 804 aa]
          Length = 804

 Score =  194 bits (494), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 153/528 (28%), Positives = 250/528 (47%), Gaps = 75/528 (14%)

Query: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPD-- 384
           I+ADEMGLGKT+Q IAL+  +    ++G       ++  P S+V+NW  E  K+  P   
Sbjct: 209 ILADEMGLGKTIQSIALLAFIYEMDTRG-----PFLVTAPLSVVDNWITEFEKF-APSIP 262

Query: 385 ALSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCKVGL 444
            L   + DG      +  + +  R       +N  + V++ SYE + R++  +   +   
Sbjct: 263 VLKYYSADG--PGKRHAILKEFFR-------KNSGEGVVVTSYEIVMRDMNVILSHQWKF 313

Query: 445 MLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQ 504
           ++ DEGHRLKN +      L  IN   R++L+GTP+QN+L+E ++LLNF  P +      
Sbjct: 314 LIVDEGHRLKNINCKLIRELKRINTFNRLLLTGTPLQNNLAELWSLLNFILPDVFADFEI 373

Query: 505 FRKNFEIPILRGRDADATDKEIAAGEVK---LHELSQIVSKFIIRRTNDI-LSKYLPCKY 560
           F K F+   L  + +     +I   E++   +  L  I+  F++RR   + L+  LP K 
Sbjct: 374 FSKWFDFSDLDLKTSSQRWDKIIGEELEKNLVTNLHTILKPFLLRRLKRVVLADALPPKR 433

Query: 561 EHILFVNLSPMQKAIYEHFVRSREVAKLMKGTGSQPLKAIGLLKK-----LCNHP--DLL 613
           E+I+   L+P+Q   Y+  +      KL +   +Q +K    L +     + N    + +
Sbjct: 434 EYIINCPLTPLQTRFYKMAL----AGKLKRTVFTQAIKEFFTLNREHIGSVSNKTIREFI 489

Query: 614 DL--PDEIAGSTNLIPDD---YQSAMTHNSRGGRSH------------------------ 644
           D    DE   ++ +I D    Y+  +    R  R                          
Sbjct: 490 DYKTSDEEIQASKVITDMEKLYEQHIHKELRNKRLQNLMMQLRQIVDSTFLFYFPYLKAE 549

Query: 645 -----VEVQTTHSSKFAILERFLFKI---KHESNDKIVLISNYTQTLDLIEKMCRYNHYG 696
                V +QT  S K  IL++ L ++   KH    K+++ S +   LDLIE  C  N+Y 
Sbjct: 550 DLQLPVLLQT--SGKLQILQQLLPRLLAAKH----KVLIFSQFVSMLDLIEDWCELNNYS 603

Query: 697 VLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAA 756
             R+DG+M    R++ ++ F++      +FLLS++AGG GINL  A+ +IL D DWNP  
Sbjct: 604 ACRIDGSMDNETRREQINSFSEKGSPHSLFLLSTRAGGLGINLTAADSVILFDNDWNPQV 663

Query: 757 DQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVE 804
           D QA+ R  R GQ+    +YR     ++E  I  R + K  L   V++
Sbjct: 664 DLQAMDRSHRIGQQHPVIVYRLYCDKTVESVILARATNKRKLEQLVIQ 711

>Scas_548.4
          Length = 1054

 Score =  195 bits (495), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 165/563 (29%), Positives = 260/563 (46%), Gaps = 88/563 (15%)

Query: 306  PEILDANAAMTRESNRG----------AYGCIMADEMGLGKTLQCIALMWTLLRQGSQGR 355
            P++LD+   +      G             CI+AD+MGLGKT Q I+  +  L+Q ++  
Sbjct: 487  PKLLDSEVTLKDYQQTGINWLNLLYHNQMSCILADDMGLGKTCQVISF-FAYLKQINEPG 545

Query: 356  PTIEKCIIVCPSSLVNNWANEIVKWLGPDALSPLAIDGRKSSLSNGSVAQSVRQWAIAQG 415
            P +    +V PSS + NW  E  K+     + P            GS  +      I + 
Sbjct: 546  PHL----VVVPSSTLENWLREFQKFCPTLKIEPYY----------GSQNERADLREILER 591

Query: 416  RNVVKPVLIISYETL---RRNVENLKGCKVGLMLADEGHRLKNGDSLTFTSLDSINCPRR 472
                  V++ +Y      + +V  L+  +  +++ DEGH LKN  S  F  L  I    R
Sbjct: 592  TAGQYDVIVTTYNLAAGNKYDVSFLRNRQFNVVVYDEGHMLKNSMSERFNKLMRIQGNFR 651

Query: 473  VILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFRKNFEIPILRGRDADATDKEIAAGEVK 532
            ++L+GTP+QN+L E  +LL F  P L  ++    K     + + R A  TD       + 
Sbjct: 652  LLLTGTPLQNNLRELMSLLEFIMPALFISK----KESLASVFKQR-AKTTDDNKGHNPLL 706

Query: 533  LHELSQ----IVSKFIIRRTNDILSKYLPCKYEHILFVNLSPMQKAIYEHFVRS------ 582
            + E  +    ++  FI+RR  D + K+LP K+  I +  +  +Q+ IY+  +++      
Sbjct: 707  VQEAIERAKTMMKPFILRRRKDQVLKHLPAKHHKIEYCIMQDLQRKIYDSEIKTVMEHKK 766

Query: 583  -----------REVAKLMKGTGSQPLKAIGLLKKLCNHPDL-----------------LD 614
                       +E AK+   + S     I  L+K   HP L                 ++
Sbjct: 767  MILDGTLPDDPKERAKIQSSSSSN---LIMTLRKAALHPLLFRTIYNDALIAKMSKAIIN 823

Query: 615  LPD-EIAGSTNLIPDDYQSAMTH--------NSRGGRSHVEVQT---THSSKFAILERFL 662
             P  ++ G+   I +D  S MT         N     S  +++     +S K   L R L
Sbjct: 824  EPQYKVDGNIEFIKED-MSVMTDFELHRLCLNFPNTLSRYQLKNKEWMNSGKVDTLCRLL 882

Query: 663  FKIKHESNDKIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGE 722
             +I  E  +K+++ S +TQ LD++E +    +Y  LRLDG+  +N RQ L+DKF +    
Sbjct: 883  KEIIFERKEKVLIFSLFTQVLDILELVLSELNYKFLRLDGSTQVNDRQSLIDKFYEDDTI 942

Query: 723  EFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTG 782
              IF+LS+KAGG GINL+ AN +I+ D  +NP  D+QA  R  R GQ K+  I   IT  
Sbjct: 943  P-IFILSTKAGGFGINLVCANNVIIFDQSFNPHDDRQAADRAHRVGQTKEVNITTLITKD 1001

Query: 783  SIEEKISQRPSMKMSLSSCVVEE 805
            SIEEKI Q    K++L S + E+
Sbjct: 1002 SIEEKIFQLAKNKLALDSHISED 1024

>CAGL0H06193g 604422..607802 similar to sp|P31380 Saccharomyces
            cerevisiae YAL019w FUN30, hypothetical start
          Length = 1126

 Score =  191 bits (485), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 159/528 (30%), Positives = 246/528 (46%), Gaps = 72/528 (13%)

Query: 325  GCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPD 384
             CI+AD+MGLGKT Q I+ +   L+Q  Q  P     +IV PSS + NW  E  K+    
Sbjct: 592  SCILADDMGLGKTCQVISFL-AYLKQIGQPSP----HLIVVPSSTLENWLREFQKFCPSL 646

Query: 385  ALSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETL---RRNVENLKGCK 441
             + P            G+  +      I +  +    V++ +Y      + +V  LK   
Sbjct: 647  KIEPYY----------GTQQERADLREILERNDGKYDVIVTTYNLAAGNKYDVSFLKTRN 696

Query: 442  VGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGT 501
              +++ DEGH LKN  S  F  L  I+   R++L+GTP+QN+L E  +LL F  P L  +
Sbjct: 697  FNVVVYDEGHMLKNSMSERFNKLMRIHANFRLLLTGTPLQNNLKELMSLLEFIMPNLFVS 756

Query: 502  RAQFRKNFEIPILRGRDADATDKE----IAAGEVKLHELSQIVSKFIIRRTNDILSKYLP 557
            +    K     + + R   + D +    + A +  +     ++  FI+RR  D + K+LP
Sbjct: 757  K----KESLAAVFKQRAKTSDDNKGHNPLLAQQA-ITRAKTMMKPFILRRRKDQVLKHLP 811

Query: 558  CKYEHILFVNLSPMQKAIYEHFVRSREVAKLMKGTGSQP--------------LKAIGLL 603
             K+    +  ++  Q+ IY   V+     K M   G+ P                 I  L
Sbjct: 812  AKHVRTSYCAMNDTQREIYNREVKLVMEHKQMIRDGTLPEDKKERSKIENNSSKNLIMSL 871

Query: 604  KKLCNHPDLL--------------DLPDEIA----GSTNLIPDDYQSAMTH--------- 636
            +K   HP L                + DE A    G+   I +D  S MT          
Sbjct: 872  RKASIHPLLFRHIYDDAKIDKMCDAILDEPAYAENGNKEYIREDM-SFMTDFELHRLCCN 930

Query: 637  --NSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLISNYTQTLDLIEKMCRYNH 694
              N+ G       +  +S K   L++ L  I ++  +K+++ + +TQ LD++EK+    +
Sbjct: 931  FPNTLGDYQLKNDEWMNSGKVDALKKLLDDIINKKREKVLIFTLFTQVLDILEKVLSTLN 990

Query: 695  YGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNP 754
            Y  LRLDG+  +N RQ ++DKF D +    IF+LS++AGG GINL+ AN +I+ D  +NP
Sbjct: 991  YKFLRLDGSTQVNDRQTMIDKFYDDNTIP-IFMLSTRAGGFGINLVCANHVIIFDQSFNP 1049

Query: 755  AADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSCV 802
              D+QA  R  R GQ K+  +   IT  SIEEKI Q    K++L S V
Sbjct: 1050 HDDRQAADRAHRVGQTKEVTVTTLITKDSIEEKIFQLAKTKLALDSQV 1097

>ADR309W [2050] [Homologous to ScYDR334W (SWR1) - SH]
           complement(1244005..1248465) [4461 bp, 1486 aa]
          Length = 1486

 Score =  132 bits (333), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 91/298 (30%), Positives = 149/298 (50%), Gaps = 24/298 (8%)

Query: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
           I+ADEMGLGKT+Q IAL+  L  +     P +    I+ P+S++ NW  E  K   P   
Sbjct: 693 ILADEMGLGKTIQTIALLAYLACEKENWGPHL----IIVPTSVLLNWEMEF-KRFAP-GF 746

Query: 387 SPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCKVGLML 446
             L+  G     S     +  R W      +V     I SY+ +  +  + K  K   M+
Sbjct: 747 KVLSYYG-----SPQQRKEKRRGWNKLDAFHVC----ITSYQLVVHDQHSFKRKKWQYMI 797

Query: 447 ADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFR 506
            DE H +KN  S  + +L + N  RR++L+GTP+QN+++E ++LL F  P       +  
Sbjct: 798 LDEAHNIKNFKSTRWQALLNFNTRRRLLLTGTPLQNNIAELWSLLYFLMPQTALENGKIS 857

Query: 507 KNFEIPILRGRDADATDKEIAAGEVK--------LHELSQIVSKFIIRRTNDILSKYLPC 558
              ++   +       DK IAA + +        + +L Q++  +++RR    + K +P 
Sbjct: 858 GFADLDAFQQWFGKPVDKIIAANDSEHDDETRRTVSKLHQVLRPYLLRRLKADVEKQMPA 917

Query: 559 KYEHILFVNLSPMQKAIYEHFV-RSREVAKLMKGTGSQPLKAIGLLKKLCNHPDLLDL 615
           KYEHIL+  LS  Q+ +Y+ F+ R++  A L  G     +  +  L+K+CNHPDL ++
Sbjct: 918 KYEHILYCRLSKRQRFLYDDFMSRAQTKATLASGNFMSIINCLMQLRKVCNHPDLFEV 975

 Score =  115 bits (288), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 64/173 (36%), Positives = 99/173 (57%), Gaps = 4/173 (2%)

Query: 654  KFAILERFLFKIKHESNDKIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLV 713
            K   L   L ++K E + + ++ +  T+ LD++E+   Y+ Y  +RLDG   I  RQ L 
Sbjct: 1218 KLQSLAVLLRRLKEEGH-RALIFTQMTKVLDILEQFLNYHGYLYMRLDGATKIEDRQILT 1276

Query: 714  DKFN-DPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKD 772
            ++FN DP     +F+LSS++GG GINL GA+ +I  D DWNPA D+Q   R  R GQ +D
Sbjct: 1277 ERFNTDPRIT--VFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRD 1334

Query: 773  CFIYRFITTGSIEEKISQRPSMKMSLSSCVVEEKEDVERLFSSENLRPLFQFD 825
              IYRF +  +IE  I ++ + K  L + V+++ E     FS  +++ L   D
Sbjct: 1335 VHIYRFASEHTIESNILKKANQKRQLDNIVIQKGEFTTDYFSRLSVKDLLGSD 1387

>Scas_646.3*
          Length = 1456

 Score =  132 bits (333), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 94/303 (31%), Positives = 159/303 (52%), Gaps = 33/303 (10%)

Query: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
           I+ADEMGLGKT+Q I+L+  L  +     P     +IV P+S++ NW  E  ++      
Sbjct: 666 ILADEMGLGKTIQTISLLAYLACEKQNWGP----HLIVVPTSVLLNWEMEFKRFCP---- 717

Query: 387 SPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKP----VLIISYETLRRNVENLKGCKV 442
                 G K     GS  Q   +    +G N  KP    V I+SY+ + ++  + K  K 
Sbjct: 718 ------GLKVLTYYGSPQQRKEK---RKGWN--KPDAFHVCIVSYQLVVQDQHSFKRKKW 766

Query: 443 GLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLL--G 500
             M+ DE H +KN  S  + +L + N  RR++++GTP+QN+L+E ++LL F  P  +  G
Sbjct: 767 QYMVLDEAHNIKNFRSTRWQALLNFNTRRRLLVTGTPLQNNLAELWSLLYFLMPQTVIDG 826

Query: 501 TRAQ-------FRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILS 553
            +         F++ F  P+ +  +  A  ++ A  +  + +L Q++  +++RR    + 
Sbjct: 827 KKVSGFADLDAFQQWFGRPVDKLIETGAGYQQDAETKKTVSKLHQVLRPYLLRRLKADVE 886

Query: 554 KYLPCKYEHILFVNLSPMQKAIYEHFV-RSREVAKLMKGTGSQPLKAIGLLKKLCNHPDL 612
           K +P KYEHI++  LS  Q+ +Y+ F+ RS+  A L  G     +  +  L+K+CNHPDL
Sbjct: 887 KQMPAKYEHIVYCRLSKRQRFLYDDFMSRSQTKATLASGNFMSIVNCLMQLRKVCNHPDL 946

Query: 613 LDL 615
            ++
Sbjct: 947 FEM 949

 Score =  111 bits (278), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 57/152 (37%), Positives = 91/152 (59%), Gaps = 4/152 (2%)

Query: 654  KFAILERFLFKIKHESNDKIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLV 713
            K   L + L  +K ++  + ++ +  T+ LD++E+   Y+ Y  +RLDG   +  RQ L 
Sbjct: 1190 KLQKLAKLLQDLK-DNGHRALIFTQMTKVLDVLERFLNYHGYIYMRLDGATKVEDRQILT 1248

Query: 714  DKFN-DPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKD 772
            ++FN DP     +F+LSS++GG GINL GA+ +I  D DWNPA D+Q   R  R GQ +D
Sbjct: 1249 ERFNNDPRVT--VFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRD 1306

Query: 773  CFIYRFITTGSIEEKISQRPSMKMSLSSCVVE 804
              IYRF++  +IE  I ++ + K  L + V++
Sbjct: 1307 VHIYRFVSEHTIESNILKKANQKRQLDNVVIQ 1338

>Kwal_55.20143
          Length = 1494

 Score =  132 bits (332), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 94/302 (31%), Positives = 152/302 (50%), Gaps = 31/302 (10%)

Query: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
           I+ADEMGLGKT+Q I+L+  L  +     P +    I+ P+S++ NW  E  K   P   
Sbjct: 693 ILADEMGLGKTIQTISLLAYLACEKHNWGPHL----IIVPTSVLLNWEMEF-KRFAP--- 744

Query: 387 SPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCKVGLML 446
                 G K     GS  Q  ++      R     V I SY+ +  +  + K  K   M+
Sbjct: 745 ------GFKVLTYYGS-PQQRKEKRKGWNRPDAFHVCITSYQLVVHDQHSFKRKKWQYMI 797

Query: 447 ADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRA--- 503
            DE H +KN  S  + +L + N  RR++L+GTP+QN+L+E ++LL F  P   GT     
Sbjct: 798 LDEAHNIKNFRSTRWQALLNFNTERRLLLTGTPLQNNLAELWSLLYFLMPQTAGTNGGIQ 857

Query: 504 ------QFRKNFEIP---ILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSK 554
                  F++ F  P   I++  +  A D+E      KLH   Q++  +++RR    + K
Sbjct: 858 GFADLEAFQQWFGRPVDKIIQTGEGYAQDEETRKTVTKLH---QVLRPYLLRRLKADVEK 914

Query: 555 YLPCKYEHILFVNLSPMQKAIYEHFV-RSREVAKLMKGTGSQPLKAIGLLKKLCNHPDLL 613
            +P K+EH+++  LS  Q+ +Y+ F+ R++    L  G     +  +  L+K+CNHPDL 
Sbjct: 915 QMPAKHEHVVYCRLSKRQRFLYDDFMSRAQTKETLSSGNFMSIINCLMQLRKVCNHPDLF 974

Query: 614 DL 615
           ++
Sbjct: 975 EV 976

 Score =  110 bits (274), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 81/133 (60%), Gaps = 1/133 (0%)

Query: 672  KIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSK 731
            + ++ +  T+ LD++E+   Y+ Y  +RLDG   I +RQ L ++FN        F+LSS+
Sbjct: 1235 RALIFTQMTKVLDVLEQFLNYHGYLYMRLDGATKIEERQILTERFN-TDNRITAFILSSR 1293

Query: 732  AGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQR 791
            +GG GINL GA+ +I  D DWNPA D+Q   R  R GQ +D  IYRF++  +IE  I ++
Sbjct: 1294 SGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSEHTIESNILKK 1353

Query: 792  PSMKMSLSSCVVE 804
             + K  L + V++
Sbjct: 1354 ANQKRQLDNVVIQ 1366

>YDR334W (SWR1) [1163] chr4 (1135923..1140467) Member of the Snf2p DNA
            helicase ATPase family [4545 bp, 1514 aa]
          Length = 1514

 Score =  130 bits (326), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 98/306 (32%), Positives = 156/306 (50%), Gaps = 39/306 (12%)

Query: 327  IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
            I+ADEMGLGKT+Q I+L+  L  +     P +    IV P+S++ NW  E  K   P   
Sbjct: 718  ILADEMGLGKTIQTISLLAYLACEKENWGPHL----IVVPTSVLLNWEMEF-KRFAP--- 769

Query: 387  SPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKP----VLIISYETLRRNVENLKGCKV 442
                  G K     GS  Q   +    +G N  KP    V I+SY+ + ++  + K  + 
Sbjct: 770  ------GFKVLTYYGSPQQRKEK---RKGWN--KPDAFHVCIVSYQLVVQDQHSFKRKRW 818

Query: 443  GLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLL--G 500
              M+ DE H +KN  S  + +L + N  RR++L+GTP+QN+L+E ++LL F  P  +  G
Sbjct: 819  QYMVLDEAHNIKNFRSTRWQALLNFNTQRRLLLTGTPLQNNLAELWSLLYFLMPQTVIDG 878

Query: 501  TRAQ-------FRKNFEIP---ILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTND 550
             +         F++ F  P   I+        DKE      KLH   Q++  +++RR   
Sbjct: 879  KKVSGFADLDAFQQWFGRPVDKIIETGQNFGQDKETKKTVAKLH---QVLRPYLLRRLKA 935

Query: 551  ILSKYLPCKYEHILFVNLSPMQKAIYEHFV-RSREVAKLMKGTGSQPLKAIGLLKKLCNH 609
             + K +P KYEHI++  LS  Q+ +Y+ F+ R++  A L  G     +  +  L+K+CNH
Sbjct: 936  DVEKQMPAKYEHIVYCKLSKRQRFLYDDFMSRAQTKATLASGNFMSIVNCLMQLRKVCNH 995

Query: 610  PDLLDL 615
            P+L ++
Sbjct: 996  PNLFEV 1001

 Score =  117 bits (292), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 90/151 (59%), Gaps = 1/151 (0%)

Query: 672  KIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSK 731
            + ++ +  T+ LD++E+   Y+ Y  +RLDG   I  RQ L ++FN  S    +F+LSS+
Sbjct: 1264 RALIFTQMTKVLDVLEQFLNYHGYLYMRLDGATKIEDRQILTERFNTDS-RITVFILSSR 1322

Query: 732  AGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQR 791
            +GG GINL GA+ +I  D DWNPA D+Q   R  R GQ +D  IYRF++  +IE  I ++
Sbjct: 1323 SGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSEHTIESNILKK 1382

Query: 792  PSMKMSLSSCVVEEKEDVERLFSSENLRPLF 822
             + K  L + V++E +     FS  ++R L 
Sbjct: 1383 ANQKRQLDNVVIQEGDFTTDYFSKLSVRDLL 1413

>CAGL0M01188g complement(132330..136682) similar to sp|Q05471
           Saccharomyces cerevisiae YDR334w, start by similarity
          Length = 1450

 Score =  129 bits (323), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 93/303 (30%), Positives = 158/303 (52%), Gaps = 33/303 (10%)

Query: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
           I+ADEMGLGKT+Q I+L+  L  +     P +    IV P+S++ NW  E  K   P   
Sbjct: 650 ILADEMGLGKTIQTISLLSYLACEKHNWGPHL----IVVPTSVLLNWEMEF-KRFAP--- 701

Query: 387 SPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKP----VLIISYETLRRNVENLKGCKV 442
                 G K     G+  Q   +    +G N  KP    V I+SY+ + ++  + K  K 
Sbjct: 702 ------GFKVLTYYGNPQQRKEK---RKGWN--KPDAFHVCIVSYQLIVQDQHSFKRKKW 750

Query: 443 GLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLL--G 500
             M+ DE H +KN  S  + +L + N  RR++L+GTP+QN+++E ++LL F  P  +  G
Sbjct: 751 QYMVLDEAHNIKNFRSTRWQALLNFNTQRRILLTGTPLQNNIAELWSLLYFLMPQTVIDG 810

Query: 501 TRAQ-------FRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILS 553
            +         F++ F  P+ +  +   T ++    +  + +L Q++  +++RR    + 
Sbjct: 811 QKVSGFADLDAFQQWFGRPVDKLIETGGTYEQDNETKRTVEKLHQVLRPYLLRRLKADVE 870

Query: 554 KYLPCKYEHILFVNLSPMQKAIYEHFV-RSREVAKLMKGTGSQPLKAIGLLKKLCNHPDL 612
           K +P KYEHI++  LS  Q+ +Y+ F+ R++  A L  G     +  +  L+K+CNHPDL
Sbjct: 871 KQIPGKYEHIVYCKLSKRQRFLYDDFMSRAQTKATLASGNFMSIVNCLMQLRKVCNHPDL 930

Query: 613 LDL 615
            ++
Sbjct: 931 FEV 933

 Score =  117 bits (293), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 92/155 (59%), Gaps = 3/155 (1%)

Query: 672  KIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFN-DPSGEEFIFLLSS 730
            + ++ +  T+ LD++E+   Y+ Y  +RLDG   I  RQ L ++FN DP     +F+LSS
Sbjct: 1196 RALIFTQMTKVLDILEQFLNYHGYLYMRLDGATKIEDRQILTERFNSDPKIT--VFILSS 1253

Query: 731  KAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQ 790
            ++GG GINL GA+ +I  D DWNPA D+Q   R  R GQ +D  IYRF++  +IE  I +
Sbjct: 1254 RSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSEHTIESNILK 1313

Query: 791  RPSMKMSLSSCVVEEKEDVERLFSSENLRPLFQFD 825
            + + K  L   ++++ E     FS  +++ LF  D
Sbjct: 1314 KANQKRQLDDVIIQKGEFTTDYFSKLSVKDLFGSD 1348

>KLLA0F21758g complement(2023805..2028523) similar to sp|Q05471
            Saccharomyces cerevisiae YDR334w SWR1 DEAH-box protein,
            putative RNA helicase, hypothetical start
          Length = 1572

 Score =  126 bits (317), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 96/303 (31%), Positives = 150/303 (49%), Gaps = 33/303 (10%)

Query: 327  IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
            I+ADEMGLGKT+Q I+L+  L  +     P +    IV P+S++ NW  E  K   P   
Sbjct: 787  ILADEMGLGKTIQTISLLAYLACEKENWGPHL----IVVPTSVLLNWEMEF-KRFAP--- 838

Query: 387  SPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCKVGLML 446
                  G K     GS  Q  R+      +     V I SY+ +  +  + K  K   M+
Sbjct: 839  ------GFKVLTYYGS-PQQRREKRKGWNKPDAFHVCITSYQLVVHDQHSFKRKKWQYMI 891

Query: 447  ADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNP---------- 496
             DE H +KN  S  + +L + N  RR++L+GTP+QN+L+E ++LL F  P          
Sbjct: 892  LDEAHNIKNFRSTRWQALLNFNTERRLLLTGTPLQNNLAELWSLLYFLMPQTALENGKVS 951

Query: 497  GLLGTRAQFRKNFEIP---ILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILS 553
            G     A F++ F  P   I+   +    D+E      KLH   Q++  +++RR    + 
Sbjct: 952  GFADLDA-FQQWFGRPVDKIVETGENYEQDEETKKTVSKLH---QVLRPYLLRRLKADVE 1007

Query: 554  KYLPCKYEHILFVNLSPMQKAIYEHFV-RSREVAKLMKGTGSQPLKAIGLLKKLCNHPDL 612
            K +P KYEHI++  LS  Q+ +Y+ F+ R++    L  G     +  +  L+K+CNHPDL
Sbjct: 1008 KQMPGKYEHIIYCRLSKRQRFLYDDFMSRAQTKETLASGNFMSIINCLMQLRKVCNHPDL 1067

Query: 613  LDL 615
             ++
Sbjct: 1068 FEV 1070

 Score =  110 bits (276), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 59/170 (34%), Positives = 98/170 (57%), Gaps = 4/170 (2%)

Query: 654  KFAILERFLFKIKHESNDKIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLV 713
            K   L + L  +K ++  + ++ +  T+ LD++E+   ++ Y  +RLDG   I  RQ L 
Sbjct: 1311 KLQKLAQLLQNLK-DNGHRALIFTQMTKVLDILEQFLNFHGYLYMRLDGATKIEDRQILT 1369

Query: 714  DKFN-DPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKD 772
            ++FN DP     +F+LSS++GG GINL GA+ +I  D DWNPA D+Q   R  R GQ +D
Sbjct: 1370 ERFNSDPRIT--VFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRD 1427

Query: 773  CFIYRFITTGSIEEKISQRPSMKMSLSSCVVEEKEDVERLFSSENLRPLF 822
              IYRF++  +IE  I ++ + K  L + V++  +     F+  +++ L 
Sbjct: 1428 VHIYRFVSDHTIESNILKKANQKRHLDNVVIQTGDFTTDYFTKLSVKDLL 1477

>Scas_669.20
          Length = 1397

 Score =  120 bits (301), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 83/302 (27%), Positives = 144/302 (47%), Gaps = 28/302 (9%)

Query: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
           I+ADEMGLGKT+Q I+++  L  + +   P     ++V P+S ++NW NEI K++    +
Sbjct: 667 ILADEMGLGKTVQSISVLAHLAEKHNIWGP----YLVVTPASTLHNWVNEITKFVPQFKI 722

Query: 387 SPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKP----VLIISYETLRRNVENLKGCKV 442
            P           N +  + +R++   +     K     V+I SY+ +  +V  L+  K 
Sbjct: 723 LPY--------WGNAADRKVLRKFWDRKNLRYTKDSPFHVMITSYQMVVSDVTYLQKMKW 774

Query: 443 GLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTR 502
             M+ DE   +K+  S  + +L S +C  R++L+GTPIQN++ E +ALL+F  P L  + 
Sbjct: 775 QYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTPIQNNMQELWALLHFIMPSLFDSH 834

Query: 503 AQFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEH 562
            +F + F   I    +A+           +L  L  I+  F++RR    +   L  K E 
Sbjct: 835 DEFSEWFAKDIESHAEANT-----QLNHQQLRRLHMILKPFMLRRVKKNVQSELGDKIEI 889

Query: 563 ILFVNLSPMQKAIYEHFVRSREVAKLMKGTGSQPLKA-------IGLLKKLCNHPDLLDL 615
            +  +L+  Q  +Y+    +     +    GS    +       +   +K+CNHPDL + 
Sbjct: 890 DVLCDLTQRQAKLYQVLKSTSNYDAIENAAGSDEFSSDQNLVNTVMQFRKVCNHPDLFER 949

Query: 616 PD 617
            D
Sbjct: 950 AD 951

 Score =  112 bits (280), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 58/157 (36%), Positives = 90/157 (57%), Gaps = 2/157 (1%)

Query: 650  THSSKFAILERFLFKIKHESNDKIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKR 709
            T S+K   L+  L ++K E + ++++    T+ +DL+E+   Y  Y  +RLDG+  +  R
Sbjct: 1217 TESAKLKKLDELLVQLKREGH-RVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLEDR 1275

Query: 710  QKLVDKFNDPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQ 769
            + LV  +     E F+FLLS++AGG GINL  A+ +I  D DWNP  D QA+ R  R GQ
Sbjct: 1276 RDLVHDWQ-TKPEIFVFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQ 1334

Query: 770  KKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVEEK 806
             +   +YR +  G+IEE++  R   K  +   V+E K
Sbjct: 1335 TRQVTVYRLLIRGTIEERMRDRAKQKEQVQQVVMEGK 1371

>Kwal_27.11388
          Length = 1334

 Score =  117 bits (293), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 86/304 (28%), Positives = 144/304 (47%), Gaps = 30/304 (9%)

Query: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
           I+ADEMGLGKT+Q I+++  L    +   P     I+V P+S ++NW NEI K+L    +
Sbjct: 616 ILADEMGLGKTVQSISVLAHLAENYNIWGP----FIVVTPASTLHNWVNEISKFLPDFKI 671

Query: 387 SPLAIDGRKSSLSNGSVAQSVRQ-WAIAQ---GRNVVKPVLIISYETLRRNVENLKGCKV 442
            P           NG+  + +R+ W   Q   G++    V++ SY+ +  +   L+  K 
Sbjct: 672 LPY--------WGNGNDRKILRRFWDRKQFRYGKDAPFHVMVTSYQMVVSDAAYLQKMKW 723

Query: 443 GLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTR 502
             M+ DE   +K+  S  + +L S +C  R++L+GTPIQN++ E +ALL+F  P L  + 
Sbjct: 724 QYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTPIQNNMQELWALLHFIMPSLFDSH 783

Query: 503 AQFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEH 562
            +F   F   I     ++         + +L  L  I+  F++RR    +   L  K E 
Sbjct: 784 DEFSDWFSKDIESHAQSNT-----KLNQQQLRRLHMILKPFMLRRIKKNVQSELGEKIEI 838

Query: 563 ILFVNLSPMQKAIYEHFVRSREVA--KLMKGTGSQP-------LKAIGLLKKLCNHPDLL 613
            +  +L+  Q  +Y+        A   +    GS         +  +   +K+CNHPDL 
Sbjct: 839 DVMCDLTRRQHKLYQVLKSQMSAAYDAIENAAGSDEASSDQNIVNTVMQFRKVCNHPDLF 898

Query: 614 DLPD 617
           +  D
Sbjct: 899 ERED 902

 Score =  111 bits (278), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 63/167 (37%), Positives = 95/167 (56%), Gaps = 7/167 (4%)

Query: 650  THSSKFAILERFLFKIKHESNDKIVLIS-NYTQTLDLIEKMCRYNHYGVLRLDGTMTINK 708
            T S+K   L+  L  +K   ND  VLI    T+ +DL+E+   +  Y  +RLDG+  +  
Sbjct: 1167 TESTKLKKLDELLVNLK--KNDHRVLIYFQMTKMMDLMEEYLSFRQYKHIRLDGSSKLED 1224

Query: 709  RQKLVDKFNDPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDG 768
            R+ LV  +     E FIFLLS++AGG GINL  A+ +I  D DWNP  D QA+ R  R G
Sbjct: 1225 RRDLVHDWQ-TKPEIFIFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLG 1283

Query: 769  QKKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVE---EKEDVERL 812
            Q +   +YR +  G+IEE++  R   K  +   V+E   +++D+++L
Sbjct: 1284 QTRQVTVYRLLIRGTIEERMRDRAKQKEQVQQVVMEGKTQEKDIQQL 1330

>YGL150C (INO80) [1838] chr7 complement(221107..225576) Member of the
            Snf2p-like family of probable DNA helicases [4470 bp,
            1489 aa]
          Length = 1489

 Score =  115 bits (289), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 84/311 (27%), Positives = 146/311 (46%), Gaps = 37/311 (11%)

Query: 327  IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
            I+ADEMGLGKT+Q I+++  L    +   P     ++V P+S ++NW NEI K+L    +
Sbjct: 728  ILADEMGLGKTVQSISVLAHLAENHNIWGP----FLVVTPASTLHNWVNEISKFLPQFKI 783

Query: 387  SPLAIDGRKSSLSNGSVAQSVRQW----AIAQGRNVVKPVLIISYETLRRNVENLKGCKV 442
             P           N +  + +R++     +   +N    V++ SY+ +  +   L+  K 
Sbjct: 784  LPY--------WGNANDRKVLRKFWDRKNLRYNKNAPFHVMVTSYQMVVTDANYLQKMKW 835

Query: 443  GLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTR 502
              M+ DE   +K+  S  + +L S +C  R++L+GTPIQN + E +ALL+F  P L  + 
Sbjct: 836  QYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTPIQNSMQELWALLHFIMPSLFDSH 895

Query: 503  AQFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEH 562
             +F + F   I    +A+         + +L  L  I+  F++RR    +   L  K E 
Sbjct: 896  DEFNEWFSKDIESHAEANT-----KLNQQQLRRLHMILKPFMLRRVKKNVQSELGDKIEI 950

Query: 563  ILFVNLSPMQKAIY--------------EHFVRSREVAKLMKGTGSQP--LKAIGLLKKL 606
             +  +L+  Q  +Y              E+   +   +     +GS    + A+   +K+
Sbjct: 951  DVLCDLTQRQAKLYQVLKSQISTNYDAIENAATNDSTSNSASNSGSDQNLINAVMQFRKV 1010

Query: 607  CNHPDLLDLPD 617
            CNHPDL +  D
Sbjct: 1011 CNHPDLFERAD 1021

 Score =  114 bits (284), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/157 (37%), Positives = 91/157 (57%), Gaps = 2/157 (1%)

Query: 650  THSSKFAILERFLFKIKHESNDKIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKR 709
            T S+K   L+  L K+K E + ++++    T+ +DL+E+   Y  Y  +RLDG+  +  R
Sbjct: 1296 TESAKLRKLDELLVKLKSEGH-RVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLEDR 1354

Query: 710  QKLVDKFNDPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQ 769
            + LV  +   + E F+FLLS++AGG GINL  A+ +I  D DWNP  D QA+ R  R GQ
Sbjct: 1355 RDLVHDW-QTNPEIFVFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQ 1413

Query: 770  KKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVEEK 806
             +   +YR +  G+IEE++  R   K  +   V+E K
Sbjct: 1414 TRQVTVYRLLVRGTIEERMRDRAKQKEQVQQVVMEGK 1450

>YFR038W (YFR038W) [1720] chr6 (229367..231928) Member of the
           Snf2/Rad54 subfamily of NTP-dependent DNA helicases
           [2562 bp, 853 aa]
          Length = 853

 Score =  115 bits (287), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 85/262 (32%), Positives = 135/262 (51%), Gaps = 29/262 (11%)

Query: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
           I+ADEMGLGKT+Q IAL+  +    ++G       ++  P S ++NW NE  K+  PD L
Sbjct: 244 ILADEMGLGKTVQSIALLAFIYEMDTKG-----PFLVTAPLSTLDNWMNEFAKF-APD-L 296

Query: 387 SPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKP-----VLIISYETLRRNVENLKGCK 441
             L   G     +NG   +S      A+ +N  K      ++I SYE + R+ + +    
Sbjct: 297 PVLKYYG-----TNGYKERS------AKLKNFFKQHGGTGIVITSYEIILRDTDLIMSQN 345

Query: 442 VGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGT 501
              ++ DEGHRLKN +      L  IN   R++L+GTP+QN+L+E ++LLNF  P +   
Sbjct: 346 WKFLIVDEGHRLKNINCRLIKELKKINTSNRLLLTGTPLQNNLAELWSLLNFIMPDIFAD 405

Query: 502 RAQFRKNFEIPILR---GRDADATDKEIAAGEVK--LHELSQIVSKFIIRRTND-ILSKY 555
              F K F+   L    G +++A +K I     K  +  L  I+  F++RR    +L+  
Sbjct: 406 FEIFNKWFDFDSLNLGSGSNSEALNKLINDELQKNLISNLHTILKPFLLRRLKKVVLANI 465

Query: 556 LPCKYEHILFVNLSPMQKAIYE 577
           LP K E+I+   ++  Q+  Y+
Sbjct: 466 LPPKREYIINCPMTSAQEKFYK 487

 Score =  111 bits (278), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 56/153 (36%), Positives = 87/153 (56%), Gaps = 1/153 (0%)

Query: 652 SSKFAILERFLFKIKHESNDKIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQK 711
           S K  IL++ +  +  E + K+++ S +   LDLIE  C  N +   R+DG++    R+ 
Sbjct: 602 SGKLQILQKLIPPLISEGH-KVLIYSQFVNMLDLIEDWCDLNSFATFRIDGSVNNETRKD 660

Query: 712 LVDKFNDPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 771
            ++KFN    +  IFLLS++A G GINL+GA+ ++L D DWNP  D QA+ R  R GQ+ 
Sbjct: 661 QLEKFNSSKDKHNIFLLSTRAAGLGINLVGADTVVLFDSDWNPQVDLQAMDRCHRIGQES 720

Query: 772 DCFIYRFITTGSIEEKISQRPSMKMSLSSCVVE 804
              +YR     +IE  I  R + K +L   V++
Sbjct: 721 PVIVYRLCCDNTIEHVILTRAANKRNLERMVIQ 753

>Sklu_1582.2 , Contig c1582 197-1048
          Length = 283

 Score =  108 bits (271), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 57/163 (34%), Positives = 90/163 (55%), Gaps = 4/163 (2%)

Query: 645 VEVQTTHSSKFAILERFLFKIKHESNDKIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTM 704
           ++V    S K  IL++ + K+ +E + K+++ S +   LDLIE  C  N +   R+DG+M
Sbjct: 26  LDVLLQTSGKLQILQQLVPKLINEGH-KVLIFSQFVNMLDLIEDWCELNDFQACRIDGSM 84

Query: 705 TINKRQKLVDKFNDPSGEEF---IFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQAL 761
               RQ+ + KFN  + +     +FLLS++AGG GINL  A+ +++ D DWNP  D QA+
Sbjct: 85  DNEVRQEQIGKFNSKTTDSHANDVFLLSTRAGGLGINLTAADSVVIFDSDWNPQVDLQAM 144

Query: 762 ARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVE 804
            R  R GQ +   +YR     ++E  I  R   K  L   V++
Sbjct: 145 DRTHRIGQDRPVIVYRLCCDNTVEHVILTRAVSKRKLEKLVIQ 187

>Scas_520.5
          Length = 863

 Score =  114 bits (286), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 56/153 (36%), Positives = 86/153 (56%), Gaps = 1/153 (0%)

Query: 652 SSKFAILERFLFKIKHESNDKIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQK 711
           S K   L+R +  +  + + KI++ S +   LDL+E  C  N     R+DGT+    R++
Sbjct: 650 SGKLKTLQRLVIPLIAKGH-KILIFSQFVNMLDLLEDWCDLNSLAAFRIDGTIDNESRKE 708

Query: 712 LVDKFNDPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 771
            + KFND   +  +FLLS++A G G+NL+GA+ ++L D DWNP  D QA+ R  R GQ K
Sbjct: 709 QLSKFNDKKNKHMVFLLSTRAAGLGVNLVGADTVVLFDSDWNPQVDLQAMDRCHRIGQTK 768

Query: 772 DCFIYRFITTGSIEEKISQRPSMKMSLSSCVVE 804
              +YRF    ++E  I  R + K  L   V++
Sbjct: 769 PVIVYRFCCDNTLEHVILTRAANKRKLERLVIQ 801

 Score =  114 bits (284), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 79/260 (30%), Positives = 129/260 (49%), Gaps = 27/260 (10%)

Query: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDA- 385
           I+AD+MGLGKT+Q IAL+  +    ++G       +I  P S V+NW NE  K+  PD  
Sbjct: 293 ILADDMGLGKTIQSIALLAFIYEMDTKG-----PFLIAAPLSTVDNWMNEFEKF-APDLP 346

Query: 386 ----LSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCK 441
                 P   + R   + N         +    G  +V    + SYE + R+ + +   +
Sbjct: 347 VLKYYHPGGKNERNKLMRNF--------FKKTNGTGIV----VTSYEIIIRDADYIMSKQ 394

Query: 442 VGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGT 501
              ++ DEGHRLKN +      L  IN   R++L+GTP+QN+L+E ++LLNF  P +   
Sbjct: 395 WKFLIVDEGHRLKNVNCRLIQELKRINTSNRLLLTGTPLQNNLAELWSLLNFIMPDIFTD 454

Query: 502 RAQFRKNFEIPILRGRDADATDKEIAAGEVK---LHELSQIVSKFIIRRTND-ILSKYLP 557
              F K F+   L      +   ++   E++   +  L  I+  F++RR    +L+  LP
Sbjct: 455 FEIFNKWFDFKDLEMESNSSKLNKVINEELQKNLISNLHTILKPFLLRRLKKTVLANILP 514

Query: 558 CKYEHILFVNLSPMQKAIYE 577
            K E+++   L+P+QK  Y+
Sbjct: 515 PKREYVVNCPLTPIQKKFYK 534

>CAGL0E05038g 488549..493003 similar to sp|P53115 Saccharomyces
            cerevisiae YGL150c INO80, hypothetical start
          Length = 1484

 Score =  114 bits (285), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 64/158 (40%), Positives = 90/158 (56%), Gaps = 4/158 (2%)

Query: 650  THSSKFAILERFLFKIKHESNDKIVLIS-NYTQTLDLIEKMCRYNHYGVLRLDGTMTINK 708
            T S+K   L+  L ++K   ND  VLI    T+ +DL+E+   Y  Y  +RLDG+  +  
Sbjct: 1292 TESAKLKKLDELLVELK--KNDHRVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLED 1349

Query: 709  RQKLVDKFNDPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDG 768
            R+ LV  +   + E FIFLLS++AGG GINL  A+ +I  D DWNP  D QA+ R  R G
Sbjct: 1350 RRDLVHDWQ-TNPEIFIFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLG 1408

Query: 769  QKKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVEEK 806
            Q K   +YR +  G+IEE++  R   K  +   V+E K
Sbjct: 1409 QTKQVTVYRLLVRGTIEERMRDRAKQKEQVQQVVMEGK 1446

 Score =  113 bits (282), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 85/322 (26%), Positives = 147/322 (45%), Gaps = 61/322 (18%)

Query: 327  IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
            I+ADEMGLGKT+Q I+++  L    +   P     ++V P+S ++NW NEI K++    +
Sbjct: 744  ILADEMGLGKTVQSISVLAHLAEHHNIWGP----FLVVTPASTLHNWVNEISKFVPQFKI 799

Query: 387  SPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKP----------------VLIISYETL 430
             P                     W  A  R V++                 V+I SY+ +
Sbjct: 800  LPY--------------------WGSANDRKVLRKFWDRKNLRYSEKSPFHVMITSYQMV 839

Query: 431  RRNVENLKGCKVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFAL 490
              +   L+  K   M+ DE   +K+  S  + +L S +C  R++L+GTPIQN++ E +AL
Sbjct: 840  VADASYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTPIQNNMQELWAL 899

Query: 491  LNFSNPGLLGTRAQFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTND 550
            L+F  P L  +  +F + F   I    + ++     +  + +L  L  I+  F++RR   
Sbjct: 900  LHFIMPSLFDSHDEFNEWFSRDIESHAEGNS-----SLNQQQLRRLHMILKPFMLRRIKK 954

Query: 551  ILSKYLPCKYEHILFVNLSPMQKAIYEHFVRSR-------------EVAKLMKGTGSQP- 596
             +   L  K E  +  +L+  Q  +Y+  ++S+             E + +  G  S   
Sbjct: 955  NVQSELGDKIEIDVMCDLTQRQTKLYQ-VLKSQMSSNYDAIENAAAEGSDIAGGGNSDQS 1013

Query: 597  -LKAIGLLKKLCNHPDLLDLPD 617
             + A+   +K+CNHPDL +  D
Sbjct: 1014 IINAVMQFRKVCNHPDLFERAD 1035

>KLLA0E08965g complement(797861..802330) similar to sp|P53115
            Saccharomyces cerevisiae YGL150c INO80, hypothetical
            start
          Length = 1489

 Score =  114 bits (285), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 68/209 (32%), Positives = 113/209 (54%), Gaps = 16/209 (7%)

Query: 615  LPDEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQT-----THSSKFAILERFLFKIKHES 669
            +P E    T + P  + ++ T       S++E+ +     T S+K   L+  L K+K E 
Sbjct: 1283 IPIEELPVTEMAPKAFNNSFT-------SYIEMPSMDRFITESAKLKKLDELLVKLKEED 1335

Query: 670  NDKIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLS 729
            + ++++    T+ +DL+E+   Y  Y  +RLDG+  ++ R+ LV  +     + FIFLLS
Sbjct: 1336 H-RVLIYFQMTKMMDLMEEYLTYRQYTHIRLDGSSKLDDRRDLVHDWQ-TKPDIFIFLLS 1393

Query: 730  SKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKIS 789
            ++AGG GINL  A+ +I  D DWNP  D QA+ R  R GQ +   +YR +  G+IEE++ 
Sbjct: 1394 TRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTRQVTVYRLLIRGTIEERMR 1453

Query: 790  QRPSMKMSLSSCVVE--EKEDVERLFSSE 816
             R   K  +   V+E   KE+ +++   E
Sbjct: 1454 DRAKQKEHVQQVVMEGKAKENKQKIIEVE 1482

 Score =  113 bits (283), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 83/306 (27%), Positives = 152/306 (49%), Gaps = 34/306 (11%)

Query: 327  IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
            I+ADEMGLGKT+Q I+++  L  + +   P     I+V P+S ++NW NEI +++    +
Sbjct: 768  ILADEMGLGKTVQSISVLAHLADRYNIWGP----FIVVTPASTLHNWVNEISRFVPQFKI 823

Query: 387  SPLAIDGRKSSLSNGSVAQSVRQW----AIAQGRNVVKPVLIISYETLRRNVENLKGCKV 442
             P           N +  +++R++     +  GR+    V++ SY+ +  +   L+  K 
Sbjct: 824  LPY--------WGNANDRKTLRKFWDRKHLRYGRDAPFHVMVTSYQMVVSDASYLQKMKW 875

Query: 443  GLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTR 502
              M+ DE   +K+  S  + +L S +C  R++L+GTPIQN++ E +ALL+F  P L  + 
Sbjct: 876  QYMILDEAQAIKSSQSSRWKTLLSFHCRNRLLLTGTPIQNNMQELWALLHFIMPSLFDSH 935

Query: 503  AQFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEH 562
             +F   F   I    +++         + +L  L  ++  F++RR    +   L  K E 
Sbjct: 936  DEFSDWFSKDIESHAESNT-----ELNQEQLRRLHMVLKPFMLRRIKKNVQSELGDKIEI 990

Query: 563  ILFVNLSPMQKAIYEHFVRSREVA----KLMKGTGSQPL----KAIGLL---KKLCNHPD 611
             +  +L+  Q  +Y+  V   +V+     +    G+  +    K + L+   +K+CNHPD
Sbjct: 991  DVLCDLTFRQAKLYQ--VLKSQVSGGYDAIENAAGNDDVTSDQKLVNLVMEFRKVCNHPD 1048

Query: 612  LLDLPD 617
            L +  D
Sbjct: 1049 LFERAD 1054

>AGR379W [4690] [Homologous to ScYGL150C (INO80) - SH]
            complement(1426843..1431087) [4245 bp, 1414 aa]
          Length = 1414

 Score =  113 bits (283), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 89/157 (56%), Gaps = 2/157 (1%)

Query: 650  THSSKFAILERFLFKIKHESNDKIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKR 709
            T S+K   L+  L ++K     ++++    T+ +DLIE+   Y  Y  +RLDG+  +  R
Sbjct: 1237 TESAKLKKLDELLVRLK-AGEHRVLIYFQMTRMMDLIEEYLTYRQYKHIRLDGSSKLEDR 1295

Query: 710  QKLVDKFNDPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQ 769
            + LV  +   S + FIFLLS++AGG GINL  A+ +I  D DWNP  D QA+ R  R GQ
Sbjct: 1296 RDLVHDWQTKS-DIFIFLLSTRAGGLGINLTSADTVIFYDSDWNPTIDSQAMDRAHRLGQ 1354

Query: 770  KKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVEEK 806
             K   +YR +  G+IEE++  R   K  +   V+E K
Sbjct: 1355 TKQVTVYRLLIKGTIEERMRDRAKQKEHVQQVVMEGK 1391

 Score =  113 bits (282), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 84/312 (26%), Positives = 146/312 (46%), Gaps = 39/312 (12%)

Query: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386
           I+ADEMGLGKT+Q I+++  L  + +   P     I+V P+S ++NW NEI K++    +
Sbjct: 677 ILADEMGLGKTVQSISVLAHLAERYNIWGP----FIVVTPASTLHNWVNEIQKFVPDFKI 732

Query: 387 SPLAIDGRKSSLSNGSVAQSVRQW----AIAQGRNVVKPVLIISYETLRRNVENLKGCKV 442
            P           NG+  + +R++     +   ++    V+I SY+ +  +   L+  K 
Sbjct: 733 LPY--------WGNGNDRKILRRFWDRKHLRYSKDAPFHVMITSYQMIVSDAAYLQKMKW 784

Query: 443 GLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTR 502
             M+ DE   +K+  S  + +L S +C  R++L+GTPIQN + E +ALL+F  P L  + 
Sbjct: 785 QYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTPIQNSMQELWALLHFIMPSLFDSH 844

Query: 503 AQFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEH 562
            +F   F   I                + +L  L  I+  F++RR    +   L  K E 
Sbjct: 845 DEFNDWFSKDI-----ESHAQSNTQLNQQQLRRLHMILKPFMLRRIKKNVQSELGDKIEI 899

Query: 563 ILFVNLSPMQKAIYEHFVRSREVAKL-----------------MKGTGSQPLKAIGLLKK 605
            +  +L+  Q  +Y+  ++S+  A                   M  + S+ +  +   +K
Sbjct: 900 DVMCDLTHRQAKLYQ-VLKSQVSASYDAIENAASNSSGDDSGNMSLSDSKIMNTVMEFRK 958

Query: 606 LCNHPDLLDLPD 617
           +CNHPDL +  D
Sbjct: 959 VCNHPDLFERAD 970

>AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH]
            complement(830240..833497) [3258 bp, 1085 aa]
          Length = 1085

 Score = 93.2 bits (230), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 57/160 (35%), Positives = 87/160 (54%), Gaps = 6/160 (3%)

Query: 649  TTHSSKFAILERFLFKIKHES-NDKIVLISNYTQTLDLIEKMCRYNHYG----VLRLDGT 703
            T  SSK   L R L  ++  S N+++V+ S ++  LD++E   R +       + + DG 
Sbjct: 906  TKKSSKIVALIRHLKHLQDTSANEQVVVFSQFSSYLDILENELRQSFASDICEIYKFDGR 965

Query: 704  MTINKRQKLVDKFNDPSGEEF-IFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALA 762
            + + +R  ++ KF + S  +  + LLS KAGG G+NL  A+   +MDP W+P  + QA+ 
Sbjct: 966  LDLKERSNVLAKFTEKSLVKMKVLLLSLKAGGVGLNLTCASHAFIMDPWWSPGMEDQAMD 1025

Query: 763  RVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSCV 802
            R+ R GQ     IYRFI   SIEEK+ +    K SL   V
Sbjct: 1026 RIHRIGQSNTVKIYRFIVENSIEEKMLRIQEKKRSLGEFV 1065

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 83/335 (24%), Positives = 144/335 (42%), Gaps = 55/335 (16%)

Query: 325 GCIMADEMGLGKTLQCIALMWTL------LRQGSQGRP-----------------TIEKC 361
           G I+ADEMGLGKT+  +AL+  +      L   +Q +P                 T    
Sbjct: 455 GGILADEMGLGKTISILALITMVPSDTKHLLTTAQEKPPVGHLSLELGISTVKPYTASTT 514

Query: 362 IIVCPSSLVNNWANEIVKWLGPDAL-SPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVK 420
           +IV P SL+  W NE V+    + L   +   G  S+L    V Q      +     VV+
Sbjct: 515 LIVVPMSLLPQWRNEFVRVNDGNGLYCEVYYAGNVSNLRTLLVKQKSPPSVVLTTYGVVQ 574

Query: 421 P----VLIISYETLRRNVENLKGCKVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILS 476
                +    YE    + E L   +   ++ DEGH ++N  + T  ++ ++   R+ +L+
Sbjct: 575 TEWSKLQQFDYEA---SNEGLFSVEFFRIILDEGHNIRNRTTKTSKAVMALTSRRKWVLT 631

Query: 477 GTPIQNDLSEYFALLNFSNPGLLGTRAQFRKNFEIPILRGRDADATDKEIAAGEVKLHEL 536
           GTPI N L + F+L+ F N         F    +I   R   +D  +K+  +  +++  +
Sbjct: 632 GTPIMNRLDDLFSLIKFMN---------FEPWCKIDYWRQFVSDPFEKKDYSSALEV--I 680

Query: 537 SQIVSKFIIRRTNDILSK------YLPCKYEHILFVNLSPMQKAIYEHFVRSREVA---K 587
             ++   ++RRT ++  +       LP K   I  +  S  +  +Y++F+   E +    
Sbjct: 681 QAVMGPILLRRTKNMKDEDGNPLVQLPPKEVVIEMIRFSDTEAGLYKYFLSKAEHSVKES 740

Query: 588 LMKGTGSQPLKAIGL----LKKLCNHPDLLDLPDE 618
           L +G   +    I L    L+++C H  LL   DE
Sbjct: 741 LARGDLLKKYSTILLHILRLRQVCCHFKLLGSQDE 775

>AAR147W [335] [Homologous to ScYOR191W (RIS1) - SH]
            complement(608865..613607) [4743 bp, 1580 aa]
          Length = 1580

 Score = 90.1 bits (222), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 115/215 (53%), Gaps = 15/215 (6%)

Query: 622  STNLIPDDYQSAMTHNSRGGRSHVEV--QTTHSSK-----FAILERFLFKIKHESNDKIV 674
            ST+ + ++Y++ MT      +   ++  +  H SK       I++  L    + +++K++
Sbjct: 1366 STDELREEYENEMTKRRHKLKYDYQLNFENLHQSKKVQQCLGIIKTVL---DNSTDEKLI 1422

Query: 675  LISNYTQTLDLIEKMCR-YNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAG 733
            + S +T   D+++   +   +   LR DGTM  N R  ++++F     E  + L+S KAG
Sbjct: 1423 VFSQFTTFFDILQFFIKKVLNVSYLRYDGTMNGNVRASVIERFYREKNERLL-LISMKAG 1481

Query: 734  GCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPS 793
              G+ L  AN +IL+DP WNP  ++QA+ R +R  Q+++ +I+R +   +IE++I +  +
Sbjct: 1482 NSGLTLTCANHVILVDPFWNPYVEEQAMDRCYRISQQREVYIHRLLLKNTIEDRIVELQN 1541

Query: 794  MKMSLSSCVVEEKE--DVERLFSSENLRPLFQFDS 826
             K +L    ++  E  +V RL   E L  LF  +S
Sbjct: 1542 RKRTLVENAMDPTELREVNRLGRQE-LGFLFGINS 1575

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 82/353 (23%), Positives = 150/353 (42%), Gaps = 71/353 (20%)

Query: 325  GCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPD 384
            G ++AD+MGLGKT+Q IALM            T +  ++V P +++  W +EI   +   
Sbjct: 917  GGLLADDMGLGKTVQAIALMLA----NRSADSTCKTNLVVGPVAVLRVWHDEINTKVKKQ 972

Query: 385  ALSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLR------------- 431
            A   + I G       G   + V  +      +VV    ++SY+TL              
Sbjct: 973  AQFSVMIYG-------GFGGKKVENFKAMHNYDVV----LVSYQTLAVEFKKHWPARLQG 1021

Query: 432  -----------RNVENLKGCKVG---------------LMLADEGHRLKNGDSLTFTSLD 465
                        +++ +   K+                 ++ DE   +KN  +    +  
Sbjct: 1022 TSENGGQLPEVASIKAMNSMKLRNEYWSPFFSDDSNFYRIILDEAQNIKNKQTQAAKACC 1081

Query: 466  SINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFRKNFEIPIL-RGRDADATDK 524
            ++N   R  LSGTPIQN++ E ++LL F          +F+++    +L RG D D+ D 
Sbjct: 1082 TLNGTYRWALSGTPIQNNILELYSLLRFLRIAPYNREQKFKEDIGNALLSRGGDFDSMDT 1141

Query: 525  EIAAGEVKLHELSQIVSKFIIRR--TNDILSK---YLPCKY----EHILFVNLSPMQKAI 575
            + A  +V++     ++   ++RR  T+ I  +    LP K+    E IL        K++
Sbjct: 1142 KRALKKVRV-----LLRAIMLRRAKTSQINGQPILELPAKHIRKKEDILDGQDLEFYKSL 1196

Query: 576  -YEHFVRSREVAKLMKGTGSQPLKAIGL-LKKLCNHPDLLDLPDEIAGSTNLI 626
             +E  +++R +    K + S  +  + L L++ C H +L+ L    A  T ++
Sbjct: 1197 EHETAIQARALLNERKASSSSNILTLLLRLRQACCHQELVKLGKAKAIGTRVV 1249

>KLLA0F17479g complement(1601287..1604631) similar to sp|P32849
            Saccharomyces cerevisiae YLR032w RAD5 DNA helicase, start
            by similarity
          Length = 1114

 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 57/179 (31%), Positives = 97/179 (54%), Gaps = 7/179 (3%)

Query: 651  HSSKFAILERFLFKIKHES-NDKIVLISNYTQTLDLIEKMCRY----NHYGVLRLDGTMT 705
             S+K   L R L +I+  S  ++I++ S ++  LD++E   R     +   + + DG + 
Sbjct: 937  QSTKIKALLRHLKQIQETSPGEQIIVFSQFSSFLDILEIELRSHLPRDQVIIYKFDGRLD 996

Query: 706  INKRQKLVDKFNDPSGEEF-IFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARV 764
            + +R +++++F+D       + LLS K GG G+NL  A+R  +MDP W+P  + QA+ R+
Sbjct: 997  MKERTRILEQFHDKDLSCIKLLLLSLKTGGVGLNLTCASRAFMMDPWWSPGMEDQAIDRI 1056

Query: 765  WRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVEEKEDVERLFSSENLRPLFQ 823
             R GQ++   + RFI   S+EEK+ +    K  L   +VE  E   R    E ++ LFQ
Sbjct: 1057 HRIGQQQTVKVVRFIIDNSVEEKMLRIQERKRMLGD-IVEGDEAERRQKRIEEIQMLFQ 1114

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 85/337 (25%), Positives = 140/337 (41%), Gaps = 69/337 (20%)

Query: 325 GCIMADEMGLGKTLQCIALMWTL-----------------------------LRQGSQGR 355
           G I+ADEMGLGKT+  +AL+ T                              LR      
Sbjct: 479 GGILADEMGLGKTISALALICTASYDEAHEKKIESTKKPSMKEMSSQVDSSPLRHSQHKH 538

Query: 356 PTI--EKCIIVCPSSLVNNWANEIVKWLGPDALSPLAIDGRKSSLSNGSVAQSVRQWAIA 413
            T      +IV P SL+N W +E  K     A   L    ++  +  G+  + +R + + 
Sbjct: 539 DTYAYRTTLIVVPMSLLNQWQSEFEK-----ANKDLK---KRCEIYYGNNIKDLRAYVL- 589

Query: 414 QGRN----VVKPVLIISYETLRRNVENLKGCKVGLMLADEGHRLKNGDSLTFTSLDSINC 469
            G N    ++    II  E  R +   L       ++ DEGH ++N  + T  ++ ++  
Sbjct: 590 -GPNAPSVIITTYGIIQSEYGRTSTSGLFNVVFFRIILDEGHTIRNRSTRTSKAVIALRS 648

Query: 470 PRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFRKNFEIPILRGRDADATDKEIAAG 529
            R+ IL+GTPI N L + F+L+ F N         +++   +P  +G  A A D      
Sbjct: 649 SRKWILTGTPIINRLDDLFSLVQFLNLEPWSHINYWKRYVSVPFEKGNYAQAFDV----- 703

Query: 530 EVKLHELSQIVSKFIIRRT---NDILSK---YLPCKYEHILFVNLSPMQKAIYEHFVRSR 583
                 ++ ++   ++RRT    D+  K    LP K   +  + LS  +K +Y+  +   
Sbjct: 704 ------INAVLEPVLLRRTKNMKDVDGKPLVSLPPKEVIVEKLQLSSSEKRVYQSMLEDA 757

Query: 584 EVA---KLMKG----TGSQPLKAIGLLKKLCNHPDLL 613
           E +    L KG      +  L  I  L+++C H DLL
Sbjct: 758 ENSVKEGLAKGDLLKNYTNILVHILRLRQVCCHLDLL 794

>ADL345C [1395] [Homologous to ScYBR114W (RAD16) - SH]
           (100332..102572) [2241 bp, 746 aa]
          Length = 746

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 90/172 (52%), Gaps = 2/172 (1%)

Query: 652 SSKFAILERFLFKIKHESND-KIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQ 710
           S+K   L   L+ ++  +   K ++ S +T  LDL+E   +   +   +L G+MT  +R 
Sbjct: 574 STKIEALLEELYNLRSSTRTIKSIVFSQFTSMLDLVEWRLKRAGFQTAKLQGSMTPTQRA 633

Query: 711 KLVDKFNDPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQK 770
           + ++ F D    E +FL+S KAGG  +NL  A+++ ++DP WNP+ + Q+  RV R GQ 
Sbjct: 634 ETINYFMDNVHCE-VFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQH 692

Query: 771 KDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVEEKEDVERLFSSENLRPLF 822
           +   I RF    SIE +I +    K ++    + + E      +  +L+ LF
Sbjct: 693 RPVKITRFCIEDSIESRIIELQEKKANMIHATLGQDEGAVNRLTPADLQFLF 744

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 57/184 (30%), Positives = 92/184 (50%), Gaps = 21/184 (11%)

Query: 317 RESNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANE 376
           +E+N    G ++ADEMG+GKT+Q I    +LL   ++G PT+    +V P+  +  W NE
Sbjct: 156 QENNERYRGGVLADEMGMGKTVQMI----SLLLHANKG-PTL----VVAPTVALIQWKNE 206

Query: 377 IVKWLGPDALSPLAIDG-RKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNV- 434
           I K+ G  AL  L   G  +S++S    A  V    +     V++ V     +  RR   
Sbjct: 207 IDKYTG-GALRSLVFHGPGRSAVSEELAAADV----VLTTYAVLESVYRKQTQGFRRKAG 261

Query: 435 -----ENLKGCKVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFA 489
                  L       ++ DE H +K+  S T  S++++   RR  L+GTP+QN + E ++
Sbjct: 262 VVREQSPLHAVDFYRVVLDEAHNIKDRSSGTARSVNALRAVRRWCLTGTPLQNRIGEMYS 321

Query: 490 LLNF 493
           L+ F
Sbjct: 322 LIRF 325

>Kwal_14.1868
          Length = 1357

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 69/119 (57%), Gaps = 2/119 (1%)

Query: 671  DKIVLISNYTQTLDLIEKMCRYN-HYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLS 729
            +KI++ S +T   DL++   R +     LR DG+M    R   +++F   S E  I L+S
Sbjct: 1195 EKIIVFSQFTTFFDLLQHFIRKDLGAQYLRYDGSMDSQSRAATIEEFYR-SLERRILLIS 1253

Query: 730  SKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKI 788
             KAG  G+ L  AN +IL+DP WNP  ++QA+ R +R  Q +D  ++R +   S+E++I
Sbjct: 1254 MKAGNAGLTLTCANHVILIDPFWNPFVEEQAMDRCYRISQTRDVQVHRLLVKNSVEDRI 1312

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 83/350 (23%), Positives = 150/350 (42%), Gaps = 80/350 (22%)

Query: 318  ESNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKC---IIVCPSSLVNNWA 374
            +SNR   G ++AD+MGLGKT+Q IALM          +  +E C   +IV P +++  W 
Sbjct: 691  KSNRK--GGLLADDMGLGKTVQAIALMLA-------NKSGVENCKTNLIVAPVAVLRVWQ 741

Query: 375  NEI-VKWLGPDALSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRR- 432
             E+  K      L  L   G      NG+  ++ R         +   V+++SY+TL   
Sbjct: 742  AEVKTKVKKTSGLKVLIYGG-----GNGAKVENYRSL-------LRHDVVLVSYQTLASE 789

Query: 433  -------------------NVENLKG------------------CKVGLMLADEGHRLKN 455
                               ++ +LK                    K   ++ DE   +KN
Sbjct: 790  LKKHWPARLSEDSEEAKITDIPDLKALNSLKERKEYWSPFYCNESKFYRIILDEAQNIKN 849

Query: 456  GDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFRKNFEIPILR 515
              + +  +  +++   R  LSGTP+QN++ E ++L+ F          +F+ +   P+ +
Sbjct: 850  KKTQSAKACCTLDATYRWALSGTPMQNNIMELYSLIRFLKISPYKREQKFKLDIGNPLGK 909

Query: 516  G-RDADATDKEIAAGEVKLHELSQIVSKFIIRRTND--ILSKYLPCKYEHILFVNLSPMQ 572
               D D+ D++ A  +V++     ++   ++RRT D  I  K +    E I+      +Q
Sbjct: 910  ATNDYDSHDRQQAIKKVQV-----LLRAIMLRRTKDSKIDGKPILELPEKIITNREDVLQ 964

Query: 573  KAIYEHFV-----RSREVAKLM----KGTGSQPLKAIGLLKKLCNHPDLL 613
             A  + +        ++V KL+    KG+ S  L  +  L++ C HP+L+
Sbjct: 965  GAELQFYSDLEAKNQKKVEKLLNNRAKGSYSSILTLLLRLRQACCHPELV 1014

>CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces
            cerevisiae YLR032w RAD5, hypothetical start
          Length = 1151

 Score = 84.0 bits (206), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 54/177 (30%), Positives = 96/177 (54%), Gaps = 7/177 (3%)

Query: 653  SKFAILERFLFKIKHES-NDKIVLISNYTQTLDLIE----KMCRYNHYGVLRLDGTMTIN 707
            +K   L R L +++  S  +++V+ S ++  LD++E    ++   N   V + DG +++ 
Sbjct: 975  AKLNALIRHLQQLQDSSAGEQVVVFSQFSSYLDILESQLNEVYSSNKLKVYKFDGRLSLK 1034

Query: 708  KRQKLVDKFN-DPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWR 766
            +R  +++ F       + + LLS KAGG G+NL  A+   +MDP W+P+ + QA+ R+ R
Sbjct: 1035 ERTAVLEDFKVKDYAVQKVLLLSLKAGGVGLNLTCASYAFMMDPWWSPSMEDQAIDRIHR 1094

Query: 767  DGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVEEKEDVERLFSSENLRPLFQ 823
             GQ     + RF+  GSIEEK+ +    K +L    ++  ED  R    E ++ LF+
Sbjct: 1095 IGQTNSVKVIRFVIDGSIEEKMLRIQDRKRTLGEA-MDTDEDERRKRRIEEIQMLFE 1150

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 74/309 (23%), Positives = 125/309 (40%), Gaps = 62/309 (20%)

Query: 320 NRGAYGCIMADEMGLGKTLQCIALMW-----------TLLRQGSQGRPT----------- 357
           N    G I++DEMGLGKT+  ++L+            +L  Q S    +           
Sbjct: 503 NSFKNGGILSDEMGLGKTISALSLVLMRPKDEHTTSQSLFHQESSNLSSDDVIEIKEPER 562

Query: 358 ---IEKCIIVCPSSLVNNWANEIVKWLGPDALS-PLAIDGRKSSLSNGSVAQSVRQWAIA 413
               +  +I+ P SL+  W +E  K      L+  L   G  SSL +  + +      + 
Sbjct: 563 SYAYKTTLIIVPMSLLTQWRDEFDKVNNNAGLTCELYYGGNVSSLKSLLIKRKNPPTVVL 622

Query: 414 QGRNVVKPVLIISYETLRRNVENLK--GCKVGL-------MLADEGHRLKNGDSLTFTSL 464
               +V+      +  L ++  N++  G   G+       ++ DEGH ++N  ++T  ++
Sbjct: 623 TTYGIVQN----EWTKLSKDGTNIRSLGRTSGIFSIEFFRIILDEGHTIRNKSTITSKAV 678

Query: 465 DSINCPRRVILSGTPIQNDLSEYFALLNFSNP---GLLGTRAQFRKNFEIPILRGRDADA 521
             ++   R IL+GTPI N L + ++L+ F        +G   QF  N   P        A
Sbjct: 679 LELSSKYRWILTGTPIINRLDDLYSLVKFLKLEPWSQIGYWKQFITN---PFEERNFKQA 735

Query: 522 TDKEIAAGEVKLHELSQIVSKFIIRRTNDILSK------YLPCKYEHILFVNLSPMQKAI 575
            D            ++ I+   ++RRT  +          LP K   I  + LS  QK I
Sbjct: 736 FDV-----------VNAIMEPVLLRRTKQMKDTDGNPLVQLPPKEIVIEKLQLSKKQKLI 784

Query: 576 YEHFVRSRE 584
           YE F++  E
Sbjct: 785 YEEFLQRAE 793

>Kwal_47.17771
          Length = 972

 Score = 83.6 bits (205), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 55/158 (34%), Positives = 86/158 (54%), Gaps = 6/158 (3%)

Query: 671 DKIVLISNYTQTLDLIE---KMC-RYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEF-I 725
           ++IV+ S ++  LD+IE     C   +   V + DG +++ +R K++  F         I
Sbjct: 816 EQIVVFSQFSSFLDIIETEISSCFSKSTTKVYKFDGRLSMKERSKVLQDFAVKDMTRLKI 875

Query: 726 FLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIE 785
            LLS KAGG G+NL  A+R  +MDP W+P+ + QA+ R+ R GQ  +  + RFI   SIE
Sbjct: 876 LLLSLKAGGVGLNLTCASRAYMMDPWWSPSLEDQAIDRIHRIGQVNNVKVVRFIIEHSIE 935

Query: 786 EKISQRPSMKMSLSSCVVEEKEDVERLFSSENLRPLFQ 823
           EK+ +    K +L    V+  ED  R    E ++ LF+
Sbjct: 936 EKMLRIQERKRTLGEA-VDADEDERRKRRIEEIKMLFE 972

 Score = 66.6 bits (161), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 86/350 (24%), Positives = 138/350 (39%), Gaps = 79/350 (22%)

Query: 325 GCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKC----------------------- 361
           G I+ADEMGLGKT+  +A++ T+    S G+  + +                        
Sbjct: 335 GGILADEMGLGKTISILAMILTVPSDSSYGKEKLREASESPDPEISVLGSQWSGGSKPYA 394

Query: 362 ----IIVCPSSLVNNWANEIVKWLGP-DALSPLAIDGRKSSLSNGSVAQSVRQWAIAQGR 416
               ++V P SL++ W  E  K     +A   +   G  SSL            ++    
Sbjct: 395 SGTTLVVVPMSLLSQWQQEFEKASSSKEATCEIYYGGNTSSLK-----------SLLTKT 443

Query: 417 NVVKPVLIISYETLRR--------------NVENLKGCKVGLMLADEGHRLKNGDSLTFT 462
                VLI +Y T++               +V  L   +   ++ DEGH ++N ++ T  
Sbjct: 444 KSPPTVLITTYGTVQHEWSRLLNKNGQMDTDVSGLFSVEFFRIVIDEGHTIRNRNTRTSR 503

Query: 463 SLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFRKNFEIPILRGRDADAT 522
           SL  +   R  IL+GTPI N L + ++L+ F           ++     P  +     A 
Sbjct: 504 SLMDLKSTRSWILTGTPIINRLDDLYSLVKFMRLEPWSQIGYWKTFVSDPFEKKNYKAAF 563

Query: 523 DKEIAAGEVKLHELSQIVSKFIIRRTN---DILSK---YLPCKYEHILFVNLSPMQKAIY 576
           D            +S I+   I+RRT    D+  K    LP K   I  V  +  + A+Y
Sbjct: 564 DI-----------VSSILEPVILRRTKGMRDVDGKRLVELPPKEVIIEKVAFNKNEDALY 612

Query: 577 EHFVRSREVA--------KLMKGTGSQPLKAIGLLKKLCNHPDLLDLPDE 618
           ++F+   E +         L+K   S  L  I  L+++C H DLL   DE
Sbjct: 613 KYFLNKAESSVKEGLDRGDLLKKY-STILVHILRLRQVCCHADLLGSQDE 661

>Kwal_23.3660
          Length = 768

 Score = 82.8 bits (203), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 51/172 (29%), Positives = 91/172 (52%), Gaps = 2/172 (1%)

Query: 652 SSKFAILERFLFKIKHESND-KIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQ 710
           S+K   L   L+ ++ +    K ++ S +T  LDL+E   +   +  ++L G+MT  +R 
Sbjct: 596 STKIEALVEELYNLRSDRRTIKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMTPTQRD 655

Query: 711 KLVDKFNDPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQK 770
           + +  F D +  E +FL+S KAGG  +NL  A+++ ++DP WNP+ + Q+  RV R GQ 
Sbjct: 656 QTIKYFMDNTHCE-VFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQY 714

Query: 771 KDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVEEKEDVERLFSSENLRPLF 822
           +   I RF    SIE +I +    K ++    + + +      +  +L+ LF
Sbjct: 715 RPVKITRFCIEDSIESRIIELQEKKANMIHATINQDDAAINRLTPGDLQFLF 766

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 86/185 (46%), Gaps = 34/185 (18%)

Query: 325 GCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPD 384
           G ++ADEMG+GKT+Q IAL    L      +P++    +V P+  +  W NEI +  G  
Sbjct: 183 GGVLADEMGMGKTIQTIAL----LMNDVTKKPSL----VVAPTVALMQWKNEIEQHTGGK 234

Query: 385 ALSPLAIDGRKSS-----------LSNGSVAQSV---RQWAIAQGRNVVKPVLIISYETL 430
             + +     ++S           L+  +V +SV   + +   +   V K   ++     
Sbjct: 235 LKTHIFHGANRTSNVGEFKDVDVLLTTYAVLESVFRKQNYGFKRKSGVYKEPSVLHNMNF 294

Query: 431 RRNVENLKGCKVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFAL 490
            R            ++ DE H +K+  S T  +++S+   ++  L+GTP+QN + E ++L
Sbjct: 295 YR------------VILDEAHNIKDRQSNTAKAVNSLLTEKKWCLTGTPLQNRIGEMYSL 342

Query: 491 LNFSN 495
           + F N
Sbjct: 343 IRFLN 347

>CAGL0K07766g 770935..773427 highly similar to sp|P31244
           Saccharomyces cerevisiae YBR114w RAD16 DNA repair
           protein, start by similarity
          Length = 830

 Score = 82.8 bits (203), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 90/172 (52%), Gaps = 2/172 (1%)

Query: 652 SSKFAILERFLFKIKHESND-KIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQ 710
           S+K   L   L+K++      K ++ S +T  LDL+E   +   +  ++L G+M+  +R 
Sbjct: 658 STKIEALVEELYKLRSPVKTVKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMSPTQRD 717

Query: 711 KLVDKFNDPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQK 770
           + +  F D    E +FL+S KAGG  +NL  A+++ ++DP WNP+ + Q+  RV R GQ 
Sbjct: 718 QTIKYFMDNIECE-VFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQY 776

Query: 771 KDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVEEKEDVERLFSSENLRPLF 822
           +   I RF    SIE +I +    K ++    + + E      +  +L+ LF
Sbjct: 777 RPVKITRFCIEDSIEARIIELQEKKANMIHATINQDEAAINRLTPADLQFLF 828

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 87/181 (48%), Gaps = 30/181 (16%)

Query: 325 GCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPD 384
           G ++ADEMG+GKT+Q IAL    L      +P++    +V P+  +  W NEI +     
Sbjct: 246 GGVLADEMGMGKTIQTIAL----LMNDRSKKPSL----VVAPTVALMQWKNEIEQHTN-G 296

Query: 385 ALSPLAIDGRKSS------------LSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRR 432
           ALS     G   +            L+  SV +SV +    Q     +   ++  ++L  
Sbjct: 297 ALSTYIYHGASRTINIHDLKDIDVILTTYSVLESVFR---KQNYGFRRKNGLVKEKSLLH 353

Query: 433 NVENLKGCKVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLN 492
           N++  +       + DE H +K+  S T  +++++   +R  LSGTP+QN + E ++L+ 
Sbjct: 354 NIDFYRA------ILDEAHNIKDRTSNTSRAVNALKTQKRWCLSGTPLQNRIGEMYSLIR 407

Query: 493 F 493
           F
Sbjct: 408 F 408

>KLLA0B09240g complement(810178..812580) similar to sp|P31244
           Saccharomyces cerevisiae YBR114w RAD16 nucleotide
           excision repair protein, start by similarity
          Length = 800

 Score = 82.4 bits (202), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 90/172 (52%), Gaps = 2/172 (1%)

Query: 652 SSKFAILERFLFKIKHESND-KIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQ 710
           S+K   L   L+ ++ +    K ++ S +T  LDL+E   +   +  ++L G+MT  +R 
Sbjct: 628 STKIEALVEELYNLRSDKRTIKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMTPTQRD 687

Query: 711 KLVDKFNDPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQK 770
           + +  F +    E +FL+S KAGG  +NL  A+++ ++DP WNP+ + Q+  RV R GQ 
Sbjct: 688 QTIKYFMENIHCE-VFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQF 746

Query: 771 KDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVEEKEDVERLFSSENLRPLF 822
           +   I RF    SIE +I +    K S+    + + E      +  +L+ LF
Sbjct: 747 RPVKITRFCIEDSIESRIIELQEKKASMIHATINQDEAAINRLTPADLQFLF 798

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 83/177 (46%), Gaps = 18/177 (10%)

Query: 325 GCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPD 384
           G ++ADEMG+GKT+Q IAL+ + + +    +P++    +V P+  +  W NEI +     
Sbjct: 215 GGVLADEMGMGKTIQTIALLMSDITR----KPSL----VVAPTVALMQWKNEIEQHTNK- 265

Query: 385 ALSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLK------ 438
            LS     G   + + G          I     V++ V        +R    +K      
Sbjct: 266 KLSVYMYHGANRTNNLGDFKDVD---VILTTYAVLESVYRKQVYGFKRKAGTVKEKSLLH 322

Query: 439 GCKVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSN 495
                 ++ DE H +K+  S T  +++S+   +R  LSGTP+QN + E ++L+ F N
Sbjct: 323 SINFYRVILDEAHNIKDRTSNTAKAVNSLQTKKRWCLSGTPLQNRIGEMYSLIRFLN 379

>YBR114W (RAD16) [303] chr2 (467204..469576) Nucleotide excision
           repair protein involved in G2 repair of inactive genes,
           component of the nucleotide excision repair factor four
           (NEF4, Rad7p-Rad16p) ATP-dependent damage recognition
           complex, has DNA helicase domain of Snf2p family [2373
           bp, 790 aa]
          Length = 790

 Score = 80.5 bits (197), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 93/173 (53%), Gaps = 4/173 (2%)

Query: 652 SSKFAILERFLFKIK-HESNDKIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQ 710
           S+K   L   L+K++ ++   K ++ S +T  LDL+E   +   +  ++L G+M+  +R 
Sbjct: 618 STKIEALVEELYKLRSNKRTIKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMSPTQRD 677

Query: 711 KLVDKF-NDPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQ 769
           + +  F N+   E  +FL+S KAGG  +NL  A+++ ++DP WNP+ + Q+  RV R GQ
Sbjct: 678 ETIKYFMNNIQCE--VFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQ 735

Query: 770 KKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVEEKEDVERLFSSENLRPLF 822
            +   I RF    SIE +I +    K ++    + + E      +  +L+ LF
Sbjct: 736 YRPVKITRFCIEDSIEARIIELQEKKANMIHATINQDEAAISRLTPADLQFLF 788

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 87/182 (47%), Gaps = 28/182 (15%)

Query: 325 GCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVK----- 379
           G ++ADEMG+GKT+Q IAL+   L        T    ++V P+  +  W NEI +     
Sbjct: 205 GGVLADEMGMGKTIQTIALLMNDL--------TKSPSLVVAPTVALMQWKNEIEQHTKGQ 256

Query: 380 -----WLGPDALSPLA-IDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRN 433
                + G    + +  + G    L+  +V +SV +    Q     +   +    ++  N
Sbjct: 257 LKIYIYHGASRTTDIKDLQGYDVVLTTYAVLESVFR---KQNYGFRRKNGLFKQPSVLHN 313

Query: 434 VENLKGCKVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNF 493
           ++  +      ++ DE H +K+  S T  +++++   +R  LSGTP+QN + E ++L+ F
Sbjct: 314 IDFYR------VILDEAHNIKDRQSNTARAVNNLKTQKRWCLSGTPLQNRIGEMYSLIRF 367

Query: 494 SN 495
            N
Sbjct: 368 LN 369

>KLLA0C05368g 481598..486415 some similarities with sgd|S0005717
            Saccharomyces cerevisiae YOR191w RIS1, hypothetical start
          Length = 1605

 Score = 80.1 bits (196), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 79/137 (57%), Gaps = 2/137 (1%)

Query: 669  SNDKIVLISNYTQTLDLIEKMCRYN-HYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFL 727
            +++K+V+ S +T   +++    + N     LR DG+M+ ++R   ++ F   +    + L
Sbjct: 1445 TDEKLVIFSQFTMFFEILGHFIKKNLGLNFLRYDGSMSSSQRSACIESFYQDNNYR-VML 1503

Query: 728  LSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEK 787
            +S KAG  G+ L  AN +IL DP WNP  ++QA+ R  R  Q+++ +++R +   S+E++
Sbjct: 1504 ISMKAGNSGLTLTCANHVILADPFWNPFVEEQAMDRCHRISQEREVYVHRLLIKMSVEDR 1563

Query: 788  ISQRPSMKMSLSSCVVE 804
            I +  + K +L +  ++
Sbjct: 1564 IVELQNKKKTLVNLAMD 1580

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 83/365 (22%), Positives = 149/365 (40%), Gaps = 71/365 (19%)

Query: 313  AAMTRESNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNN 372
             +M + S RG    ++AD+MGLGKT+Q +AL   L+    + +  I+  ++V P +++  
Sbjct: 931  VSMEKSSKRGG---LLADDMGLGKTVQSLAL---LMANKPEPKSAIKTTLVVAPVAVLRV 984

Query: 373  WANEIVKWLGPDALSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRR 432
            W +E+   +  D    + I G   + S+       R W      ++V    ++SY+TL  
Sbjct: 985  WKDEVAVKIKKDVNVKVVIFGGGENNSS-----KFRSWKDLAEYDIV----LVSYQTLAS 1035

Query: 433  NVE--------------NLKGCKVGLM-----------------------LADEGHRLKN 455
              +              ++    + LM                       + DE   +KN
Sbjct: 1036 EFKKHWPLSWKNGEHQPDVHAVDLKLMNQVKSSDEYFSPFYRNDSEFYRVILDEAQNIKN 1095

Query: 456  GDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFRKNFEIPILR 515
              +    +  +I+   R  LSGTPIQN++ E ++L+ F         A+F  +    +  
Sbjct: 1096 KKTQAAKACCTISSTFRWALSGTPIQNNIGELYSLIRFLRIPPYNKEAKFHSDIGAVLNT 1155

Query: 516  GRDADATDKEIAAGEVKLHELSQIVSKFIIRRTND-------ILSKYLPCKYEHILFVNL 568
             +  D  D E      K+  L + +   ++RRT         IL   LP K+       L
Sbjct: 1156 KKPYDYNDSERQRAMKKVQVLLRAI---MLRRTKTSQIDGKPILQ--LPEKHLKESANKL 1210

Query: 569  SPMQKAIYEHF-VRSREVAKLM------KGTGSQPLKAIGLLKKLCNHPDLLDLPDEIAG 621
               +   Y+    +SR+ AK M      +G  S  L  +  L++ C H +L+ + +  A 
Sbjct: 1211 EGDELEFYQALESKSRDKAKKMLESKQKQGAYSSILTLLLRLRQACLHSELVKIGESNAK 1270

Query: 622  STNLI 626
            S+ +I
Sbjct: 1271 SSKII 1275

>YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded
            DNA-dependent ATPase of the Snf2p family of DNA
            helicases, member of the RAD6 epistasis group, involved
            in error-free DNA repair [3510 bp, 1169 aa]
          Length = 1169

 Score = 79.3 bits (194), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 96/181 (53%), Gaps = 9/181 (4%)

Query: 650  THSSKF-AILERFLFKIKHESNDKIVLISNYTQTLDLIEKMCRYNHYG----VLRLDGTM 704
            + SSK  A+L+         + +++V+ S ++  LD++EK   +        + + DG +
Sbjct: 991  SKSSKITALLKELQLLQDSSAGEQVVIFSQFSTYLDILEKELTHTFSKDVAKIYKFDGRL 1050

Query: 705  TINKRQKLVDKF--NDPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALA 762
            ++ +R  ++  F   D S ++ I LLS KAGG G+NL  A+   +MDP W+P+ + QA+ 
Sbjct: 1051 SLKERTSVLADFAVKDYSRQK-ILLLSLKAGGVGLNLTCASHAYMMDPWWSPSMEDQAID 1109

Query: 763  RVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVEEKEDVERLFSSENLRPLF 822
            R+ R GQ     + RFI   SIEEK+ +    K ++    ++  ED  R    E ++ LF
Sbjct: 1110 RLHRIGQTNSVKVMRFIIQDSIEEKMLRIQEKKRTIGEA-MDTDEDERRKRRIEEIQMLF 1168

Query: 823  Q 823
            +
Sbjct: 1169 E 1169

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 80/350 (22%), Positives = 133/350 (38%), Gaps = 79/350 (22%)

Query: 325 GCIMADEMGLGKTLQCIALMWTLLRQGS------------------------QGRPTIEK 360
           G I++DEMGLGKT+   +L+ +                                +P   K
Sbjct: 527 GGILSDEMGLGKTVAAYSLVLSCPHDSDVVDKKLFDIENTAVSDNLPSTWQDNKKPYASK 586

Query: 361 C-IIVCPSSLVNNWANEIVKWL-GPDALSPLAIDGRKSS---------------LSNGSV 403
             +IV P SL+  W+NE  K    PD    +   G  SS               L+   +
Sbjct: 587 TTLIVVPMSLLTQWSNEFTKANNSPDMYHEVYYGGNVSSLKTLLTKTKTPPTVVLTTYGI 646

Query: 404 AQSVRQWAI-AQGRNVVKPVLIISYETLRRNVENLKGCKVGLMLADEGHRLKNGDSLTFT 462
            Q+  +W   ++GR   + V I S          L       ++ DEGH ++N  ++T  
Sbjct: 647 VQN--EWTKHSKGRMTDEDVNISS---------GLFSVNFYRIIIDEGHNIRNRTTVTSK 695

Query: 463 SLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFRKNFEIPILRGRDADAT 522
           ++ ++    + +L+GTPI N L + ++L+ F           ++     P        A 
Sbjct: 696 AVMALQGKCKWVLTGTPIINRLDDLYSLVKFLELDPWRQINYWKTFVSTPFESKNYKQAF 755

Query: 523 DKEIAAGEVKLHELSQIVSKFIIRRTNDILSK------YLPCKYEHILFVNLSPMQKAIY 576
           D            ++ I+   ++RRT  +  K       LP K   I  +  S  Q  +Y
Sbjct: 756 DV-----------VNAILEPVLLRRTKQMKDKDGKPLVELPPKEVVIKRLPFSKSQDLLY 804

Query: 577 EHFVRSREVA--------KLMKGTGSQPLKAIGLLKKLCNHPDLLDLPDE 618
           +  +   EV+         L+K   S  L  I  L+++C HP L+   DE
Sbjct: 805 KFLLDKAEVSVKSGIARGDLLKKY-STILVHILRLRQVCCHPGLIGSQDE 853

>Scas_721.100
          Length = 1137

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 93/174 (53%), Gaps = 8/174 (4%)

Query: 656  AILERFLFKIKHESNDKIVLISNYTQTLDLIEKMCR----YNHYGVLRLDGTMTINKRQK 711
            A+L+         + +++V+ S ++  LD++E   +     +   + + DG +++ +R  
Sbjct: 966  ALLKHLQLLQDSSAGEQVVIFSQFSSYLDILEDELKEAFPTDVAKIYKFDGRLSLKERST 1025

Query: 712  LVDKFN--DPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQ 769
            ++  F   D S ++ I LLS KAGG G+NL  A+   +MDP W+P+ + QA+ R+ R GQ
Sbjct: 1026 VLQDFQIKDLSRQK-ILLLSLKAGGVGLNLTCASHAYMMDPWWSPSMEDQAIDRIHRIGQ 1084

Query: 770  KKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVEEKEDVERLFSSENLRPLFQ 823
              +  + RFI   SIEEK+ +    K ++    ++  ED  R    E ++ LF+
Sbjct: 1085 TNNVKVVRFIIENSIEEKMLRIQERKRTIGEA-MDADEDERRKRRIEEIKMLFE 1137

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 78/332 (23%), Positives = 135/332 (40%), Gaps = 73/332 (21%)

Query: 325 GCIMADEMGLGKTLQCIALMWTL----------LRQGSQG---------RPTIEKC-IIV 364
           G I++DEMGLGKT+  +AL+ +           L +G +          +P   K  +IV
Sbjct: 501 GGILSDEMGLGKTISTLALILSCPYDSEVVDKKLFKGEEDDIRETQPHLKPYASKTTLIV 560

Query: 365 CPSSLVNNWANEIVKWL-GPDALSPLAIDGRKSSL---------------SNGSVAQSVR 408
            P SL+N W  E  K     D  S +   G  SSL               +   + QS  
Sbjct: 561 VPMSLLNQWNTEFNKANNSSDMRSEIYYGGNVSSLKKLLTKTHNPPTVVITTYGIVQS-- 618

Query: 409 QWA-IAQGRNVVKPVLIISYETLRRNVENLKGCKVGLMLADEGHRLKNGDSLTFTSLDSI 467
           +W+ I + +N+   +         ++   L       ++ DEGH ++N  +LT  ++  +
Sbjct: 619 EWSKIFKKQNIGAEI---------QSSSGLFSVDFYRIVIDEGHTIRNRTTLTSKAIMDL 669

Query: 468 NCPRRVILSGTPIQNDLSEYFALLNF------SNPGLLGT-------RAQFRKNFEI--- 511
               + +L+GTPI N L + ++L+ F      S  G              F++ F++   
Sbjct: 670 TSKCKWVLTGTPIINRLDDLYSLVRFLKLEPWSQIGYWKMFVSTPFENKNFKQAFDVVNA 729

Query: 512 ---PILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHILFVNL 568
              P+L  R     D +     V+L     IV +  + +  + + KYL  + E  + + L
Sbjct: 730 ILEPVLLRRTKQMKDID-GKPLVELPPKEVIVERLKLSKAQNAVYKYLLDRAEQSVILGL 788

Query: 569 S-----PMQKAIYEHFVRSREVAKLMKGTGSQ 595
           +          I  H +R R+V   +K  G+Q
Sbjct: 789 ARGDLLKQYSTILVHILRLRQVCCDVKLIGAQ 820

>Scas_591.10
          Length = 772

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 91/173 (52%), Gaps = 4/173 (2%)

Query: 652 SSKFAILERFLFKIKHESND-KIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQ 710
           S+K   L   L+K++      K ++ S +T  LDL+E   +   +  ++L G+M+  +R 
Sbjct: 600 STKIEALVEELYKLRSPVRTIKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMSPTQRD 659

Query: 711 KLVDKF-NDPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQ 769
           + +  F N+   E  +FL+S KAGG  +NL  A+++ ++DP WNP+ + Q+  RV R GQ
Sbjct: 660 ETIKYFMNNIECE--VFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQ 717

Query: 770 KKDCFIYRFITTGSIEEKISQRPSMKMSLSSCVVEEKEDVERLFSSENLRPLF 822
            +   I RF    SIE +I +    K ++    + + E      +  +L+ LF
Sbjct: 718 FRPVKITRFCIEDSIESRIIELQEKKANMIHATINQDEAAIGRLTPADLQFLF 770

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 93/186 (50%), Gaps = 36/186 (19%)

Query: 325 GCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEI------- 377
           G ++ADEMG+GKT+Q IAL+   L +    RP++    +V P+  +  W NEI       
Sbjct: 187 GGVLADEMGMGKTIQTIALLMNDLTK----RPSL----VVAPTVALMQWKNEINQHTDGK 238

Query: 378 VKWLGPDALSPLAIDGRKSS-----LSNGSVAQSV---RQWAIAQGRNVVKPVLIISYET 429
           +K       S   ID +  S     L+  +V +SV   + +   +   VVK + ++    
Sbjct: 239 LKVYMFHGTSK-NIDIKTLSEYDVVLTTYAVLESVFRKQNYGFKRKHGVVKELSVL---- 293

Query: 430 LRRNVENLKGCKVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFA 489
              N+E  +      ++ DE H +K+  S T  +++++   +R  L+GTP+QN + E ++
Sbjct: 294 --HNIEFYR------VILDEAHNIKDRQSNTARAVNNLKTQKRWCLTGTPLQNRIGEMYS 345

Query: 490 LLNFSN 495
           L+ F N
Sbjct: 346 LIRFLN 351

>Scas_674.12d
          Length = 1323

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 88/162 (54%), Gaps = 11/162 (6%)

Query: 671  DKIVLISNYTQTLDL----IEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIF 726
            +KI++ S +T   D+    +EK+ +  +   L+  G MT  +R  ++ KF   + E  I 
Sbjct: 1166 EKIIIFSQFTSFFDIFQHFLEKLLKVPY---LKYTGAMTAQQRADVITKFYRQANER-IL 1221

Query: 727  LLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEE 786
            L+S KAG  G+ L  AN +I++DP WNP  ++QA  R +R  Q ++  ++R     S+E+
Sbjct: 1222 LISMKAGNSGLTLTCANHVIIVDPFWNPYVEEQAQDRCYRISQTREVHVHRLFIKDSVED 1281

Query: 787  KISQRPSMKMSLSSCVVE--EKEDVERLFSSENLRPLFQFDS 826
            +I++    K  +    ++  + ++V RL + E L  LF  +S
Sbjct: 1282 RIAELQEKKREMVDAAMDPSKLKEVNRLGARE-LGFLFGLNS 1322

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 76/327 (23%), Positives = 141/327 (43%), Gaps = 50/327 (15%)

Query: 325 GCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKC---IIVCPSSLVNNWANEIVKWL 381
           G ++AD+MGLGKT+Q IALM          R   + C   +IV P +++  W  E+   +
Sbjct: 671 GGLLADDMGLGKTVQGIALMLA-------NRSKDQACKTNLIVAPVAVLRVWGGELETKI 723

Query: 382 GPDALSPLAIDGRKSSLSNGS---------------VAQSVRQWAIAQGRNVVK-PVL-- 423
             +A     I G    L+                    +  + W  + G++  + P +  
Sbjct: 724 KKEANFSAFIYGGGDKLATWKELSEYDAIMVSYPTLAIEFKKHWPASLGKDQKQLPAIPQ 783

Query: 424 IISYETLRRNVENLK--GCKVGL---MLADEGHRLKNGDSLTFTSLDSINCPRRVILSGT 478
           + +  +L++  E      C       ++ DEG  +KN  +    +  S++   R + SGT
Sbjct: 784 LAAMNSLKKKDEYFSPFFCNESTFYRIILDEGQNIKNKKTRAAKACCSLDATYRWVFSGT 843

Query: 479 PIQNDLSEYFALLNFSNPGLLGTRAQFRKNFEIPILRGR-DADATDKEIAAGEVKLHELS 537
           PIQN + E ++L+ F          +F  +   P LR   + D  D++ A  +V++    
Sbjct: 844 PIQNSMDELYSLIRFLRIPPYHREERFMADIGRPFLRKNGNYDDFDRKQAIKKVQV---- 899

Query: 538 QIVSKFIIRRT-NDILSKY----LPCKYEHILFVNLSPMQKAIYEHF-VRSREVAKLM-- 589
            ++S  ++RR+ +D++       LP K   I    L   +   Y     ++R++A+ +  
Sbjct: 900 -LLSAIMLRRSKSDMIDGKPLLELPPKQIEIDSAALEGDELEFYTDLEAKNRKLAERLLK 958

Query: 590 ---KGTGSQPLKAIGLLKKLCNHPDLL 613
              KG  S  L  +  L++ C H +L+
Sbjct: 959 RKAKGNYSSVLTLLLRLRQACVHSELV 985

>YOR191W (RIS1) [4987] chr15 (692475..697334) Protein involved in
            silencing, member of Snf2p DNA-dependent ATPase family
            [4860 bp, 1619 aa]
          Length = 1619

 Score = 77.4 bits (189), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 73/124 (58%), Gaps = 4/124 (3%)

Query: 669  SNDKIVLISNYTQTLDLIEKMCRYN-HYGVLRLDGTMTINKRQKLVDKF-NDPSGEEFIF 726
            + +KI++ S +T   +++E   +   ++  L+  G+M   +R  ++++F  DP  E+ I 
Sbjct: 1460 ATEKIIIFSQFTTFFEILEHFLKNKLNFPYLKYIGSMNAQRRSDVINEFYRDP--EKRIL 1517

Query: 727  LLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEE 786
            L+S KAG  G+ L  AN ++++DP WNP  ++QA  R +R  Q K   +++     S+E+
Sbjct: 1518 LISMKAGNSGLTLTCANHVVIVDPFWNPYVEEQAQDRCYRISQTKKVQVHKLFIKDSVED 1577

Query: 787  KISQ 790
            +IS+
Sbjct: 1578 RISE 1581

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 59/214 (27%), Positives = 89/214 (41%), Gaps = 59/214 (27%)

Query: 320  NRGAYGCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKC---IIVCPSSLVNNWANE 376
            N    G ++AD+MGLGKT+Q IALM          R    KC   +IV P S++  W  E
Sbjct: 959  NSAKKGGLLADDMGLGKTIQAIALMLA-------NRSEESKCKTNLIVAPVSVLRVWKGE 1011

Query: 377  IVKWLGPDALSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVK-PVLIISYETLRRNVE 435
            +   +   A     I G       GS    V+ W     R++ +   +++SY+TL    +
Sbjct: 1012 LETKVKKRAKFTTFIFG-------GSGNGKVKHW-----RDLARYDAVLVSYQTLANEFK 1059

Query: 436  N-----LKGCKVGL-------------------------------MLADEGHRLKNGDSL 459
                  L G +  L                               +L DEG  +KN ++ 
Sbjct: 1060 KHWPKKLDGEQNQLPAVPHIQALNRLKTSNEYYSPFFCNDSTFYRILLDEGQNIKNKNTR 1119

Query: 460  TFTSLDSINCPRRVILSGTPIQNDLSEYFALLNF 493
               +  +IN   R +LSGTPIQN + E ++L+ F
Sbjct: 1120 ASKACCTINGMYRWVLSGTPIQNSMDELYSLIRF 1153

>CAGL0G09493g complement(902228..906454) similar to tr|Q08562
            Saccharomyces cerevisiae YOR191w RIS1, hypothetical start
          Length = 1408

 Score = 77.0 bits (188), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 84/159 (52%), Gaps = 5/159 (3%)

Query: 671  DKIVLISNYTQTLDLIEKMCRYN-HYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLS 729
            +KI++ S +T  LDL+E +         L+  G M    R +++ +F     +  + L+S
Sbjct: 1251 EKIIIFSQFTTFLDLLEHILATRLKISCLKYTGDMNAKVRSEIISRFYSEEDKR-VLLIS 1309

Query: 730  SKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKIS 789
             KAG  G+ L  AN ++++DP WNP  ++QA  R +R  Q ++  ++R     S+E++I 
Sbjct: 1310 MKAGNSGLTLTCANHVVIVDPFWNPYVEEQAQDRCYRISQTREVTVHRLFIKNSVEDRIL 1369

Query: 790  QRPSMKMSLSSCVVEEK--EDVERLFSSENLRPLFQFDS 826
            +   +K  +    ++ K  +D+ +L + E L  LF  +S
Sbjct: 1370 ELQKLKRDMVDAAMDAKKIKDINKLGTRE-LGFLFGLNS 1407

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 84/354 (23%), Positives = 150/354 (42%), Gaps = 76/354 (21%)

Query: 325  GCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPD 384
            G ++AD+MGLGKT+Q IALM    R  ++ + T    +IV P S++  W  EI   +   
Sbjct: 754  GGLLADDMGLGKTVQAIALMLAN-RSSNESKKT---NLIVAPVSVLRVWKGEIETKIKES 809

Query: 385  ALSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNV-----ENLKG 439
            +    AI G       G      R W      +V+    ++SY+TL   +     E LK 
Sbjct: 810  SDFNSAIYG-------GVNGIKFRSWDKLSNFDVI----LVSYQTLANELKKHWPERLKT 858

Query: 440  CKVGL-------------------------------MLADEGHRLKNGDSLTFTSLDSIN 468
                L                               ++ DEG  +KN  +    +  ++N
Sbjct: 859  DSKQLPPVPDIKAMNSLKTKNEYWSPFYSDDSTFYRIILDEGQNIKNMKTQAAKACCTVN 918

Query: 469  CPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFRKNFEIPILR-GRDADATDKEIA 527
               R ILSGTPIQN++ E ++L+ F          +F+++   P     ++ D+  ++ A
Sbjct: 919  SVYRWILSGTPIQNNMEELYSLIRFLRIPPYNRHERFQQDIGRPFSNLKQNYDSESRKQA 978

Query: 528  AGEVKLHELSQIVSKFIIRRTND-------ILSKYLPCKYEHILFVNLSPMQKAIY---E 577
              +V++     ++   ++RR+         IL   LP K  +         +   Y   E
Sbjct: 979  IKKVRV-----LLRAIMLRRSKTDKIDGVPILE--LPPKNVNAQETTFKDDELEFYKALE 1031

Query: 578  HFVRSREVAKLM-----KGTGSQPLKAIGLLKKLCNHPDLLDLPDEIAGSTNLI 626
            H  +++++AK +     +G  S  L  +  L++ C HP+L+ L ++ A +  ++
Sbjct: 1032 H--KNKQLAKKLLESKVQGNYSSVLTLLLRLRQACCHPELVILGEKKAEAATVV 1083

>Sklu_2412.7 YLR032W, Contig c2412 15481-18864
          Length = 1127

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 94/186 (50%), Gaps = 16/186 (8%)

Query: 629  DYQSAMTHNSRGGRSHVEVQTTH------SSKFAILERFLFKIKHES-NDKIVLISNYTQ 681
            D +  +T   RGG    EV   H      SSK   L + L +++     +++V+ S ++ 
Sbjct: 926  DPKRLLTLKERGG----EVSVVHYDTSSKSSKICSLLKHLKQLQETCPGEQVVVFSQFSS 981

Query: 682  TLDLIEKMCRYNH----YGVLRLDGTMTINKRQKLVDKF-NDPSGEEFIFLLSSKAGGCG 736
             LD++E     +       + + DG + +  R +++D F      +  I LLS KAGG G
Sbjct: 982  YLDILENELTSSFSKADAKIYKFDGRLNLKDRSRVLDTFATKDLSKLKILLLSLKAGGVG 1041

Query: 737  INLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKM 796
            +NL  A+R  +MDP W+P+ + QA+ RV R GQ+ +  I RFI   SIEEK+      K 
Sbjct: 1042 LNLTCASRAYMMDPWWSPSLEDQAIDRVHRIGQESNVKIIRFIMENSIEEKMLSIQDRKR 1101

Query: 797  SLSSCV 802
            +L   V
Sbjct: 1102 TLGEAV 1107

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 78/340 (22%), Positives = 138/340 (40%), Gaps = 88/340 (25%)

Query: 325 GCIMADEMGLGKTLQCIALMWTL-----------LRQGSQG---------RPTIEK-CII 363
           G ++ADEMGLGKT+  +A++  +            R+   G         +P   K  +I
Sbjct: 495 GGLLADEMGLGKTISTLAMISMVPCDTDPVEEKNKRENEIGMNDYGYKSDKPYASKTTLI 554

Query: 364 VCPSSLVNNWANEIVKW-LGPDALSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPV 422
           V P SL+  W  E  K    P+A   +   GR  +L             + + +N   P 
Sbjct: 555 VVPMSLLFQWQKEFEKANNNPNAHCEIYYGGRAGNLIT----------LLTKTKN--PPT 602

Query: 423 LII-SYETLRRNVENL---------KGCKVGL-------MLADEGHRLKNGDSLTFTSLD 465
           +I+ SY  ++     L         +G  +GL       ++ DEGH ++N  + T  ++ 
Sbjct: 603 IILTSYGVIQSEWSKLPRCNNNRIEQGAAIGLFSVEFFRIVIDEGHSIRNRTTRTSKAVM 662

Query: 466 SINCPRRVILSGTPIQNDLSEYFALLNF------SNPGLLGT-------RAQFRKNFEI- 511
            ++  R+ +L+GTPI N L + F+L+ F      S  G   +       +  +++ F++ 
Sbjct: 663 DLSSSRKWVLTGTPIINRLDDLFSLVKFMKLEPWSQIGYWKSFVSGPFEKKNYKQAFDVV 722

Query: 512 -----PILRGRDADATD-----------KEIAAGEVKLHELSQIVSKFIIRRTNDILSKY 555
                P+L  R     D           KEI   +VK +    I+ KF + +  + +   
Sbjct: 723 SSVLEPVLLRRTKQMKDINGKPLVTLPLKEIVIEKVKFNTSEDILYKFFLNKAENSVK-- 780

Query: 556 LPCKYEHILFVNLSPMQKAIYEHFVRSREVAKLMKGTGSQ 595
                E +   +L      I  H +R R+V   ++  GS+
Sbjct: 781 -----ESLARGDLLKKYSTILVHILRLRQVCCHIELLGSR 815

>AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4620
            bp, 1539 aa]
          Length = 1539

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 79/159 (49%), Gaps = 12/159 (7%)

Query: 644  HVEVQTTHSSKFAILERFL--FKIKHESND-----KIVLISNYTQTLDLIEKMCRYNHYG 696
             +E    + SK   + + L   +++HE+N      +IV+ S Y + L+++  + + N   
Sbjct: 1324 QLETSVNYGSKIDFVIKLLKYLRLQHETNPTSPALQIVIYSQYAELLEIVAHVLKQN--S 1381

Query: 697  VLRLDGTMTINKRQKLVDKFN-DPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPA 755
            +  L  T  +    K+V+ F  DP  E    LL +K    G+ LI A  + L++P  N +
Sbjct: 1382 IKFLTTTKNVRNFAKVVETFKADP--EITCLLLDTKRQASGLTLINATHVFLLEPIVNNS 1439

Query: 756  ADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSM 794
             + QA+ R+ R GQ  + +++ F+   ++E  I +  S+
Sbjct: 1440 TEFQAINRIHRIGQTSETYVWHFMLLNTVEHSILRYKSI 1478

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 37/67 (55%), Gaps = 15/67 (22%)

Query: 327 IMADEMGLGKTLQCIAL--------------MWTLLRQGSQGRPTIEKCIIVCPSSLVNN 372
           ++++EMGLGKT++ +AL              ++ ++  G + R  ++  +IVCP  +V  
Sbjct: 381 MLSEEMGLGKTVEVLALLLLRPRAMDPVEEQVYEVVSTGKRMR-RVKTNLIVCPQVIVQQ 439

Query: 373 WANEIVK 379
           W +EI K
Sbjct: 440 WLDEIAK 446

>KLLA0F12166g complement(1116715..1121301) weakly similar to
            sgd|S0004237 Saccharomyces cerevisiae YLR247c,
            hypothetical start
          Length = 1528

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 89/176 (50%), Gaps = 19/176 (10%)

Query: 657  ILERFLFKIKHESNDKIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKF 716
            I ++ L K  H+ N +IV+ S+++  L ++  +   ++    R    +   K  K VD F
Sbjct: 1338 IKQQHLEKEPHKKNPQIVIFSSHSAFLSILSTLLTAHNVTHAR---PLRNTKFAKAVDTF 1394

Query: 717  -NDPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFI 775
              DP+      LL+  +   G+ L+ A  LIL++P  + + + QA++R+ R GQK   ++
Sbjct: 1395 RKDPNCT--CLLLNVHSQSTGLTLVNARHLILLEPIMDSSTEAQAISRIHRIGQKDVTYV 1452

Query: 776  YRFITTGSIEEKISQRPS------------MKMSLSSCVVEEKE-DVERLFSSENL 818
            + F+   ++EE I +  +            ++ S S   VEE E ++ER FS +N+
Sbjct: 1453 WNFMVRNTVEESIMKYKAVLEGKKKKKTEELRASGSKISVEEAEQEIERNFSMDNI 1508

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 13/71 (18%)

Query: 319 SNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGSQGRPT------------IEKCIIVCP 366
           S + A G ++ADEMGLGKT++ + L+ T +R  S    +            ++  +IVCP
Sbjct: 347 SGKKARG-VLADEMGLGKTIEILTLISTNVRNLSNESSSFVSPINEKEVRRVKTNLIVCP 405

Query: 367 SSLVNNWANEI 377
            S++  W +EI
Sbjct: 406 ESILQQWIDEI 416

>Kwal_14.1287
          Length = 1518

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 73/149 (48%), Gaps = 15/149 (10%)

Query: 672  KIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSK 731
            +I++ S Y++ L L+ K+ + +        G+    K  K+V+KF   + E    LL+  
Sbjct: 1332 QIIIYSQYSEFLGLLSKVLKQHSIQHCNTAGS---GKFSKIVEKFK-KNPEVTCLLLNVT 1387

Query: 732  AGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFIT----------- 780
                G+ L+ A  + +MDP  N + + QA+ R  R GQ ++ +++ F+            
Sbjct: 1388 RQATGLTLVNATHVFIMDPIMNTSDELQAINRTHRIGQTRETYVWNFVVRNTVEQNIVRL 1447

Query: 781  TGSIEEKISQRPSMKMSLSSCVVEEKEDV 809
             G +EE+I+ R  +K   S  +  ++E++
Sbjct: 1448 KGVLEERIASRQRLKTQPSKTIPMKREEI 1476

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 35/61 (57%), Gaps = 10/61 (16%)

Query: 327 IMADEMGLGKTLQCIALMWTLLRQ-------GSQGRPTIEKC---IIVCPSSLVNNWANE 376
           ++++EMGLGKTL+ +ALM    R         S  + TI K    +IVCP S++  W +E
Sbjct: 356 VLSEEMGLGKTLEILALMLVHKRTINGAPTFLSDSKKTILKTATNLIVCPDSILQQWIDE 415

Query: 377 I 377
           +
Sbjct: 416 V 416

>YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protein
            containing an SNF2 related N-terminal domain, a C3HC4
            type (RING) zinc finger, and a helicase conserved
            C-terminal domain, has a region of low similarity to a
            region of transcription termination factor RNA polymerase
            II (human TTF2) [4671 bp, 1556 aa]
          Length = 1556

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 62/124 (50%), Gaps = 17/124 (13%)

Query: 672  KIVLISNYTQTLDLIEKMCRYNHYGVLR-LDGTM----TIN--KRQKLVDKFNDPSGEEF 724
            +++L S  T+ L +I K+ +  H   L  L  T     TIN  KRQ  V           
Sbjct: 1381 QVILYSQKTEYLKVIGKVLKLYHIEHLACLSNTANVGETINNFKRQPSVT---------- 1430

Query: 725  IFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSI 784
              LL+ K  G G+NLI A  + L+DP  N + + QA+ R  R GQ ++ F++ F+   ++
Sbjct: 1431 CLLLNVKTLGAGLNLINAKHIFLLDPILNNSDELQAMGRNNRIGQDEETFVWNFMIRNTV 1490

Query: 785  EEKI 788
            EE I
Sbjct: 1491 EENI 1494

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 83/190 (43%), Gaps = 43/190 (22%)

Query: 327 IMADEMGLGKTLQCIALMWTLLRQGSQGRPTI-----------EKCIIVCPSSLVNNWAN 375
           ++A+EMGLGKT++ ++L+    R+      T            +  +I+CP++++  W  
Sbjct: 388 VLAEEMGLGKTIEILSLILLNRRKLKDSEATFIDDENRTITKTKTTLIICPNAILKQWLE 447

Query: 376 EI------VKWLGPDALSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYET 429
           EI      +KW      + +  D +       +V ++V+Q  + Q   +V    II+ E 
Sbjct: 448 EIELHANSLKWYTYRGYNEIMKDCK-------TVDEAVQQ--LCQYDIIVTSYNIIATEV 498

Query: 430 ----LRRNVEN--LKGCK------VGLM-----LADEGHRLKNGDSLTFTSLDSINCPRR 472
                 R++ +  LK  K      + LM     + DE   L++  + +      ++    
Sbjct: 499 HHAEFNRSIRSRRLKSPKYDYSSPLALMQFYRIILDEVQMLRSSSTYSAKCTSLLHRIHT 558

Query: 473 VILSGTPIQN 482
             +SGTPIQN
Sbjct: 559 WGVSGTPIQN 568

>Scas_573.9
          Length = 1502

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (58%)

Query: 726  FLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIE 785
             LL+ K  G G+NL+ A  + L+DP  N + + QA+ R  R GQK + +++  I   S+E
Sbjct: 1384 LLLNVKTLGAGLNLLNARHIFLLDPIINHSDELQAMNRNNRIGQKYETYVWNLIINNSVE 1443

Query: 786  EKI 788
            E I
Sbjct: 1444 ENI 1446

 Score = 37.4 bits (85), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 37/60 (61%), Gaps = 10/60 (16%)

Query: 327 IMADEMGLGKTLQCIALMWT----LLRQGS---QGRPTIEK---CIIVCPSSLVNNWANE 376
           ++++EMGLGKT++ +AL+      ++++ S       TI +    +IVCP++++  W NE
Sbjct: 372 LLSEEMGLGKTIEVLALIMLNKRDVIKEDSFIDDQNKTIRRTNLTLIVCPNAILTQWINE 431

>CAGL0B05049g 487186..491598 some similarities with tr|Q06554
            Saccharomyces cerevisiae YLR247c, hypothetical start
          Length = 1470

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 40/63 (63%)

Query: 726  FLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIE 785
             LL+ ++ G G+NL+ A  + L+DP  N   + QA++R  R GQ+++ +++ F+   ++E
Sbjct: 1350 LLLNIRSLGAGLNLLNARHIFLLDPILNVNEEIQAMSRNNRIGQRQETYVWNFMLENTVE 1409

Query: 786  EKI 788
            E I
Sbjct: 1410 ESI 1412

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 39/72 (54%), Gaps = 13/72 (18%)

Query: 318 ESNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGSQGRP---------TIEKC---IIVC 365
           E   GA G ++A+EMGLGKTL+ +AL+    R+     P          I KC   +IVC
Sbjct: 345 EYEVGAKG-VLAEEMGLGKTLEILALICINKRKYKADEPLDFVSESGKVISKCSTTLIVC 403

Query: 366 PSSLVNNWANEI 377
           P S++  W +E+
Sbjct: 404 PGSILKQWIDEM 415

>Sklu_2234.2 YOR191W, Contig c2234 6350-9366 reverse complement
          Length = 1006

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 55/116 (47%), Gaps = 23/116 (19%)

Query: 325  GCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKC---IIVCPSSLVNNWANEIVKWL 381
            G ++AD+MGLGKT+Q IALM          R  +E C   +IV P +++  W  EI   +
Sbjct: 906  GGLLADDMGLGKTVQAIALMIA-------NRSELESCKTNLIVAPVAVLRVWQAEIQTKI 958

Query: 382  GPDALSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENL 437
              +A     I G  + +   S    +R  A+           ++SY+TL   ++N+
Sbjct: 959  KKNATFKAFIYGGNNKVV--SYKDLLRYDAV-----------LVSYQTLASELKNI 1001

>Sklu_2432.9 , Contig c2432 20306-24733 reverse complement
          Length = 1475

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 45/87 (51%), Gaps = 8/87 (9%)

Query: 726  FLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIE 785
             L++ K    G+ L  A  +ILM+P       +QA+ R+ R GQ KD F++  +T  + E
Sbjct: 1352 LLMNPKWCSRGLKLTNATHVILMEPMSEGRIQEQAVERIHRIGQGKDTFVWHLMTRNTAE 1411

Query: 786  EKISQRPSMKMSLSSCVVEEKEDVERL 812
            E      ++K  +   ++EEK   ERL
Sbjct: 1412 ES-----TLKYRM---LLEEKNSRERL 1430

>KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces
           cerevisiae YBL016w FUS3 mitogen-activated protein kinase
           (MAP kinase), start by similarity
          Length = 371

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 47/109 (43%), Gaps = 2/109 (1%)

Query: 403 VAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCKVGLMLADEGHRLKNGDSLTFT 462
           V Q++R   +  G NV+   L  S   L  N  +LK C  GL       R  +GD+    
Sbjct: 118 VYQTLRALKVLHGSNVIHRDLKPSNLLLNSNC-DLKICDFGLARI-VSERATDGDAHVDA 175

Query: 463 SLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFRKNFEI 511
                N P      G P  + ++EY A   +  P ++ T AQ+ K+ ++
Sbjct: 176 DDTDDNSPSSAANDGDPAISGMTEYVATRWYRAPEVMLTAAQYSKSMDV 224

>Scas_720.17
          Length = 519

 Score = 34.7 bits (78), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 43/85 (50%), Gaps = 3/85 (3%)

Query: 662 LFKIKHESNDKIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSG 721
           L K  H   +K+++ + Y +    +E+  RYN Y V  + G ++  +R K + +F   SG
Sbjct: 347 LLKKYHSKKEKVLIFALYKKEAARVERTLRYNGYDVAAIHGDLSQEQRTKALGEFK--SG 404

Query: 722 EEFIFLLSSKAGGCGINLIGANRLI 746
           +  + LL++     G+++     +I
Sbjct: 405 KSNL-LLATDVAARGLDIPNVKTVI 428

>Kwal_56.24005
          Length = 533

 Score = 33.9 bits (76), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 16/77 (20%), Positives = 39/77 (50%), Gaps = 3/77 (3%)

Query: 670 NDKIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLS 729
           NDK+++ + Y +    +E+  +YN Y V  + G ++  +R + +++F   +      LL+
Sbjct: 369 NDKVLIFALYKKEAARVERNLKYNGYSVAAIHGDLSQQQRTQALNEFKSGASN---LLLA 425

Query: 730 SKAGGCGINLIGANRLI 746
           +     G+++     +I
Sbjct: 426 TDVAARGLDIPNVKTVI 442

>AFL080W [3113] [Homologous to ScYGL078C (DBP3) - SH]
           complement(288205..289812) [1608 bp, 535 aa]
          Length = 535

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/77 (20%), Positives = 38/77 (49%), Gaps = 3/77 (3%)

Query: 670 NDKIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLS 729
           NDK+++ + Y +    +E+  +YN Y V  + G ++  +R + + +F   +      LL+
Sbjct: 371 NDKVLIFALYKKEASRVERNLKYNGYNVAAIHGDLSQQQRTQALSEFKAGTAN---LLLA 427

Query: 730 SKAGGCGINLIGANRLI 746
           +     G+++     +I
Sbjct: 428 TDVAARGLDIPNVKTVI 444

>KLLA0C15499g complement(1345201..1346715) similar to sp|P20447
           Saccharomyces cerevisiae YGL078c DBP3 putative RNA
           helicase required for pre-rRNA processing, start by
           similarity
          Length = 504

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/70 (24%), Positives = 34/70 (48%), Gaps = 14/70 (20%)

Query: 670 NDKIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLS 729
           NDK+++ + Y +    +E+  +YN Y V  + G ++  +R + +++F             
Sbjct: 340 NDKVLIFALYKKEASRVERNLKYNGYDVAAIHGDLSQQQRTQALNEF------------- 386

Query: 730 SKAGGCGINL 739
            KAG C + L
Sbjct: 387 -KAGKCNLLL 395

>Scas_588.16
          Length = 693

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 4/56 (7%)

Query: 652 SSKFAILERFLFKI----KHESNDKIVLISNYTQTLDLIEKMCRYNHYGVLRLDGT 703
           S KF + ++ LFK+    K E + K++LIS+  + LD++E         + R+ GT
Sbjct: 126 SGKFKVFQQLLFKLLDKEKDEVSKKVLLISHSIKELDILEGFLLGQKVRIKRISGT 181

>CAGL0H03377g complement(313755..315377) highly similar to sp|P20447
           Saccharomyces cerevisiae YGL078c DBP3, hypothetical
           start
          Length = 540

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 41/77 (53%), Gaps = 3/77 (3%)

Query: 670 NDKIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLS 729
           NDK+++ + Y +    +E+   YN Y V  + G ++  +R + +++F   SG+  + LL+
Sbjct: 376 NDKVLIFALYKKEASRVERNLNYNGYKVAAIHGDLSQQQRTQALNEFK--SGKSNL-LLA 432

Query: 730 SKAGGCGINLIGANRLI 746
           +     G+++     +I
Sbjct: 433 TDVAARGLDIPNVKTVI 449

>YJR124C (YJR124C) [3016] chr10 complement(652807..654153) Member of
           the multidrug-resistance 12-spanner (DHA12) family of
           the major facilitator superfamily (MFS-MDR) [1347 bp,
           448 aa]
          Length = 448

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 33/61 (54%), Gaps = 4/61 (6%)

Query: 150 IVLYDPT-VDGEIPDETPREEPAQKENDGGNEEQARPTRRTATHPEKLSNGLRNKTLREL 208
           ++L D T +DG        EE A+  +   N+E A P  R ATHPE+ SN L  +T+  L
Sbjct: 202 LLLSDATELDGHYEHTDCNEETAEPLDV--NDETA-PLMRQATHPEERSNKLSKETVSVL 258

Query: 209 L 209
           +
Sbjct: 259 M 259

>KLLA0F23716g join(complement(2216857..2218129), some similarities
           with ca|CA1415|CaDBP2.exon2 Candida albicans
           ATP-dependent RNA helicase of DEAD box family, exon 2
           (by homology), hypothetical start
          Length = 554

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 39/176 (22%), Positives = 72/176 (40%), Gaps = 21/176 (11%)

Query: 658 LERFLFKIKHESNDKIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFN 717
           L + L     + + KI++ ++  +T D I    R   +  L + G    N+R  ++ +F 
Sbjct: 348 LAKHLETASQDQDSKIIIFASTKRTCDEITSYLRTEGWPALAIHGDKAQNERDWVLAEFR 407

Query: 718 DPSGEEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYR 777
             SG   I ++++     GI++ G N +I  D   N       + R  R G         
Sbjct: 408 --SGRSPI-MVATDVAARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGSTGTAI--S 462

Query: 778 FITTGSIEEKISQRPSMKMSLSSCVVEEKEDVERLFSSENLRPLFQFDSNTHMRYP 833
           F T G+         S+  +L   + E K+D+      E LR   ++D   + ++P
Sbjct: 463 FFTEGN--------KSLGAALIKIMREAKQDI-----PEELR---RYDRGQYGQHP 502

>YGL234W (ADE5,7) [1764] chr7 (56481..58889)
           Phosphoribosylamine-glycine ligase (GARSase) plus
           phosphoribosylformylglycinamidine cyclo-ligase
           (AIRSase), a bifunctional protein [2409 bp, 802 aa]
          Length = 802

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 50/121 (41%), Gaps = 15/121 (12%)

Query: 432 RNVENLKGCKVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALL 491
           R  +N +  KV +  AD G  + NG++L  T  + +   RR         +D+  +  L 
Sbjct: 438 RAFQNSESSKVAITYADSGVSVDNGNNLVQTIKEMVRSTRR-----PGADSDIGGFGGLF 492

Query: 492 NFSNPGLLGTRAQFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDI 551
           + +  G       FR+N +  ++   D   T K I A E  +H    I    +    ND+
Sbjct: 493 DLAQAG-------FRQNEDTLLVGATDGVGT-KLIIAQETGIHNTVGI--DLVAMNVNDL 542

Query: 552 L 552
           +
Sbjct: 543 V 543

>KLLA0D08932g 751943..752779 similar to sp|P09064 Saccharomyces
           cerevisiae YPL237w SUI3 translation initiation factor
           eIF2 beta subunit singleton, start by similarity
          Length = 278

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 2/36 (5%)

Query: 477 GTPIQNDLSEYFALLNFSNPGLLGTRAQFRKNFEIP 512
           G P Q+ LS +F +LN +NP L G R+     F+IP
Sbjct: 121 GLPYQDLLSRFFKILNTNNPELAGDRSG--PKFKIP 154

>YGL078C (DBP3) [1904] chr7 complement(360289..361860) ATP-dependent
           RNA helicase CA3, member of the DEAD-box family of RNA
           helicases [1572 bp, 523 aa]
          Length = 523

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 17/77 (22%), Positives = 42/77 (54%), Gaps = 3/77 (3%)

Query: 670 NDKIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLS 729
           N+K+++ + Y +    +E+  +YN Y V  + G ++  +R + +++F   SG+  + LL+
Sbjct: 359 NEKVLIFALYKKEAARVERNLKYNGYNVAAIHGDLSQQQRTQALNEFK--SGKSNL-LLA 415

Query: 730 SKAGGCGINLIGANRLI 746
           +     G+++     +I
Sbjct: 416 TDVAARGLDIPNVKTVI 432

>KLLA0E04763g complement(429714..431624) similar to sgd|S0006383
           Saccharomyces cerevisiae YPR179c PLO1, start by
           similarity
          Length = 636

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 652 SSKFAILERFLFKIKHESNDKIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQK 711
           S KFA+L R L  +  E     VL++   +T+DL+E +   N   ++R DG  TI  + K
Sbjct: 113 SGKFAVL-RDLITLVQEYETHTVLMARSDRTMDLLEALLLGNKVNIVRHDG-QTIKTKNK 170

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.135    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 29,154,402
Number of extensions: 1284012
Number of successful extensions: 3976
Number of sequences better than 10.0: 128
Number of HSP's gapped: 3694
Number of HSP's successfully gapped: 207
Length of query: 879
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 769
Effective length of database: 12,788,129
Effective search space: 9834071201
Effective search space used: 9834071201
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)