Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AEL296W43943120610.0
Sklu_1546.14294497921e-101
CAGL0I04202g4254257232e-91
Scas_668.174123026657e-83
YGL164C (YRB30)4403126415e-79
Kwal_14.15422042042675e-27
CAGL0J11198g30842655.0
CAGL0L10230g37727655.1
ACR092C27460637.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AEL296W
         (431 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AEL296W [2209] [Homologous to ScYGL164C - SH] complement(86307.....   798   0.0  
Sklu_1546.1 YGL164C, Contig c1546 317-1606 reverse complement         309   e-101
CAGL0I04202g complement(368221..369498) highly similar to sp|P53...   283   2e-91
Scas_668.17                                                           260   7e-83
YGL164C (YRB30) [1825] chr7 complement(191982..193304) Protein o...   251   5e-79
Kwal_14.1542                                                          107   5e-27
CAGL0J11198g 1088932..1089858 similar to sp|P53881 Saccharomyces...    30   5.0  
CAGL0L10230g 1098614..1099747 similar to sp|Q08446 Saccharomyces...    30   5.1  
ACR092C [1139] [Homologous to ScYOR036W (PEP12) - SH] (521646..5...    29   7.7  

>AEL296W [2209] [Homologous to ScYGL164C - SH]
           complement(86307..87626) [1320 bp, 439 aa]
          Length = 439

 Score =  798 bits (2061), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/431 (92%), Positives = 398/431 (92%)

Query: 1   MDELLSRAGSQAVSFAIKSSVSLASTYAIKQFTKFLTGVPQQDASRLQKLRRQLETRIDI 60
           MDELLSRAGSQAVSFAIKSSVSLASTYAIKQFTKFLTGVPQQDASRLQKLRRQLETRIDI
Sbjct: 1   MDELLSRAGSQAVSFAIKSSVSLASTYAIKQFTKFLTGVPQQDASRLQKLRRQLETRIDI 60

Query: 61  INNAIVLIKLCVVRGNTNLKSTLSLILDLKDELAEFNGDMEMLSSASVAGKLPASKNGKA 120
           INNAIVLIKLCVVRGNTNLKSTLSLILDLKDELAEFNGDMEMLSSASVAGKLPASKNGKA
Sbjct: 61  INNAIVLIKLCVVRGNTNLKSTLSLILDLKDELAEFNGDMEMLSSASVAGKLPASKNGKA 120

Query: 121 GVDAVSLMEAKMSELIHRIELVIPLINLSMTTSGVSSSMKLPSNVSPSLLLQASNYVVKS 180
           GVDAVSLMEAKMSELIHRIELVIPLINLSMTTSGVSSSMKLPSNVSPSLLLQASNYVVKS
Sbjct: 121 GVDAVSLMEAKMSELIHRIELVIPLINLSMTTSGVSSSMKLPSNVSPSLLLQASNYVVKS 180

Query: 181 NEQALADNYEKDVQVGPLFSVTVYDIFDKSSKIIWKETMARCDLRIVRISSNIPDRGVEY 240
           NEQALADNYEKDVQVGPLFSVTVYDIFDKSSKIIWKETMARCDLRIVRISSNIPDRGVEY
Sbjct: 181 NEQALADNYEKDVQVGPLFSVTVYDIFDKSSKIIWKETMARCDLRIVRISSNIPDRGVEY 240

Query: 241 NYHLELKENFDDDRYHDIKEDKPRKLHWNVEQITRLFFTMSGKLLNLEERDSPXXXXXXX 300
           NYHLELKENFDDDRYHDIKEDKPRKLHWNVEQITRLFFTMSGKLLNLEERDSP       
Sbjct: 241 NYHLELKENFDDDRYHDIKEDKPRKLHWNVEQITRLFFTMSGKLLNLEERDSPVLVLKLV 300

Query: 301 XSLXXXXXXXXXXLHWLAVGEYEPASDLRDSDDDIPSPANADAEAPGQDSDNEDSYDSAQ 360
            SL          LHWLAVGEYEPASDLRDSDDDIPSPANADAEAPGQDSDNEDSYDSAQ
Sbjct: 301 KSLGGESGESNESLHWLAVGEYEPASDLRDSDDDIPSPANADAEAPGQDSDNEDSYDSAQ 360

Query: 361 EDGTXXXXXXXXXXXXXXXKLTSLQNHDQASILDVKDERLSLYLNDENPNSVKRQPVVED 420
           EDGT               KLTSLQNHDQASILDVKDERLSLYLNDENPNSVKRQPVVED
Sbjct: 361 EDGTELEISSSLSLLEYIIKLTSLQNHDQASILDVKDERLSLYLNDENPNSVKRQPVVED 420

Query: 421 VTAKFSKISMK 431
           VTAKFSKISMK
Sbjct: 421 VTAKFSKISMK 431

>Sklu_1546.1 YGL164C, Contig c1546 317-1606 reverse complement
          Length = 429

 Score =  309 bits (792), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 193/449 (42%), Positives = 271/449 (60%), Gaps = 42/449 (9%)

Query: 1   MDELLSRAGSQAVSFAIKSSVSLASTYAIKQFTKFLTGVPQQDASRLQKLRRQLETRIDI 60
           MDE+L++AGSQAV+FAIKS +SLAS+YAIK    FLT +P+ DA+RL++LR++LETRI+I
Sbjct: 1   MDEILAKAGSQAVTFAIKSGISLASSYAIKTVANFLTKIPKDDAARLERLRKKLETRIEI 60

Query: 61  INNAIVLIKLCVVRGNTNLKSTLSLILDLKDELAEFNGDMEMLSSASVAGKLPASKNGKA 120
           ++ AI LIKL   +GNTNL STL L  DLK+E+  F+  +  ++      K   +K  +A
Sbjct: 61  VSPAIDLIKLVAAKGNTNLGSTLRLTKDLKEEIDSFDNRIAEIT------KNYGAKTQRA 114

Query: 121 GVDAVSLMEAKMSELIHRIELVIPLINLSMTTSGVSSSMKLPSNVSPSLLLQASNYVVKS 180
            +DAV   E  + +L+ RIE VIPLINLS+TTSG S S  LP +VSP  LL AS+Y+ K+
Sbjct: 115 SIDAV---ENYIRDLLSRIEEVIPLINLSLTTSGASLSAALPQHVSPGSLLHASDYISKN 171

Query: 181 NEQALADNYEKDVQVGPLFSVTVYDIF----------DKSSKIIWKETMARCDLRIVRIS 230
           N Q    N + D QVGP F +T++ IF          D  ++I WKE M +  + + R  
Sbjct: 172 NTQF---NGKDDRQVGPTFELTLFSIFYHIVTPDGQEDSRTRITWKEDMKKAIVTLWRRH 228

Query: 231 SNIPDRGVEYNYHLELKENFDDDRYHDIKEDKPRKLHWNVEQITRLFFTMSGKLLNLEER 290
           ++  D    Y+Y+L+++E+FDD RYHD+KE+ P+ ++ ++ QI RLFF+ SGKLL LEER
Sbjct: 229 NSKQD----YDYYLKIRESFDDGRYHDLKEETPKVINVDIYQIIRLFFSASGKLLKLEER 284

Query: 291 DSP----XXXXXXXXSLXXXXXXXXXXLHWLAVGEYEPASDLRDSDDDIPSPANADAEAP 346
           +SP            S           + W A+GEY P            S    + E  
Sbjct: 285 NSPVLVLKVDSNLRSSFKEDHATSTEDIEWFALGEYVPDDGSD-------SSDEDENEDR 337

Query: 347 GQDSDNEDSYDSAQEDGT----XXXXXXXXXXXXXXXKLTSLQNHDQASILDVKDERLSL 402
            +D + +DS++SA E  T                   +LTSLQ +DQ SIL V DERLSL
Sbjct: 338 DEDDEGDDSFESADEGETPYSESKETNNSLALLEYLLRLTSLQCNDQMSILQVHDERLSL 397

Query: 403 YLNDENPNSVK-RQPVVEDVTAKFSKISM 430
           YLNDENPNS+K ++  ++DVT +  K+ +
Sbjct: 398 YLNDENPNSIKAKRYNIDDVTDRLKKVDL 426

>CAGL0I04202g complement(368221..369498) highly similar to sp|P53107
           Saccharomyces cerevisiae YGL164c, start by similarity
          Length = 425

 Score =  283 bits (723), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 173/425 (40%), Positives = 247/425 (58%), Gaps = 33/425 (7%)

Query: 1   MDELLSRAGSQAVSFAIKSSVSLASTYAIKQFTKFLTGVPQQDASRLQKLRRQLETRIDI 60
           MDE+L++AGSQAV+FAIKS VS+ASTYAIK  T F+  +P+ DA R++KLR +L+ RI+I
Sbjct: 1   MDEILAKAGSQAVTFAIKSGVSIASTYAIKTITGFILKIPKDDAKRIEKLRIKLQNRIEI 60

Query: 61  INNAIVLIKLCVVRGNTNLKSTLSLILDLKDELAEFNGDMEMLSSASVAGKLPASKNGKA 120
           ++ AI LI+L   RGNTNL+STL L  DL+ E+ +F+  +  L+      K+  S+  K 
Sbjct: 61  VSYAIDLIRLVAARGNTNLESTLRLTSDLRVEIDQFDDKIHELTE-----KVEGSRTAKT 115

Query: 121 GVDAVSLMEAKMSELIHRIELVIPLINLSMTTSGVSSSMKLPSNVSPSLLLQASNYVVKS 180
             D+++ +E  + +L+ RIE + P INLS+TTSG + S  L + VSP LLL ASNYVVK+
Sbjct: 116 QKDSINAVELYIKDLLDRIEEITPFINLSLTTSGANLSSNLTNTVSPGLLLSASNYVVKN 175

Query: 181 NEQALADNYEKDVQVGPLFSVTVYDIF-------DKSSKIIWKETMARCDLRIVRISSNI 233
           N+    +    DVQVGP F  T + +F         + ++ WKE M R   RI+R     
Sbjct: 176 NDMFAGE----DVQVGPTFETTYFSVFYHLPSEKHNNIRVTWKEDMKRGITRIIR----R 227

Query: 234 PDRGVEYNYHLELKENFDDDRYHDIK--EDKPRKLHWNVEQITRLFFTMSGKLLNLEERD 291
            D   ++NY L + ++FDD RYH+ +  E+KPR L  N+ QI +LFF++SGKLL L ERD
Sbjct: 228 KDETNKFNYVLRIDQSFDDGRYHNTENDEEKPRSLEMNICQIVKLFFSVSGKLLKLPERD 287

Query: 292 SPXXXXXXXXSLXXX---XXXXXXXLHWLAVGEYEPASDLRDSDDDIPSPANADAEAPGQ 348
           SP        ++             + W A+G YE             S ++ D+     
Sbjct: 288 SPVLVIKTDKNIKGKGIHSNSSTEDIEWFALGSYESTDS--------DSSSDEDSSDEDN 339

Query: 349 DSDNEDSYDSAQEDGTXXXXXXXXXXXXXXXKLTSLQNHDQASILDVKDERLSLYLNDEN 408
            ++ ED+  S                     +L SLQ +D  SIL+VKDERLS+YLNDEN
Sbjct: 340 SANYEDANSSNSNIIPSNERSSSISLLEYILRLVSLQFNDDMSILEVKDERLSVYLNDEN 399

Query: 409 PNSVK 413
           PN+++
Sbjct: 400 PNAIR 404

>Scas_668.17
          Length = 412

 Score =  260 bits (665), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 141/302 (46%), Positives = 200/302 (66%), Gaps = 21/302 (6%)

Query: 1   MDELLSRAGSQAVSFAIKSSVSLASTYAIKQFTKFLTGVPQQDASRLQKLRRQLETRIDI 60
           MD+LL++AGSQAV+FAI+S VSLAS++AIK  T F+  +P+ DA R++ LR +LE RI+I
Sbjct: 1   MDDLLAKAGSQAVTFAIRSGVSLASSFAIKTLTNFIVHIPKNDARRIESLRAKLENRIEI 60

Query: 61  INNAIVLIKLCVVRGNTNLKSTLSLILDLKDELAEFNGDMEMLSSASVAGKLPASKNGKA 120
           +++AI LIKL   RGNTNL STL L  DLK E+  F+  M+ L+      K+  SK+ K+
Sbjct: 61  VSSAIDLIKLVAARGNTNLDSTLRLTKDLKQEIDSFDEKMKRLTE-----KVTTSKSSKS 115

Query: 121 GVDAVSLMEAKMSELIHRIELVIPLINLSMTTSGVSSSMKLPSNVSPSLLLQASNYVVKS 180
             +A+  +EA + +L+ RIE V P INLS+ T+G S S  LP  VSP LLLQASN+V +S
Sbjct: 116 QEEAIKSVEAYIEDLLLRIEEVTPFINLSLNTTGTSLSTALPQQVSPGLLLQASNFVSRS 175

Query: 181 NEQALADNYEKDVQVGPLFSVTVYDIF-------DKSSKIIWKETMARCDLRIVRISSNI 233
           N+  L       ++VGP F  TV+ +F       D  ++I W+E M R  ++IVR  S  
Sbjct: 176 NDGKLIHG---KLRVGPTFQATVFSVFYNMSSGADPKARITWREDMKRAFIKIVRTES-- 230

Query: 234 PDRGVEYNYHLELKENFDDDRYHDIK--EDKPRKLHWNVEQITRLFFTMSGKLLNLEERD 291
             +  E+ Y L ++++FDD RYH+ +  E+ P+K   ++ QI +LFF++SGKLL LEERD
Sbjct: 231 --KEKEFEYQLIIEQSFDDGRYHNTEDGEEVPQKTALDISQIRKLFFSISGKLLRLEERD 288

Query: 292 SP 293
           SP
Sbjct: 289 SP 290

>YGL164C (YRB30) [1825] chr7 complement(191982..193304) Protein of
           unknown function, has moderate similarity to
           uncharacterized C. albicans Orf6.8006p [1323 bp, 440 aa]
          Length = 440

 Score =  251 bits (641), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 136/312 (43%), Positives = 204/312 (65%), Gaps = 28/312 (8%)

Query: 1   MDELLSRAGSQAVSFAIKSSVSLASTYAIKQFTKFLTGVPQQDASRLQKLRRQLETRIDI 60
           MDE+L++AGSQAV+FAIKS +S+ASTYA+K  T F+  +P+ DA R+ +L+ +LE+R+ I
Sbjct: 1   MDEILAKAGSQAVTFAIKSGISIASTYALKTITNFVVQIPKDDARRIDQLKFKLESRMAI 60

Query: 61  INNAIVLIKLCVVRGNTNLKSTLSLILDLKDELAEFNGDMEMLSSASVAGKLPASKNGKA 120
           +++AI LIKL   RGNTNL+ TL L  DLK+E+  F+  +  ++      K+  S++ K 
Sbjct: 61  VSSAIDLIKLVAARGNTNLQITLRLTKDLKEEIDRFDEKINEMTQ-----KVEGSRSAKT 115

Query: 121 GVDAVSLMEAKMSELIHRIELVIPLINLSMTTSGVSSSMKLPSNVSPSLLLQASNYV--- 177
             +A+  +E  + +L+ RIE + P INLS+TTSG + +  LP  +SP LLL+AS++V   
Sbjct: 116 QNEAIKAVENYIKDLLLRIEEITPFINLSLTTSGANLNSALPYQLSPGLLLKASDFVSEN 175

Query: 178 -------VKSNEQALADNYEKDVQVGPLFSVTVYDIF-------DKSSKIIWKETMARCD 223
                  +KSNE+   D     VQVGP F VT++ IF       +  S I+WKE M R  
Sbjct: 176 NRKYEKAMKSNEKGTGDKEILKVQVGPTFEVTLFSIFYNLTSENNGQSGIVWKEDMKRAK 235

Query: 224 LRIVRISSNIPDRGVEYNYHLELKENFDDDRYH--DIKEDKPRKLHWNVEQITRLFFTMS 281
            RI R++S     G +Y+Y ++++++F+D RYH  D KED P++L  ++  I +LFF++S
Sbjct: 236 ARIYRLNST----GRKYDYFMKIEQDFNDGRYHEDDDKEDTPQELAIDLNHIKKLFFSVS 291

Query: 282 GKLLNLEERDSP 293
           GKLL LEE+DSP
Sbjct: 292 GKLLRLEEQDSP 303

>Kwal_14.1542
          Length = 204

 Score =  107 bits (267), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 105/204 (51%), Gaps = 19/204 (9%)

Query: 232 NIPDRGVEYNYHLELKENFDDDRYHDIKEDKPRKLHWNVEQITRLFFTMSGKLLNLEERD 291
           +I DR  EY+Y + LKE+F+D RYHD +++ P+    ++ QIT+LFFT SGKLL LEER+
Sbjct: 12  SIGDR--EYDYFIRLKESFNDGRYHDPEQETPKLKERDIWQITKLFFTASGKLLKLEERN 69

Query: 292 SPXXXXXXXXSL----XXXXXXXXXXLHWLAVGEYEPASDLRDSDDDIPSPANADAEAPG 347
           SP         +              + WLA GE           D       +      
Sbjct: 70  SPVLVLKVDKDIKSPFAEDHGTSTEDVEWLAFGEC----------DFEADLEESSESEAE 119

Query: 348 QDSDNEDSYDSAQEDGTXXXXXXXXXXXXXXXKLTSLQNHDQASILDVKDERLSLYLNDE 407
            + D+E +Y+   E  +               +L SLQ +DQ SIL V DERLS+YLNDE
Sbjct: 120 DEGDDESNYEETTE--SPVPVSDSIALLEYIIRLASLQCNDQLSILQVHDERLSMYLNDE 177

Query: 408 NPNSVK-RQPVVEDVTAKFSKISM 430
           NPNS+K ++  V++VT K  KI +
Sbjct: 178 NPNSIKSKRYNVDEVTTKLKKIDL 201

>CAGL0J11198g 1088932..1089858 similar to sp|P53881 Saccharomyces
          cerevisiae YNL177c, hypothetical start
          Length = 308

 Score = 29.6 bits (65), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (54%)

Query: 38 GVPQQDASRLQKLRRQLETRIDIINNAIVLIKLCVVRGNTNL 79
          G+P ++ASR+   RR L T    +NN+  L       GNTNL
Sbjct: 11 GLPLRNASRVLANRRLLSTSFPCLNNSGNLFGSITDTGNTNL 52

>CAGL0L10230g 1098614..1099747 similar to sp|Q08446 Saccharomyces
           cerevisiae YOR057w SGT1 suppressor of G2 allele of SKP1,
           start by similarity
          Length = 377

 Score = 29.6 bits (65), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 17/27 (62%)

Query: 229 ISSNIPDRGVEYNYHLELKENFDDDRY 255
           IS  IPD+G E+ Y+++L  N D   Y
Sbjct: 216 ISYPIPDKGSEFQYNIDLAHNVDPQEY 242

>ACR092C [1139] [Homologous to ScYOR036W (PEP12) - SH]
           (521646..522470) [825 bp, 274 aa]
          Length = 274

 Score = 28.9 bits (63), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 28/60 (46%), Gaps = 1/60 (1%)

Query: 88  DLKDELAEFNGDMEMLSSASVAGKLPASKNGKAGVDAVSLMEAKMSELIHRIELVIPLIN 147
           D+   L E NG +       + G     +NGKA    V  +  +  E+IH++ L++  +N
Sbjct: 26  DIVSNLFEMNGQLGTFQHF-IKGLESNYRNGKANTMVVENISNRSMEVIHKVSLLVKTLN 84

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.129    0.354 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,016,040
Number of extensions: 543516
Number of successful extensions: 2353
Number of sequences better than 10.0: 26
Number of HSP's gapped: 2321
Number of HSP's successfully gapped: 26
Length of query: 431
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 327
Effective length of database: 12,995,837
Effective search space: 4249638699
Effective search space used: 4249638699
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 63 (28.9 bits)