Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AEL226W32431816790.0
Sklu_1927.13453087941e-105
KLLA0A07106g3103067431e-97
Kwal_55.199263123096805e-88
Scas_617.63303196121e-77
CAGL0H08217g3253165661e-70
YOR026W (BUB3)3413265418e-67
YER107C (GLE2)3653072786e-28
CAGL0G03399g3693062752e-27
Scas_510.53623042592e-25
AGL301C3613132522e-24
KLLA0E20779g3713082312e-21
Sklu_2332.73673082303e-21
Kwal_27.107853673082286e-21
Kwal_26.7736507124950.001
Scas_706.24460136890.004
KLLA0F13772g520125840.018
AGR242C419107810.041
YMR116C (ASC1)319108780.078
Kwal_56.24526121062780.11
CAGL0J01265g517179760.15
CAGL0I03718g120193770.16
Scas_592.4*31858750.21
YDL145C (COP1)120162760.22
KLLA0D16390g93630750.26
Kwal_55.22076128631750.28
Scas_512.353444730.38
Scas_624.11120562730.40
CAGL0K10626g69664720.50
CAGL0L02761g419118720.54
Scas_721.32822190710.69
KLLA0E07942g39089700.73
ADR312W66083710.79
Sklu_2371.4478107700.80
ADR077C120462710.80
CAGL0C02937g46728700.81
Scas_721.115*31858700.84
CAGL0E02805g84086700.86
YBL008W (HIR1)840106700.89
AGL234W62931700.99
AAL094W66635701.0
Sklu_1731.457632701.0
Kwal_0.4958432691.3
YGR200C (ELP2)78881691.5
AGR207C320139681.5
Kwal_26.862842266681.6
CAGL0M09845g93664681.9
CAGL0M02277g42748671.9
Sklu_2172.626362662.1
KLLA0E23529g826217672.2
Scas_630.662131672.3
AGR168W82587672.4
Kwal_23.411893951672.4
CAGL0H08932g90290672.4
ACR194C51381662.6
KLLA0F04884g121241672.7
AFL022W37175662.7
KLLA0F10263g68246662.8
Kwal_23.642975046662.9
AFL118W83273663.0
Sklu_2160.376031663.0
CAGL0J06512g54539653.5
Scas_660.8510120653.7
Scas_720.83d915103653.7
YLR409C (UTP21)93964654.1
KLLA0B01958g89079654.1
CAGL0G09845g500161644.7
CAGL0E01485g133638645.1
Kwal_56.2392093727645.5
CAGL0M06193g31647635.5
KLLA0E11143g49335636.3
Kwal_47.17465800105636.8
Kwal_56.2416372931637.4
KLLA0F11231g43448627.9
Scas_544.452448628.5
YHR186C (KOG1)155731629.6
YGL137W (SEC27)88936629.7
YIL046W (MET30)64052629.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AEL226W
         (318 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AEL226W [2280] [Homologous to ScYOR026W (BUB3) - SH] complement(...   651   0.0  
Sklu_1927.1 YOR026W, Contig c1927 98-1135 reverse complement          310   e-105
KLLA0A07106g complement(640536..641468) similar to sp|P26449 Sac...   290   1e-97
Kwal_55.19926                                                         266   5e-88
Scas_617.6                                                            240   1e-77
CAGL0H08217g complement(806660..807637) similar to sp|P26449 Sac...   222   1e-70
YOR026W (BUB3) [4839] chr15 (379780..380805) Checkpoint protein ...   213   8e-67
YER107C (GLE2) [1539] chr5 complement(373444..374541) Nuclear po...   111   6e-28
CAGL0G03399g complement(325879..326988) highly similar to sp|P40...   110   2e-27
Scas_510.5                                                            104   2e-25
AGL301C [4011] [Homologous to ScYER107C (GLE2) - SH] (137221..13...   101   2e-24
KLLA0E20779g complement(1841092..1842207) similar to sp|P40066 S...    94   2e-21
Sklu_2332.7 YER107C, Contig c2332 14211-15314 reverse complement       93   3e-21
Kwal_27.10785                                                          92   6e-21
Kwal_26.7736                                                           41   0.001
Scas_706.24                                                            39   0.004
KLLA0F13772g 1276532..1278094 highly similar to sp|Q04305 Saccha...    37   0.018
AGR242C [4553] [Homologous to ScYIR012W (SQT1) - SH] (1203152..1...    36   0.041
YMR116C (ASC1) [4073] chr13 complement(499455..499877,500151..50...    35   0.078
Kwal_56.24526                                                          35   0.11 
CAGL0J01265g complement(118375..119928) highly similar to sp|Q04...    34   0.15 
CAGL0I03718g complement(317565..321170) highly similar to sp|P53...    34   0.16 
Scas_592.4*                                                            33   0.21 
YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer (C...    34   0.22 
KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces...    33   0.26 
Kwal_55.22076                                                          33   0.28 
Scas_512.3                                                             33   0.38 
Scas_624.11                                                            33   0.40 
CAGL0K10626g complement(1031704..1033794) highly similar to sp|P...    32   0.50 
CAGL0L02761g complement(320826..322085) similar to sp|P18851 Sac...    32   0.54 
Scas_721.32                                                            32   0.69 
KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces c...    32   0.73 
ADR312W [2053] [Homologous to ScYOL060C (AMI3) - SH] complement(...    32   0.79 
Sklu_2371.4 YDR030C, Contig c2371 8070-9506 reverse complement         32   0.80 
ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH] (843171..84...    32   0.80 
CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces c...    32   0.81 
Scas_721.115*                                                          32   0.84 
CAGL0E02805g complement(265137..267659) similar to sp|P32479 Sac...    32   0.86 
YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription...    32   0.89 
AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH] complement(...    32   0.99 
AAL094W [93] [Homologous to ScYOR249C (APC5) - SH] complement(17...    32   1.0  
Sklu_1731.4 YJL069C, Contig c1731 3709-5439 reverse complement         32   1.0  
Kwal_0.49                                                              31   1.3  
YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa sub...    31   1.5  
AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH] (1146710..1...    31   1.5  
Kwal_26.8628                                                           31   1.6  
CAGL0M09845g 975007..977817 highly similar to sp|Q06078 Saccharo...    31   1.9  
CAGL0M02277g complement(271836..273119) highly similar to sp|Q12...    30   1.9  
Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement       30   2.1  
KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces...    30   2.2  
Scas_630.6                                                             30   2.3  
AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH] complement(...    30   2.4  
Kwal_23.4118                                                           30   2.4  
CAGL0H08932g join(871668..871685,872089..874779) highly similar ...    30   2.4  
ACR194C [1241] [Homologous to ScYDL156W - SH] (690186..691727) [...    30   2.6  
KLLA0F04884g complement(478044..481682) similar to sp|P53622 Sac...    30   2.7  
AFL022W [3171] [Homologous to ScYBR234C (ARC40) - SH] complement...    30   2.7  
KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA Kluy...    30   2.8  
Kwal_23.6429                                                           30   2.9  
AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH] complement...    30   3.0  
Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement         30   3.0  
CAGL0J06512g complement(620516..622153) similar to sp|Q04199 Sac...    30   3.5  
Scas_660.8                                                             30   3.7  
Scas_720.83d                                                           30   3.7  
YLR409C (UTP21) [3786] chr12 complement(934411..937230) Member o...    30   4.1  
KLLA0B01958g join(170646..170663,170896..173550) similar to sp|P...    30   4.1  
CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces c...    29   4.7  
CAGL0E01485g complement(138830..142840) similar to tr|Q08281 Sac...    29   5.1  
Kwal_56.23920                                                          29   5.5  
CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces c...    29   5.5  
KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces c...    29   6.3  
Kwal_47.17465                                                          29   6.8  
Kwal_56.24163                                                          29   7.4  
KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417 S...    28   7.9  
Scas_544.4                                                             28   8.5  
YHR186C (KOG1) [2471] chr8 complement(475997..480670) Component ...    28   9.6  
YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741) Coat...    28   9.7  
YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that ...    28   9.9  

>AEL226W [2280] [Homologous to ScYOR026W (BUB3) - SH]
           complement(204812..205786) [975 bp, 324 aa]
          Length = 324

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/318 (100%), Positives = 318/318 (100%)

Query: 1   MVSGEPGNVASAMAYVELKDVSKDYLSGVCLVDEEGSQLIVSSWDGTASLYDWEKNKRMG 60
           MVSGEPGNVASAMAYVELKDVSKDYLSGVCLVDEEGSQLIVSSWDGTASLYDWEKNKRMG
Sbjct: 1   MVSGEPGNVASAMAYVELKDVSKDYLSGVCLVDEEGSQLIVSSWDGTASLYDWEKNKRMG 60

Query: 61  RLSHEWPLTSVAVCAGTRRAYVGSAQGEVLELDWESERMVALQGVQCGLGISAMGSYGQF 120
           RLSHEWPLTSVAVCAGTRRAYVGSAQGEVLELDWESERMVALQGVQCGLGISAMGSYGQF
Sbjct: 61  RLSHEWPLTSVAVCAGTRRAYVGSAQGEVLELDWESERMVALQGVQCGLGISAMGSYGQF 120

Query: 121 VVVGSWDGSLAVVDTRRNTVRHIRRLTGKILSLDCGAARVVCMTTDGVYVFRTSDIDAAP 180
           VVVGSWDGSLAVVDTRRNTVRHIRRLTGKILSLDCGAARVVCMTTDGVYVFRTSDIDAAP
Sbjct: 121 VVVGSWDGSLAVVDTRRNTVRHIRRLTGKILSLDCGAARVVCMTTDGVYVFRTSDIDAAP 180

Query: 181 ERRESGLKYQSRCVRLVPDEEGYVQSSVDGRVAVEYFGDEGRKFAFRCHRMNLKDTQLVF 240
           ERRESGLKYQSRCVRLVPDEEGYVQSSVDGRVAVEYFGDEGRKFAFRCHRMNLKDTQLVF
Sbjct: 181 ERRESGLKYQSRCVRLVPDEEGYVQSSVDGRVAVEYFGDEGRKFAFRCHRMNLKDTQLVF 240

Query: 241 PVNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVKLCCNRRALVIAASD 300
           PVNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVKLCCNRRALVIAASD
Sbjct: 241 PVNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVKLCCNRRALVIAASD 300

Query: 301 DSFKTSAVVEDIALQRSR 318
           DSFKTSAVVEDIALQRSR
Sbjct: 301 DSFKTSAVVEDIALQRSR 318

>Sklu_1927.1 YOR026W, Contig c1927 98-1135 reverse complement
          Length = 345

 Score =  310 bits (794), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 153/308 (49%), Positives = 216/308 (70%), Gaps = 5/308 (1%)

Query: 11  SAMAYVELKDVSKDYLSGVCLVDEEGSQLIVSSWDGTASLYDWEKNKRMGRLSHEWPLTS 70
           + M + +L+DV+KDY+S + L+ E  S ++ +SWDG+ S+YD++   R+  L H++PL S
Sbjct: 35  ATMPFHKLQDVTKDYISDLVLL-ESYSHIVCTSWDGSISMYDYDSMNRLTSLRHKFPLLS 93

Query: 71  VAVCAGTRRAYVGSAQGEVLELDWESERMVALQGVQCGLGISAMGSYGQFVVVGSWDGSL 130
             V    +  YVGS QGE+LE+D ESE+   +      LGIS++      V+ GSWDGSL
Sbjct: 94  TGVVHNGK-IYVGSVQGEMLEVDLESEKFGTVSE-SAELGISSICIQDASVIAGSWDGSL 151

Query: 131 AVVDTRRNTVRHIRRLTGKILSLDCGAARV-VCMTTDGVYVFRTSDIDAAPERRESGLKY 189
            +VD+R N  +    L  K+LS+DC   ++ + +T   V +F    +  AP  R++GLK+
Sbjct: 152 RIVDSRNNDTQFETALGHKVLSMDCHENKLCISLTAGEVKIFDLRKL-GAPVSRKAGLKF 210

Query: 190 QSRCVRLVPDEEGYVQSSVDGRVAVEYFGDEGRKFAFRCHRMNLKDTQLVFPVNALCFHP 249
           Q+R ++++P  EGYVQSS+DGRVAVEYF  E +KFAFRCHRM+L+D Q VFPVN +CF P
Sbjct: 211 QARDIKIMPSYEGYVQSSLDGRVAVEYFDQEEKKFAFRCHRMSLQDAQFVFPVNTICFKP 270

Query: 250 KTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVKLCCNRRALVIAASDDSFKTSAVV 309
            ++ L+TGGSDGR++AWNL+TRKK++ELPK++ SVVK+ CN R +V A SDDSFKTSA V
Sbjct: 271 HSSTLFTGGSDGRIYAWNLSTRKKSDELPKLDSSVVKVACNDRVVVAATSDDSFKTSATV 330

Query: 310 EDIALQRS 317
           ED+ LQ S
Sbjct: 331 EDLPLQPS 338

>KLLA0A07106g complement(640536..641468) similar to sp|P26449
           Saccharomyces cerevisiae YOR026w BUB3 cell cycle arrest
           protein, start by similarity
          Length = 310

 Score =  290 bits (743), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 145/306 (47%), Positives = 198/306 (64%), Gaps = 9/306 (2%)

Query: 15  YVELKDVSKDYLSGVCLVDEEGSQLIVSSWDGTASLYDWEKNKRMGRLSHEWPLTSVAVC 74
           Y +L+ V KDY+S + ++  + ++++VS WDG+ SL+D  + + + +L H WPLTS  V 
Sbjct: 4   YAKLQGVPKDYISDIRIISSD-NRVVVSCWDGSLSLFDITQQQLLMKLQHSWPLTSCHV- 61

Query: 75  AGTRRAYVGSAQGEVLELDWESERMVALQGVQCGLGISAMGSYGQFVVVGSWDGSLAVVD 134
           +   R + GS QGEVLE DWESER++    +   LG+S + S   F++  SWDGSL V+D
Sbjct: 62  SKDGRIWAGSVQGEVLEADWESERLIPNDTMSFSLGVSGITSIDHFIIASSWDGSLIVLD 121

Query: 135 TRRNTVRHIRRLTGKILSLDCGAARVVCMTTDG---VYVFRTSDIDAAPERRESGLKYQS 191
             RN +    +   KI  L     RV+C  + G   +  F + DI       ESGLKYQ 
Sbjct: 122 YLRNQIVKQWKFEEKIFQLCASEVRVMCSLSSGKVKLIQFPSWDI----TETESGLKYQC 177

Query: 192 RCVRLVPDEEGYVQSSVDGRVAVEYFGDEGRKFAFRCHRMNLKDTQLVFPVNALCFHPKT 251
           R   L+P+  G+VQ SVDGRV+VE+F D+  KFAFRCHRMNL+D Q+VFPV AL F P +
Sbjct: 178 RSCTLIPNNRGFVQGSVDGRVSVEFFDDQSPKFAFRCHRMNLEDVQMVFPVTALAFQPNS 237

Query: 252 ALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVKLCCNRRALVIAASDDSFKTSAVVED 311
             L+TGG+DG++ +WNL TRKK EE  K++D+++KLCC    LVIA SDDSFKT AV +D
Sbjct: 238 LNLFTGGADGKIVSWNLVTRKKQEEFHKLDDTIMKLCCTEDYLVIAVSDDSFKTCAVPQD 297

Query: 312 IALQRS 317
           I L  S
Sbjct: 298 IELHPS 303

>Kwal_55.19926
          Length = 312

 Score =  266 bits (680), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 145/309 (46%), Positives = 190/309 (61%), Gaps = 6/309 (1%)

Query: 13  MAYVELKDVSKDYLSGVCLVDEEGSQLIVSSWDGTASLYDWEKNKRMGRLSHEWPLTSVA 72
           M +        DY+SG+ ++      + V++WDGT SLY++E N  + R+ +   LTS A
Sbjct: 1   MPFECFDSPPNDYISGL-VIKGITPHVNVTAWDGTLSLYNYEDNDLVLRMRYNDALTSCA 59

Query: 73  VCAGTRRAYVGSAQGEVLELDWESERMVALQGVQCGLGISAMGSYGQFVVVGSWDGSLAV 132
                 + +VGS  GEVLE+D+ESER   L      LGISA+      ++ GSWDGSL +
Sbjct: 60  YSEVGSKIFVGSVSGEVLEVDFESERF-NLISEPAELGISALCCSQNNIIAGSWDGSLQI 118

Query: 133 VDTRRNTVRHIRRLTG-KILSLDCGAAR--VVCMTTDGVYVFRTSDIDAAPERRESGLKY 189
           VD+R        RL   KIL +DC      VV +T   V ++   ++   P+ RESGLK+
Sbjct: 119 VDSRSGDRWFRERLDNCKILGMDCADNNKLVVSLTGGKVAIYDLRNM-IKPQIRESGLKF 177

Query: 190 QSRCVRLVPDEEGYVQSSVDGRVAVEYFGDEGRKFAFRCHRMNLKDTQLVFPVNALCFHP 249
           Q+R ++L+P   GYVQSS+DGRVAVEYF  E  +FAFRCHRMNL DTQ VFPVN+LCF+ 
Sbjct: 178 QTRDIKLMPAANGYVQSSLDGRVAVEYFDQESSRFAFRCHRMNLPDTQFVFPVNSLCFNS 237

Query: 250 KTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVKLCCNRRALVIAASDDSFKTSAVV 309
               LYTGGSDGRV+ WNL+TRKK+ E PK EDS+VKL      L +A  DDSFKT   V
Sbjct: 238 NDGTLYTGGSDGRVYGWNLSTRKKSHEFPKFEDSIVKLAYKNDVLCVATGDDSFKTLPTV 297

Query: 310 EDIALQRSR 318
           E   +Q  +
Sbjct: 298 EGAEIQPGK 306

>Scas_617.6
          Length = 330

 Score =  240 bits (612), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 138/319 (43%), Positives = 193/319 (60%), Gaps = 18/319 (5%)

Query: 16  VELKDVSKDYLSGVCLVDEEGSQLIVSSWDGTASLYDWEKNKRMGRLS----HEWPLTS- 70
           VE+++   +Y+S + L+DE+ SQ +V++WDG+ S +++  N +  +L     HE+ L   
Sbjct: 7   VEVQNGPSEYISDIVLIDEK-SQFLVTAWDGSLSQFEYNPNLKKVKLIKKVVHEYALLCC 65

Query: 71  -VAVCAGTRRAYVGSAQGEVLELDWESERMVALQGVQCGLGISAMGSYGQFVVVGS-WDG 128
             A   G  R YVG+ QGE+  +D+E+     + G    LG+S M + G +  + S WDG
Sbjct: 66  CYAFVLGKLRVYVGTVQGEIFLVDFENSDFKPVLGNSTQLGVSKMVNVGNYTFIASSWDG 125

Query: 129 SLAVVDTRRNTVRHIRRLTG--KILSLDC-GAARVVCMTTDGV----YVFRTSDIDAAPE 181
            L  +D + N V    +L    K+L++DC     ++ +T   +         +D     E
Sbjct: 126 ILQEIDMQDNAVIRTTKLENNTKVLAMDCVNNLLILALTGKKIRWLNLPLNNNDRGEVTE 185

Query: 182 RRESGLKYQSRCVRLVPDEEGYVQSSVDGRVAVEYFGDEGRKFAFRCHRMNLKDTQLVFP 241
             E+GLKYQ R ++L  + +GYV SS+DGRVAVEYF D+ R FAFRCHRMNL D Q VFP
Sbjct: 186 V-ETGLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSRNFAFRCHRMNLVDMQFVFP 244

Query: 242 VNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKV-EDSVVKLCCNRRALVIAASD 300
           VN+L F P + LL+TGGSDG V  WNL T KK ++ PK  E+SVVKL CN   LV+  SD
Sbjct: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDILVVGTSD 304

Query: 301 DSFKTSAVV-EDIALQRSR 318
           DSFKT+AVV E + LQ SR
Sbjct: 305 DSFKTNAVVAEPLELQSSR 323

>CAGL0H08217g complement(806660..807637) similar to sp|P26449
           Saccharomyces cerevisiae YOR026w BUB3, hypothetical
           start
          Length = 325

 Score =  222 bits (566), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 123/316 (38%), Positives = 193/316 (61%), Gaps = 14/316 (4%)

Query: 16  VELKDVSKDYLSGVCLVDEEGSQLIVSSWDGTASLYDWEKNKRMG----RLSHEWPLTSV 71
           VE+KDV ++Y+SG+ ++ E+ +Q+I+ S+DGT S+Y  ++  +      RL +E  LTSV
Sbjct: 3   VEIKDVPREYISGIEIISEQ-NQIIIVSYDGTLSVYTVDRELKQVNLTVRLQYESSLTSV 61

Query: 72  AV--CAGTRRAYVGSAQGEVLELDWESERMVALQGVQCGLGISAMGSYGQFVVVGSWDGS 129
           A     G +  Y GS  G++L +D E+   V +  ++   GIS +  +G  V+ GSWDGS
Sbjct: 62  AQLNIQGRQFIYAGSVDGQLLSVDLENSLFVKVDQIESSAGISCIAMHGDRVIAGSWDGS 121

Query: 130 LAVVDTRRNTVRHIRRLTG---KILSLDCGAARVVCMTTD-GVYVFRTSDIDAA-PERRE 184
           + VV+ + N++     L     K   L   A +++  T    + +F+        P   +
Sbjct: 122 IYVVNPKSNSLEFTLELPSEYKKCFKLSVQAHKLLISTIKCKIAIFKLPLTPTTKPHILD 181

Query: 185 SGLKYQSRCVRLVPDEEGYVQSSVDGRVAVEYFGDEGRKFAFRCHRMNLKDTQLVFPVNA 244
           SG  +Q R  +L P+ +G+V + +DGRV+VEYF D  ++FAFRCH+ +L DT + +P+NA
Sbjct: 182 SGQIFQIRDSQLTPEGDGFVCTGIDGRVSVEYFDDTSKRFAFRCHKYDLDDTVMTYPINA 241

Query: 245 LCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKV-EDSVVKLCCNRRALVIAASDDSF 303
           + F P T+  YTGGSDG V AW+L  + K ++LPK  E+SVV+L CN   L +A SDDSF
Sbjct: 242 IRFIPNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYNENSVVQLACNENILCVATSDDSF 301

Query: 304 KTSAVVE-DIALQRSR 318
           KT+AV++ ++ L+ SR
Sbjct: 302 KTNAVIDSNLELEPSR 317

>YOR026W (BUB3) [4839] chr15 (379780..380805) Checkpoint protein
           required for cell cycle arrest in response to loss of
           microtubule function [1026 bp, 341 aa]
          Length = 341

 Score =  213 bits (541), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 128/326 (39%), Positives = 189/326 (57%), Gaps = 31/326 (9%)

Query: 13  MAYVELKDVSKDYLSGVCLVDEEGSQLIVSSWDGTASLYDWEKNKR----MGRLSHEWPL 68
           M  V+++   KDY+S + ++  + S L+++SWDG+ ++Y ++   +    +  L ++ PL
Sbjct: 1   MQIVQIEQAPKDYISDIKIIPSK-SLLLITSWDGSLTVYKFDIQAKNVDLLQSLRYKHPL 59

Query: 69  TSVAVCAGTR-RAYVGSAQGEVLELDW-ESERMVALQGVQCGLGISAMGSYGQ-FVVVGS 125
                   T  + YVG+ QGE+L++D   S    AL   +  LGI  +  YG   ++  S
Sbjct: 60  LCCNFIDNTDLQIYVGTVQGEILKVDLIGSPSFQALTNNEANLGICRICKYGDDKLIAAS 119

Query: 126 WDGSLAVVDTR---------RNTVRHIRRLTGKILSLDCGAAR-VVCMTTDGVYVFRT-- 173
           WDG + V+D R         +N   +  ++  KI ++D  ++R +V M    V  FR   
Sbjct: 120 WDGLIEVIDPRNYGDGVIAVKNLNSNNTKVKNKIFTMDTNSSRLIVGMNNSQVQWFRLPL 179

Query: 174 -SDIDAAPERRESGLKYQSRCVRLVPDE-EGYVQSSVDGRVAVEYFGDEG------RKFA 225
             D +   E  ESGLKYQ R V L+P E EGY  SS+DGRVAVE+F D+G      ++FA
Sbjct: 180 CEDDNGTIE--ESGLKYQIRDVALLPKEQEGYACSSIDGRVAVEFFDDQGDDYNSSKRFA 237

Query: 226 FRCHRMNLKDTQLVFPVNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKV-EDSV 284
           FRCHR+NLKDT L +PVN++ F P+   LYT GSDG +  WNL TRKK +   K  EDSV
Sbjct: 238 FRCHRLNLKDTNLAYPVNSIEFSPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKFNEDSV 297

Query: 285 VKLCCNRRALVIAASDDSFKTSAVVE 310
           VK+ C+   L +A SDD+FKT+A ++
Sbjct: 298 VKIACSDNILCLATSDDTFKTNAAID 323

>YER107C (GLE2) [1539] chr5 complement(373444..374541) Nuclear pore
           protein required for poly(A)+ RNA export, has WD (WD-40)
           repeats, functions in the nuclear export of the small
           ribosomal subunit [1098 bp, 365 aa]
          Length = 365

 Score =  111 bits (278), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 79/307 (25%), Positives = 135/307 (43%), Gaps = 33/307 (10%)

Query: 16  VELKDVSKDYLSGVCLVDEEGSQLIVSSWDGTASLYDWEKNKRMGRLSHEWPLTSVAVCA 75
           + +   ++D +S +    ++      SSWDG   ++D +     GR  HE   +S  +C 
Sbjct: 29  IVINSPAEDSISDIAFSPQQDFMFSASSWDGKVRIWDVQNGVPQGRAQHE--SSSPVLCT 86

Query: 76  -----GTRRAYVGS---------AQGEVLELDWESERMVALQGVQCGLGISAMGSYGQFV 121
                GT+ A  G          A G+  ++   S  +  L+ VQCG       S  + +
Sbjct: 87  RWSNDGTKVASGGCDNALKLYDIASGQTQQIGMHSAPIKVLRFVQCG------PSNTECI 140

Query: 122 VVGSWDGSLAVVDTRRNTVRHIRRLTGKILSLDCGAARVVCMTTD-GVYVFRTSDIDAAP 180
           V GSWD ++   D R+        +  ++ S+D   + +V  T +  + +   ++     
Sbjct: 141 VTGSWDKTIKYWDMRQPQPVSTVMMPERVYSMDNKQSLLVVATAERHIAIINLANPTTIF 200

Query: 181 ERRESGLKYQSRCVRLVPDEEGYVQSSVDGRVAVEYFGDEGRK---FAFRCHRMNLKD-- 235
           +   S LK+Q+RCV    + +GY   SV+GR ++ Y  D  +K   F+F+CHR    +  
Sbjct: 201 KATTSPLKWQTRCVACYNEADGYAIGSVEGRCSIRYIDDGMQKKSGFSFKCHRQTNPNRA 260

Query: 236 -----TQLVFPVNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVKLCCN 290
                  LV+PVN++ FHP      T G DG    W+   R + +  P ++ S+     N
Sbjct: 261 PGSNGQSLVYPVNSIAFHPLYGTFVTAGGDGTFNFWDKNQRHRLKGYPTLQASIPVCSFN 320

Query: 291 RRALVIA 297
           R   V A
Sbjct: 321 RNGSVFA 327

>CAGL0G03399g complement(325879..326988) highly similar to sp|P40066
           Saccharomyces cerevisiae YER107c GLE2, start by
           similarity
          Length = 369

 Score =  110 bits (275), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 75/306 (24%), Positives = 138/306 (45%), Gaps = 31/306 (10%)

Query: 16  VELKDVSKDYLSGVCLVDEEGSQLIVSSWDGTASLYDWEKNKRMGRLSHE---------W 66
           + + + + D +S +    +      VSSWDG   ++D +     G+  +E         W
Sbjct: 28  IVINNPADDSISDIAFSPQHDFLFSVSSWDGKVRIWDAQNGVPQGKAQYEHNGPVLCTRW 87

Query: 67  PLTSVAV----CAGTRRAYVGSAQGEVLELDWESERMVALQGVQCGLGISAMGSYGQFVV 122
            L    +    C  T + Y   A G+  ++   ++ + +L+ VQCG       +  + +V
Sbjct: 88  SLDGARIASGGCDNTVKLY-DVASGQSQQIGSHNDAVKSLRFVQCGP------TNTECLV 140

Query: 123 VGSWDGSLAVVDTRRNTVRHIRRLTGKILSLDCGAARVVCMTTD-GVYVFRTSDIDAAPE 181
            GSWD ++   DTR+        +  ++ ++D     +V  T +  + +   ++     +
Sbjct: 141 TGSWDKTIKFWDTRQPQPITTIAMPERVYTMDNKQQLLVVGTAERHIAIINLANPTTIFK 200

Query: 182 RRESGLKYQSRCVRLVPDEEGYVQSSVDGRVAVEYFGDEGRK---FAFRCHRMNLKD--- 235
             +S LK+Q+R V    + +GY   SV+GR A++Y  DE +K   F+F+CHR    +   
Sbjct: 201 SSQSPLKWQTRVVACYNEGDGYAIGSVEGRCAIKYVDDEAQKKSGFSFKCHRQTQPNRAA 260

Query: 236 ----TQLVFPVNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVKLCCNR 291
                 LV+PVN++ FHP      T G DG    W+   R + +  P ++ S+     NR
Sbjct: 261 GSSSQSLVYPVNSIAFHPIYGTFVTAGGDGSFHFWDKNQRHRLKGFPSMQGSIPVCNFNR 320

Query: 292 RALVIA 297
              ++A
Sbjct: 321 NGSILA 326

>Scas_510.5
          Length = 362

 Score =  104 bits (259), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 78/304 (25%), Positives = 133/304 (43%), Gaps = 28/304 (9%)

Query: 16  VELKDVSKDYLSGVCLVDEEGSQLIVSSWDGTASLYDWEKNKRMGR---------LSHEW 66
           + L + ++D +S +    ++     VSSWDG   ++D +     GR         LS  W
Sbjct: 27  IVLNNPAEDSISDIAFSPQQDFIFSVSSWDGKVRIWDVQGGVAQGRSQYEHAGPVLSTRW 86

Query: 67  PLTSVAVCAGTRRAYV---GSAQGEVLELDWESERMVALQGVQCGLGISAMGSYGQFVVV 123
                 V +G     V     A G+  ++      + A++ V CG       S  + +V 
Sbjct: 87  SNDGSKVASGGCDNIVKLFDVASGQSQQIGMHDAPVKAVRFVNCGP------SNTECLVT 140

Query: 124 GSWDGSLAVVDTRRNTVRHIRRLTGKILSLDCGAARVVCMTTD-GVYVFRTSDIDAAPER 182
           GSWD S+   D R+        +  ++ ++D     +V  T +  + +   ++  +  + 
Sbjct: 141 GSWDKSIKYWDMRQPQAISTVIMPDRVYTMDSKQQLLVVGTAERHIAIINLNNPGSIFKT 200

Query: 183 RESGLKYQSRCVRLVPDEEGYVQSSVDGRVAVEYFGDEGRK---FAFRCHRMNLKD---- 235
             S LK+Q+R V    + +GY   S++GR A+ Y  DE +K   F+F+CHR N  +    
Sbjct: 201 TLSPLKWQTRVVSCYNEGDGYAIGSIEGRCAIRYVDDEMQKKSGFSFKCHRQNNPNRTAG 260

Query: 236 --TQLVFPVNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVKLCCNRRA 293
               LV+PVN++ FHP      T G DG    W+   R + +  P +  S+  +  NR  
Sbjct: 261 SQQSLVYPVNSIAFHPIYGTFATAGGDGCFHFWDKNHRHRLKAFPSLRSSIPVVNFNRNG 320

Query: 294 LVIA 297
            V A
Sbjct: 321 SVFA 324

>AGL301C [4011] [Homologous to ScYER107C (GLE2) - SH]
           (137221..138306) [1086 bp, 361 aa]
          Length = 361

 Score =  101 bits (252), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 82/313 (26%), Positives = 136/313 (43%), Gaps = 46/313 (14%)

Query: 16  VELKDVSKDYLSGVCLVDEEGSQLIVSSWDGTASLYDWEKNKRMGR--LSHEWP-LTSVA 72
           + + + + D +S +    ++     V++WD T  ++D +     GR    H+ P LT+  
Sbjct: 26  ITINNPANDSVSDIAFSPQQDFLFSVAAWDNTVRIWDVQNGMTQGRAQYEHQAPVLTTRW 85

Query: 73  VCAGTRRAYVGS---------AQGEVLELDWESERMVALQGVQCGLGISAMGSYGQFVVV 123
              GT+ A  G          A G+  ++      + AL+ VQCG       S  + +V 
Sbjct: 86  SSDGTKVASGGCDNILKLYDVASGQAQQIGSHDSAVRALRFVQCG------PSNQECIVT 139

Query: 124 GSWDGSLAVVDTRRNTVRHIRRLTGKILSLDC-------GAAR---VVCMTTDGVYVFRT 173
           GSWD ++   D R+        +  ++ +LD        G A    VV    +   VFRT
Sbjct: 140 GSWDKTIKYWDMRQPQPISTVAMPERVYALDSKQKLLVVGTAERHIVVIDLNNPAQVFRT 199

Query: 174 SDIDAAPERRESGLKYQSRCVRLVPDEEGYVQSSVDGRVAVEYFGDEGRK---FAFRCHR 230
           S          S LK+Q+R V    +  G+   SV+GR A++Y  ++ ++   F+F+CHR
Sbjct: 200 S---------MSPLKWQTRTVACYIEGNGFAIGSVEGRCAIQYVDEQEQRKNGFSFKCHR 250

Query: 231 MNLKDT------QLVFPVNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSV 284
                +       LV+PVN++ FHP+     T G DG    W+   R + +  P +  S+
Sbjct: 251 QQQPASGRASSESLVYPVNSIVFHPQYGTFATAGGDGSCNFWDKNQRHRLKGFPSMNASI 310

Query: 285 VKLCCNRRALVIA 297
                NR   V A
Sbjct: 311 PVCNFNRNGSVFA 323

>KLLA0E20779g complement(1841092..1842207) similar to sp|P40066
           Saccharomyces cerevisiae YER107c GLE2 required for
           nuclear pore complex structure and function, start by
           similarity
          Length = 371

 Score = 93.6 bits (231), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 72/308 (23%), Positives = 131/308 (42%), Gaps = 32/308 (10%)

Query: 16  VELKDVSKDYLSGVCLVDEEGSQLIVSSWDGTASLYDWEKNKRMGR--LSHEWP-LTSVA 72
           + L + ++D +S +    +      VSSWD    ++D +     GR    H+ P LT+  
Sbjct: 28  IVLNNAAEDSISDIAFSPQSDFMFSVSSWDSKVRIWDVQSGSPQGRAQYDHQAPVLTTRW 87

Query: 73  VCAGTRRAYVGS---------AQGEVLELDWESERMVALQGVQCGLGISAMGSYGQFVVV 123
              GT+ A  G            G+  ++   +  + +L+ V CG       +  + +  
Sbjct: 88  SIDGTKVASGGCDNVLKVFDVTTGQAQQIGQHNSAVQSLRFVSCGP------TNQECIAT 141

Query: 124 GSWDGSLAVVDTRRNTVRHIRRLTGKILSLDCGAA-RVVCMTTDGVYVFRTSDIDAAPER 182
           GSWD ++   D R        ++  ++  +D      VV M    + V   ++     + 
Sbjct: 142 GSWDKTVKYWDLRSPQPIMTLQMPERVYCMDASQKLMVVGMAERHIAVIDLNNPGQIFKT 201

Query: 183 RESGLKYQSRCVRLVPDEEGYVQSSVDGRVAVEYFGDEGRK---FAFRCHRMNLKDTQL- 238
             S LK+Q+R +    +  G+   S++GR AV+Y  ++ ++   F+F+CHR  +++    
Sbjct: 202 SLSPLKWQTRSISCYNEGNGFAIGSIEGRCAVQYIDEQEQRKDGFSFKCHRQQVQNNGAA 261

Query: 239 ---------VFPVNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVKLCC 289
                    V+PVN++ FHP      T G DG    W+   R + +  PK+  S+     
Sbjct: 262 GGRTSTEVQVYPVNSIVFHPIHGTFATAGGDGSFHFWDKNHRHRLKGFPKLNYSIPVCQF 321

Query: 290 NRRALVIA 297
           NR   V A
Sbjct: 322 NRTGSVFA 329

>Sklu_2332.7 YER107C, Contig c2332 14211-15314 reverse complement
          Length = 367

 Score = 93.2 bits (230), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 71/308 (23%), Positives = 132/308 (42%), Gaps = 32/308 (10%)

Query: 16  VELKDVSKDYLSGVCLVDEEGSQLIVSSWDGTASLYDWEKNKRMGR--LSHEWP-LTSVA 72
           + + + ++D +S +    ++     VSSWD    ++D       GR    H+ P LT+  
Sbjct: 28  IVINNPAEDSISDIAFSSQQDFLFSVSSWDNKVRIWDVNGGMAQGRAQYEHQAPVLTTRW 87

Query: 73  VCAGTRRAYVGS---------AQGEVLELDWESERMVALQGVQCGLGISAMGSYGQFVVV 123
              GT+ A  G            G+  ++      +  L+ +QCG       +  + +V 
Sbjct: 88  SNDGTKVASGGCDNVVKLFDVQSGQAQQVGAHDSAIRHLRFIQCGP------TNTECLVT 141

Query: 124 GSWDGSLAVVDTRRNTVRHIRRLTGKILSLDCGAARVVCMTTD-GVYVFRTSDIDAAPER 182
           GSWD ++   D R+        +  ++ ++D     +V  T +  + +   ++     + 
Sbjct: 142 GSWDKTIKYWDMRQPQPVSTLMMPDRVYAMDSKQKLLVVATAERHIAIIDLNNPATIFKT 201

Query: 183 RESGLKYQSRCVRLVPDEEGYVQSSVDGRVAVEYFGDEGRK---FAFRCHRMNLKDT--- 236
             S LK+Q+R V    +  GY   S++GR A++Y  ++ ++   F+F+CHR   + T   
Sbjct: 202 ATSPLKWQTRSVSCYIEGNGYAIGSIEGRCAIQYVDEQEQRKSGFSFKCHRQQQQSTGTA 261

Query: 237 -------QLVFPVNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVKLCC 289
                    V+PVN++ FHP      T G DG    W+   R + +  P ++ S+     
Sbjct: 262 GGRSNTESHVYPVNSIVFHPVYGTFATAGGDGSFHFWDKNQRHRLKGFPSMKASIPVCNF 321

Query: 290 NRRALVIA 297
           NR   V A
Sbjct: 322 NRNGSVFA 329

>Kwal_27.10785
          Length = 367

 Score = 92.4 bits (228), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 70/308 (22%), Positives = 132/308 (42%), Gaps = 32/308 (10%)

Query: 16  VELKDVSKDYLSGVCLVDEEGSQLIVSSWDGTASLYDWEKNKRMGR--LSHEWPLTSVAV 73
           + + + ++D +S +    ++     VSSWD    ++D    +   R    H+ P+ +   
Sbjct: 28  IVINNPAEDSISDIAFSPQQDFLFSVSSWDKKVRVWDVNGGQAQCRAEYQHQAPVLATRW 87

Query: 74  CAGTRRAYVGSAQGEVLELDWESER----------MVALQGVQCGLGISAMGSYGQFVVV 123
                +   G     V+  D  S +          + +L+ VQCG       S  + +V 
Sbjct: 88  STDGTKIASGGCDNAVMVFDVSSGQSQQVGAHDAAVKSLRFVQCGP------SNTECLVT 141

Query: 124 GSWDGSLAVVDTRRNTVRHIRRLTGKILSLDCGAARVVCMTTD-GVYVFRTSDIDAAPER 182
           GSWD ++   D R+        +  ++ ++D     +V  T +  + V   ++  A  + 
Sbjct: 142 GSWDKTIKYWDLRQPQPVSTLAMPERVYTMDSKQKLLVVGTAERHIVVIDLNNPAAIFKT 201

Query: 183 RESGLKYQSRCVRLVPDEEGYVQSSVDGRVAVEYFGDEGRK---FAFRCHRMNLKDT--- 236
             S LK+Q+R V    +  GY   S++GR A++Y  D+ ++   F+F+CHR+  + T   
Sbjct: 202 TTSPLKWQTRSVSCYIEGNGYAVGSIEGRCAIQYVDDQEQRKSGFSFKCHRVQQQSTGAA 261

Query: 237 -------QLVFPVNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVKLCC 289
                    V+PVN++ FHP      T G DG    W+   R + +  P ++ ++     
Sbjct: 262 GGRSSTESQVYPVNSIVFHPIYGTFATAGGDGSFHFWDKNLRHRLKGFPSLKATIPVCNF 321

Query: 290 NRRALVIA 297
           NR   + A
Sbjct: 322 NRNGSIFA 329

>Kwal_26.7736
          Length = 507

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 54/124 (43%), Gaps = 6/124 (4%)

Query: 16  VELKDVSKDYLSGVCLVDEEGSQLIVSSWDGTASLYDWEKNKRMGRLSHEWPLTSVAVCA 75
           VEL   S DY+  VC+V +    ++  S+DG   L+D   N+R   L+   P+  V   +
Sbjct: 162 VELTGAS-DYVRSVCMVPQAPHLVVTGSYDGQVRLFDTRTNERATTLAQGMPVEDVIAVS 220

Query: 76  GTRRAYVGSAQGEVLELDWES---ERMVALQGVQC--GLGISAMGSYGQFVVVGSWDGSL 130
            T+    G  + +V +L  +    ER    + V C   + +         +V  S DG +
Sbjct: 221 ATQLVSCGGPKFKVWDLTAQRPLLERANFAKTVTCLNHVDLVEDSPMSSTLVASSLDGHV 280

Query: 131 AVVD 134
            + D
Sbjct: 281 KIFD 284

>Scas_706.24
          Length = 460

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 64/136 (47%), Gaps = 12/136 (8%)

Query: 81  YVGSAQGEV--LELDWESERM---VALQGVQCGLGISAMGSYGQFVVVGSWDGSLAVVDT 135
           ++G   G++  LE+  ++  M   + +Q  +  + +  M   G+FV+ GS DGS A+ DT
Sbjct: 219 FIGFRSGKLALLEVSDDTGEMTFKLIVQAHRSAISVIKMDPVGRFVITGSTDGSCALWDT 278

Query: 136 RRNTVRH-IRRLTGKILSLDC---GAARVVCMTTDGVYVFRTSDIDAAPERRESGLKYQS 191
              T    I  + G ++S+D    G    VC T D V  +  +  D    + E+  K+ S
Sbjct: 279 STLTCSLIIDDMEGAVISMDVDHLGKILAVCSTDDLVRFYNIN--DGTLWKTENMQKFNS 336

Query: 192 R-CVRLVPDEEGYVQS 206
              VR  P +  ++ S
Sbjct: 337 ELVVRFYPRKSWFILS 352

>KLLA0F13772g 1276532..1278094 highly similar to sp|Q04305
           Saccharomyces cerevisiae YMR093w singleton, start by
           similarity
          Length = 520

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 50/125 (40%), Gaps = 9/125 (7%)

Query: 22  SKDYLSGVCLVDEEGSQLIVSSWDGTASLYDW--EKNKRMGRLSHEWPLTSVAVCAGTRR 79
           + DY+  VC V      +   S+DG   LYD   + +K    L H  P+  +   + T+ 
Sbjct: 167 ASDYVRSVCFVPNAPHMVATGSYDGVVRLYDIRTKSDKPQTTLDHGLPVEDITAISPTQL 226

Query: 80  AYVGSAQGEVLELDWES---ERMVALQGVQCGLGISAMG---SYGQFVVVGSWDGSLAVV 133
           A  G    +V +L  +    ER    + V C L  + MG        +V  S DG + + 
Sbjct: 227 ASCGGNGFKVWDLTSDRALCERQNFAKTVTC-LNYTNMGEESPMSSVLVASSLDGHVKIF 285

Query: 134 DTRRN 138
               N
Sbjct: 286 SPLEN 290

>AGR242C [4553] [Homologous to ScYIR012W (SQT1) - SH]
           (1203152..1204411) [1260 bp, 419 aa]
          Length = 419

 Score = 35.8 bits (81), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 44/107 (41%), Gaps = 15/107 (14%)

Query: 186 GLKYQSRCVRLVPDEEGYVQSSVDGRVAVEYFGDEGRKFAFRCHRMNL---------KDT 236
           G  ++   V   P EE   QS V+  +  E  G EG  +      +++         K T
Sbjct: 3   GDGFEHEEVGQTPQEEFIEQSEVEQEIDAE--GAEGADYGDDTIEIDMSNNSVTYFDKHT 60

Query: 237 QLVFPVNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDS 283
             VF V A   HPK  L+ +GG D +   W  T R+   E   VE S
Sbjct: 61  DSVFTVAA---HPKLPLVVSGGGDNKAHLWT-THREPPREAGSVEHS 103

>YMR116C (ASC1) [4073] chr13
           complement(499455..499877,500151..500687) Ribosomal
           protein of the 40S ribosomal subunit that influences
           translational efficiency and cell size, contains two WD
           (WD-40) repeats [960 bp, 319 aa]
          Length = 319

 Score = 34.7 bits (78), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 48/108 (44%), Gaps = 8/108 (7%)

Query: 194 VRLVPDEEGYVQSSVDGRVAVEYFGDEGRKFAFRCHRMNLKDTQLVFP--VNALCFHPKT 251
           VR+VP+E+     + D  V +   G++    A+  ++  ++   +     +N L   P  
Sbjct: 154 VRVVPNEK-----ADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDG 208

Query: 252 ALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVKLCCNRRALVIAAS 299
            L+ + G DG +  WNL  +K    L   +D V  L  +     +AA+
Sbjct: 209 TLIASAGKDGEIMLWNLAAKKAMYTL-SAQDEVFSLAFSPNRYWLAAA 255

>Kwal_56.24526
          Length = 1210

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 1/62 (1%)

Query: 241 PVNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVKLCCNRR-ALVIAAS 299
           PV  + FHP   L  + G D  +  W+L T+K    L    D V  +  +R    +I+AS
Sbjct: 55  PVRGIDFHPTQPLFVSAGDDYTIKVWSLDTKKCLFTLNGHLDYVRTVFFHRELPWIISAS 114

Query: 300 DD 301
           DD
Sbjct: 115 DD 116

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 25/59 (42%), Gaps = 9/59 (15%)

Query: 217 FGDEGRKFAFRCHRMNLKDTQLVFPVNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAE 275
           FGD   KF    H            VN   FHP   L+ +GG D +V  W +++ K  E
Sbjct: 196 FGDCVVKFILEGHSRG---------VNWASFHPTLPLIVSGGDDRQVKLWRMSSTKAWE 245

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/61 (24%), Positives = 28/61 (45%)

Query: 242 VNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVKLCCNRRALVIAASDD 301
           V+++ FHP   L+ + G D  V  W+L  R   ++  +  D    +  +    +  A+ D
Sbjct: 256 VDSVIFHPHQNLIISVGEDKTVRVWDLDKRTPVKQFKRENDRFWLVRAHPNINLFGAAHD 315

Query: 302 S 302
           S
Sbjct: 316 S 316

>CAGL0J01265g complement(118375..119928) highly similar to sp|Q04305
           Saccharomyces cerevisiae YMR093w, start by similarity
          Length = 517

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 70/179 (39%), Gaps = 19/179 (10%)

Query: 24  DYLSGVCLVDEEGSQLIVSSWDGTASLYDWEK-NKRMGRLSHEWPLTSVAVCAGTRRAYV 82
           DY+  +C V      ++  S+DG   LYD    +K    L H+ P+ +V   + T+    
Sbjct: 169 DYVRTLCFVPAAPHLVVTGSYDGALRLYDTRAGSKPQHTLVHDQPVENVVAISPTQLVSC 228

Query: 83  GSAQGEVLELDWES---ERMVALQGVQC----GLGISAMGSYGQFVVVGSWDGSLAVVDT 135
           G    +V +L       ER    + V C     L   +  +    ++  S DG + V D 
Sbjct: 229 GGPNFKVWDLTSNKKIFERANFNKTVTCLDYVNLPSDSGLASNSALLASSLDGHVKVFDP 288

Query: 136 RRN-TVRHIRRLTGKILSLDC------GAARVVCMTTDGVYVFRTSDIDAAPERRESGL 187
             N  V+   + +  +LS         G+  +V   T G+   RT       E+R S L
Sbjct: 289 LDNFQVKFGWKFSSAVLSCAVSPSDAQGSRHLVAGLTSGLLAIRTKK----KEKRNSHL 343

>CAGL0I03718g complement(317565..321170) highly similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 Coatomer alpha
           subunit, start by similarity
          Length = 1201

 Score = 34.3 bits (77), Expect = 0.16,   Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 38/93 (40%), Gaps = 16/93 (17%)

Query: 185 SGL--KYQSRCVRLVPDEEGYVQSSVDGRVAVEYFGDEGRKFAFRCHRMNLKDTQLVFPV 242
           SGL  K+ +  V    D     Q+ +DG      FGD   KF    H            V
Sbjct: 167 SGLRKKHSAPGVTSYEDSLASQQNLLDGA-----FGDCKVKFILEGHTRG---------V 212

Query: 243 NALCFHPKTALLYTGGSDGRVFAWNLTTRKKAE 275
           N   FHP   L+ TGG D +V  W +++ K  E
Sbjct: 213 NWASFHPTLPLIVTGGDDRQVKLWRMSSNKAWE 245

 Score = 32.3 bits (72), Expect = 0.53,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 29/62 (46%), Gaps = 1/62 (1%)

Query: 241 PVNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVKLCCNRR-ALVIAAS 299
           PV A+ FHP   +  + G D  +  W+L T +    L    D V  +  +     VI+AS
Sbjct: 55  PVRAVDFHPTQPIFVSAGDDASIKVWSLETNRCLYTLTGHLDYVRTVFFHSELPWVISAS 114

Query: 300 DD 301
           DD
Sbjct: 115 DD 116

>Scas_592.4*
          Length = 318

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 1/58 (1%)

Query: 242 VNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVKLCCNRRALVIAAS 299
           VNA+   P   L+ + G DG +  WNL   KKA      +D V  L  +     +AA+
Sbjct: 198 VNAVTASPDGTLIASAGKDGEIMLWNL-AEKKAMYTLSAQDEVFSLAFSPNRYWLAAA 254

>YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer
           (COPI) complex alpha chain (alpha-COP) of secretory
           pathway vesicles required for retrograde Golgi to
           endoplasmic reticulum transport, member of WD (WD-40)
           repeat family [3606 bp, 1201 aa]
          Length = 1201

 Score = 33.9 bits (76), Expect = 0.22,   Method: Composition-based stats.
 Identities = 21/62 (33%), Positives = 29/62 (46%), Gaps = 1/62 (1%)

Query: 241 PVNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVKLCCNRR-ALVIAAS 299
           PV  L FHP   +  + G D  +  W+L T K    L    D V  +  +R    +I+AS
Sbjct: 55  PVRGLDFHPTQPIFVSAGDDYTIKVWSLDTNKCLYTLTGHLDYVRTVFFHRELPWIISAS 114

Query: 300 DD 301
           DD
Sbjct: 115 DD 116

 Score = 29.3 bits (64), Expect = 5.1,   Method: Composition-based stats.
 Identities = 14/61 (22%), Positives = 28/61 (45%)

Query: 242 VNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVKLCCNRRALVIAASDD 301
           V+++ FHP   L+ + G D  +  W+L  R   ++  +  D    +  +    +  A+ D
Sbjct: 256 VDSVIFHPHQNLIISVGEDKTLRVWDLDKRTPVKQFKRENDRFWLIAAHPHINLFGAAHD 315

Query: 302 S 302
           S
Sbjct: 316 S 316

>KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces
           cerevisiae YLR129w DIP2 DOM34P-interacting protein,
           start by similarity
          Length = 936

 Score = 33.5 bits (75), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%)

Query: 242 VNALCFHPKTALLYTGGSDGRVFAWNLTTR 271
           V A+CFH +T LL  G  DG +  W+L ++
Sbjct: 76  VTAMCFHKETELLCVGYEDGVIKVWDLLSK 105

 Score = 28.9 bits (63), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 25/121 (20%), Positives = 53/121 (43%), Gaps = 9/121 (7%)

Query: 99  MVALQGVQCGLGISAMGSYGQFVVVGSWDGSLAVVDT-----RRNTVRHIRRLTGKILSL 153
           ++   G + G+ +  + S G  +V GS D  L + D            H   +TG  + +
Sbjct: 108 LMQFNGHKSGVTVLRLDSEGTRLVSGSKDSDLIIWDLVGEVGLMKLRSHKDAITG--IWI 165

Query: 154 DCGAARVVCMTTDGVYVFRTSDIDAAPERRESGLKYQSRCVRLVPDEEGYVQSSVDGRVA 213
           D     ++ +  DG+   +  D+ A  +  E+ + +  +C  +  DEE  + +S+D +  
Sbjct: 166 DHNMDWLISVAKDGL--IKVWDLKAGGQCVETHMAHTGQCWSMAIDEEVIITTSMDSQAK 223

Query: 214 V 214
           +
Sbjct: 224 I 224

>Kwal_55.22076
          Length = 1286

 Score = 33.5 bits (75), Expect = 0.28,   Method: Composition-based stats.
 Identities = 13/31 (41%), Positives = 17/31 (54%)

Query: 241 PVNALCFHPKTALLYTGGSDGRVFAWNLTTR 271
           P   LC+HP    + TGG DG+   WN  +R
Sbjct: 319 PGLCLCWHPTADYIMTGGRDGKCCLWNTGSR 349

>Scas_512.3
          Length = 534

 Score = 32.7 bits (73), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 3/44 (6%)

Query: 241 PVNALCFHPKTA---LLYTGGSDGRVFAWNLTTRKKAEELPKVE 281
           PV +LCF P +     L T G D ++ +WNL   K   ++  ++
Sbjct: 15  PVYSLCFQPNSPNKKKLLTAGGDNKIRSWNLNLVKDTNKIDTID 58

>Scas_624.11
          Length = 1205

 Score = 32.7 bits (73), Expect = 0.40,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 1/62 (1%)

Query: 241 PVNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVKLCCNRR-ALVIAAS 299
           PV ++ FHP   +  +GG D  +  W+L T K    L    D +  +  ++    +I+AS
Sbjct: 55  PVRSVDFHPTQPIFVSGGDDYTIKVWSLETNKCLYTLNGHLDYIRTVFFHKELPWIISAS 114

Query: 300 DD 301
           DD
Sbjct: 115 DD 116

>CAGL0K10626g complement(1031704..1033794) highly similar to
           sp|P23337 Saccharomyces cerevisiae YFR015c GSY1, start
           by similarity
          Length = 696

 Score = 32.3 bits (72), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%)

Query: 83  GSAQGEVLELDWESERMVA--LQGVQCGLGISAMGSYGQFVVVGSW--DGSLAVVDTRRN 138
           G+ QGEV ELDWE   + +  LQ VQ  L    M   G + V   W  +G+  V+    +
Sbjct: 52  GTYQGEVEELDWEDPSIFSEELQPVQQAL--KYMREKGVYFVYARWLIEGAPRVILFDLD 109

Query: 139 TVRH 142
           +VR+
Sbjct: 110 SVRY 113

>CAGL0L02761g complement(320826..322085) similar to sp|P18851
           Saccharomyces cerevisiae YOR212w STE4, hypothetical
           start
          Length = 419

 Score = 32.3 bits (72), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 52/118 (44%), Gaps = 8/118 (6%)

Query: 25  YLSGVCLVDEEGSQLIVSSWDGTASLYDWEKNKRMGRLSHEWP---LTSVAVCAGTRRAY 81
           Y+SGV  V E  S+++ SS D T +L+D  K KR+   S         S+ V   ++   
Sbjct: 176 YISGVEFVSE--SRVVTSSGDMTCALWDIPKAKRVREYSDHLGDVLAISIPVTNLSKNNM 233

Query: 82  VGSAQGEVLELDWESERMVALQGVQCGLGISAMGSY---GQFVVVGSWDGSLAVVDTR 136
             S   +     W+     A+Q    G   S    +   G  V VG+ DG++++ D R
Sbjct: 234 FASCGSDGYTFIWDVRSPSAVQQFSIGSCDSNCLKFFPDGNSVAVGNDDGTISLFDLR 291

>Scas_721.32
          Length = 822

 Score = 32.0 bits (71), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 71/190 (37%), Gaps = 27/190 (14%)

Query: 119 QFVVVGSWDGSLAVVDTRR----NTVRHIRRLTGKILSLDCGAARVVCMTTDGVYVFRTS 174
           QF  +G +  + +   T R    + +  +R   G +  +DC     V    +G YVF  S
Sbjct: 598 QFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDC-----VSFHPNGCYVFTGS 652

Query: 175 --------DIDAAPE-RRESGLKYQSRCVRLVPDEEGYVQSSVDGRVAVEYFGDEGRKFA 225
                   DI      R   G      C  + PD       S DG + +   G   R   
Sbjct: 653 SDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWLATGSEDGIINLWDIGTAKRLKV 712

Query: 226 FRCHRMNLKDTQLVFPVNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVV 285
            R H  N         +++L +  +  +L +GG+D  V  W+L  +  AE  P+ E+  V
Sbjct: 713 MRGHGKNA--------IHSLSYCKEGNVLVSGGADHSVRVWDL-KKSTAEPGPEPEEQFV 763

Query: 286 KLCCNRRALV 295
               N  A +
Sbjct: 764 GYIGNLTASI 773

>KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces
           cerevisiae YKL021c MAK11 involved in cell growth and
           replication of M1 dsRNA virus singleton, start by
           similarity
          Length = 390

 Score = 31.6 bits (70), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 36/89 (40%), Gaps = 19/89 (21%)

Query: 223 KFAFRCHRMNLKDTQLVFPVNALCFHPKTA-LLYTGGSDGRVFAWNLTTRKKAEELPKVE 281
           +F+   H   +KD Q         +H K    L T GSDGR+  W++ TR          
Sbjct: 270 EFSLLGHSNRVKDFQF--------YHNKFGHYLVTIGSDGRIVVWDMKTR---------- 311

Query: 282 DSVVKLCCNRRALVIAASDDSFKTSAVVE 310
           D V    C  R   +A  D+S +    V+
Sbjct: 312 DQVAVYDCGERLNCVAVCDESIEKYDTVK 340

>ADR312W [2053] [Homologous to ScYOL060C (AMI3) - SH]
           complement(1253624..1255606) [1983 bp, 660 aa]
          Length = 660

 Score = 32.0 bits (71), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 36/83 (43%), Gaps = 4/83 (4%)

Query: 67  PLTSVAVCAGTRRAYVGSAQGEVLELDWESERMVALQGVQCGLGISAMGSYGQFVVVGSW 126
           P  + A+    RRA V S +G+       S  +V L G+  GL +  MG    ++ V S 
Sbjct: 22  PTLAAALPVAGRRAEVPSGEGQFWTFMAVSAVLVLLGGMFRGLPLGLMGQDKMYLKVTST 81

Query: 127 DGSLAVVDTRRNTVRHIRRLTGK 149
            GS A     R   R + RL G 
Sbjct: 82  SGSRA----ERQHARKVLRLIGH 100

>Sklu_2371.4 YDR030C, Contig c2371 8070-9506 reverse complement
          Length = 478

 Score = 31.6 bits (70), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 44/107 (41%), Gaps = 3/107 (2%)

Query: 63  SHEWPLTSVA-VCAGTRRAYVGSAQGEVLELDWESERMVALQGVQCGLGISAMGSYGQFV 121
           SH + +TS+          + GS+  EV    W++     +Q  Q G  ++ + + G  V
Sbjct: 200 SHSFAITSIKWYSHDNGMFFTGSSDREVKI--WDTNEFEVVQNFQLGYRVNQLDTKGDLV 257

Query: 122 VVGSWDGSLAVVDTRRNTVRHIRRLTGKILSLDCGAARVVCMTTDGV 168
           +V S D    V+D +  +      +  K +      A+   M TD V
Sbjct: 258 IVASEDTYPRVIDLKSMSSVISLGVKNKKMKFGINTAKFAPMGTDLV 304

>ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH]
           (843171..846785) [3615 bp, 1204 aa]
          Length = 1204

 Score = 32.0 bits (71), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 29/62 (46%), Gaps = 1/62 (1%)

Query: 241 PVNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVKLCCNRR-ALVIAAS 299
           PV  + FHP   L  + G D  +  W+L+T K    L    D V  +  +     +I+AS
Sbjct: 55  PVRGVDFHPTQPLFVSAGDDYSIKVWSLSTHKCLFTLNGHLDYVRTVFFHTELPWIISAS 114

Query: 300 DD 301
           DD
Sbjct: 115 DD 116

 Score = 31.6 bits (70), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 14/61 (22%), Positives = 29/61 (47%)

Query: 242 VNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVKLCCNRRALVIAASDD 301
           V+++ FHP   L+ + G D  +  W+L  R   ++  + +D    +  +    +  A+ D
Sbjct: 256 VDSVIFHPFQNLIISVGEDSTIRVWDLDKRTPVKQFKREQDRFWSIRAHPNVNLFGAAHD 315

Query: 302 S 302
           S
Sbjct: 316 S 316

>CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces
           cerevisiae YOR269w PAC1, hypothetical start
          Length = 467

 Score = 31.6 bits (70), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 18/28 (64%)

Query: 241 PVNALCFHPKTALLYTGGSDGRVFAWNL 268
           PV A+  HP  A++Y G   GR+ A+++
Sbjct: 125 PVTAIKLHPSLAIVYVGTDTGRLIAYDI 152

>Scas_721.115*
          Length = 318

 Score = 31.6 bits (70), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 1/58 (1%)

Query: 242 VNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVKLCCNRRALVIAAS 299
           VN +   P   L+ + G DG +  WNL   KKA      +D V  L  +     +AA+
Sbjct: 198 VNTVTASPDGTLIASAGKDGEIMLWNL-AEKKAMYTLSAQDEVFALAFSPNRYWLAAA 254

>CAGL0E02805g complement(265137..267659) similar to sp|P32479
           Saccharomyces cerevisiae YBL008w HIR1 histone
           transcription regulator, start by similarity
          Length = 840

 Score = 31.6 bits (70), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 37/86 (43%), Gaps = 16/86 (18%)

Query: 193 CVRLVPDEEGYVQSSVDGRVAVEY----------FGDEGRKFAFRCH-RMNLKDTQLVFP 241
           CV+  PD   Y+ S  D R+ + +          FG EG K  +    R+   D      
Sbjct: 79  CVKFSPDG-NYLASGSDDRILLIWAMDEENHGGSFGSEGEKEHWTVRKRLVAHDND---- 133

Query: 242 VNALCFHPKTALLYTGGSDGRVFAWN 267
           +  +C+ P +++L T G D  V  WN
Sbjct: 134 IQDICWAPDSSILVTVGLDRSVIVWN 159

>YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription
           inhibitor, required for periodic repression of 3 of the
           4 histone gene loci and for autogenous repression of
           HTA1-HTB1 locus by H2A and H2B, member of WD (WD-40)
           repeat family [2523 bp, 840 aa]
          Length = 840

 Score = 31.6 bits (70), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 50/106 (47%), Gaps = 18/106 (16%)

Query: 193 CVRLVPDEEGYVQSSVDGRVAVEYFGDEGR--KFAF-----RCH-----RMNLKDTQLVF 240
           CV+  PD + Y+ S  D R+ + +  DE +  + AF     R H     R+   D     
Sbjct: 84  CVKFSPDGK-YLASGSDDRILLIWALDEEQSSQPAFGSEHEREHWTVRKRLVAHDND--- 139

Query: 241 PVNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVK 286
            +  +C+ P +++L T G D  V  WN +T +K +    V  S+VK
Sbjct: 140 -IQDICWAPDSSILVTVGLDRSVIVWNGSTFEKLKRF-DVHQSLVK 183

>AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH]
           complement(257969..259858) [1890 bp, 629 aa]
          Length = 629

 Score = 31.6 bits (70), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 18/31 (58%)

Query: 242 VNALCFHPKTALLYTGGSDGRVFAWNLTTRK 272
           + ++CF P    L TG  D  +  W+LTT+K
Sbjct: 355 IRSVCFSPDGKYLATGAEDKLIRIWDLTTKK 385

>AAL094W [93] [Homologous to ScYOR249C (APC5) - SH]
           complement(175140..177140) [2001 bp, 666 aa]
          Length = 666

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%)

Query: 256 TGGSDGRVFAWNLTTRKKAEELPKVEDSVVKLCCN 290
           TG  +  V+ W LTTR++ E+L  +E + +  C N
Sbjct: 213 TGEEEHHVYPWILTTRERYEQLVNMELTKLNSCTN 247

>Sklu_1731.4 YJL069C, Contig c1731 3709-5439 reverse complement
          Length = 576

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 17/32 (53%), Gaps = 4/32 (12%)

Query: 233 LKDTQLVFP----VNALCFHPKTALLYTGGSD 260
           LKD  +  P    V +L FHP   LL TGG D
Sbjct: 229 LKDANVTHPSRSAVQSLSFHPSKPLLLTGGYD 260

>Kwal_0.49
          Length = 584

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 17/32 (53%), Gaps = 4/32 (12%)

Query: 233 LKDTQLVFP----VNALCFHPKTALLYTGGSD 260
           LKD   V P    + +L FHP   LL TGG D
Sbjct: 237 LKDANAVHPSRAAIQSLAFHPLKPLLLTGGYD 268

>YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa
           subunit of elongator and elongating RNA polymerase II
           holoenzyme, has WD (WD-40) repeats [2367 bp, 788 aa]
          Length = 788

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 37/81 (45%), Gaps = 8/81 (9%)

Query: 186 GLKYQSRCVRLVPDEEGYVQSSVDGRVAVEYFGDEGRKFAFRCHRMNLKDTQLVFPVNAL 245
           G + +  CVR VPD +  V +S D  V +  F D       +C +     ++ +  ++AL
Sbjct: 57  GHEAEVTCVRFVPDSDFMVSASEDHHVKIWKFTDYSH---LQCIQTIQHYSKTIVALSAL 113

Query: 246 CFHPKTALLYTGGSDGRVFAW 266
                 +L+  G +DG +  W
Sbjct: 114 -----PSLISVGCADGTISIW 129

>AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH]
           (1146710..1147672) [963 bp, 320 aa]
          Length = 320

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 54/139 (38%), Gaps = 20/139 (14%)

Query: 181 ERRESGLKYQSRCVRLVPDEEGYVQSSVDGRVAVEYFGDEGRKFAFRCHRMNLKDTQLVF 240
           +R   GL   + C R+ PD   YV  +    + V   GD G      C R     T+   
Sbjct: 10  QRSPGGL---TTCARVSPDGR-YVAVADRTAICVYSVGDGG------CARYETTHTE--- 56

Query: 241 PVNALCFHPKTALLYTGGSDGRV----FAWNLTTRKKAEELPKVEDSVVKLCCNRRALVI 296
           P+N +C+ P +A + +G  D  V      +    + +    P +    V   C    L  
Sbjct: 57  PINDICWSPDSACVASGSEDFTVEITHLEYGRLHKLRGHSAPVLS---VVFNCKGNLLCT 113

Query: 297 AASDDSFKTSAVVEDIALQ 315
           A+ D+S K   V+    L+
Sbjct: 114 ASVDESIKQWDVLSGTLLK 132

>Kwal_26.8628
          Length = 422

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 29/66 (43%), Gaps = 7/66 (10%)

Query: 242 VNALCFHPKTA-----LLYTGGSDGRVFAWNLTTRKKAEELPKVED--SVVKLCCNRRAL 294
           V AL   P  A     +  +GGSDG V+ W+   R  A+     E   S +K   N  A+
Sbjct: 219 VLALALPPPHAQTSSPIFASGGSDGYVYIWDTRARAAAQSFFVSESDISTLKFFNNGYAI 278

Query: 295 VIAASD 300
           V  A D
Sbjct: 279 VTGADD 284

>CAGL0M09845g 975007..977817 highly similar to sp|Q06078
           Saccharomyces cerevisiae YLR409c, start by similarity
          Length = 936

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 35/64 (54%), Gaps = 2/64 (3%)

Query: 8   NVASAMAYVELKDVSKDYLSGVCLVDEEGSQLIVSSWDGTASLYDWEKNKRMGRLSHEWP 67
           N+ S M   + + + K  ++GV  VD    +++    DG    YD+ ++K +G+L  + P
Sbjct: 486 NMQSGMLRKKYR-LHKRAVTGVA-VDGMNRKMVSCGLDGIIGFYDFNESKYLGKLQMDAP 543

Query: 68  LTSV 71
           +TS+
Sbjct: 544 ITSM 547

>CAGL0M02277g complement(271836..273119) highly similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46 Pre-mRNA splicing
           factor PRP46, hypothetical start
          Length = 427

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 23/48 (47%)

Query: 242 VNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVKLCC 289
           V+ +  HP   ++ T G D  V  W++ TR     LP  +  + K+ C
Sbjct: 203 VHTVDIHPTVDVVVTAGRDSVVKVWDIRTRLPVMTLPGHKGPITKVRC 250

>Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement
          Length = 263

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/62 (24%), Positives = 25/62 (40%)

Query: 242 VNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVKLCCNRRALVIAASDD 301
           +  L F P    L +G  D  +  W+L       +L   +DS+  + C     +I+ S D
Sbjct: 120 ITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLISTSKD 179

Query: 302 SF 303
             
Sbjct: 180 GL 181

>KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces
           cerevisiae YBR198c TAF90 TFIID and SAGA subunit, start
           by similarity
          Length = 826

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 47/217 (21%), Positives = 77/217 (35%), Gaps = 29/217 (13%)

Query: 64  HEWPLTSVAVCAGTRRAYVGSAQGEVLELDWESER---MVALQGVQCGLGISAMGSYGQF 120
           H  P+ SVA     R  Y+ SA  +     W  +    +V  +G    +        G +
Sbjct: 552 HSGPVYSVAFSPDNR--YLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHY 609

Query: 121 VVVGSWDGSLAVVDTRRNTVRHIRRLTGKILSLDCGAARVVCMTTDGVYVF--------R 172
            +  S D +  +     + +  +R  +G +  +DC          +G YVF        R
Sbjct: 610 FITASHDQTARLWSC--DHIYPLRIFSGHLNDVDCS-----TFHPNGCYVFTGSSDKTCR 662

Query: 173 TSDIDAAPE-RRESGLKYQSRCVRLVPDEEGYVQSSVDGRVAVEYFGDEGRKFAFRCHRM 231
             DI      R   G       + + PD       S DG + V   G   R    + H  
Sbjct: 663 MWDIQTGDSVRLFLGHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGTGKRIKQMKGHGK 722

Query: 232 NLKDTQLVFPVNALCFHPKTALLYTGGSDGRVFAWNL 268
           N        P+ ++ F+ +   L TGG+D  V  W++
Sbjct: 723 N--------PIYSITFNKEGNCLVTGGADQSVRVWDI 751

 Score = 29.6 bits (65), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 32/67 (47%), Gaps = 3/67 (4%)

Query: 241 PVNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELP-KVEDSVVKLCCNRRA--LVIA 297
           PV AL   P    L TG  DG +  W++ T K+ +++    ++ +  +  N+    LV  
Sbjct: 681 PVTALEVSPDGRWLTTGSEDGTIIVWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTG 740

Query: 298 ASDDSFK 304
            +D S +
Sbjct: 741 GADQSVR 747

>Scas_630.6
          Length = 621

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 16/31 (51%)

Query: 242 VNALCFHPKTALLYTGGSDGRVFAWNLTTRK 272
           + ++CF P    L TG  D  +  WN+  RK
Sbjct: 344 IRSICFSPDGEFLATGAEDKLIRIWNIKERK 374

>AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH]
           complement(1061522..1063999) [2478 bp, 825 aa]
          Length = 825

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 40/87 (45%), Gaps = 13/87 (14%)

Query: 200 EEGYVQSSVDGRVAVEYFGDEGRKFAFRCHRMNLKDTQLVFPVNALCFHPKTALLYTGGS 259
           EEG VQ   D    +E++    R  A   H  +++D         +C+ P +++L T G 
Sbjct: 107 EEGAVQPLFDMENDLEHWNVRRRLVA---HDNDIQD---------ICWAPDSSILVTVGL 154

Query: 260 DGRVFAWNLTTRKKAEELPKVEDSVVK 286
           D  +  WN +T +K +    V  S VK
Sbjct: 155 DRSIIVWNGSTFEKIKRF-DVHQSHVK 180

>Kwal_23.4118
          Length = 939

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 21  VSKDYLSGVCLVDEEGSQLIVSSWDGTASLYDWEKNKRMGRLSHEWPLTSV 71
           + K  +SG+  VD    +++    DG    YD+ K+  +G+L  + P+TS+
Sbjct: 501 LHKKAVSGIA-VDGMNRKMVSCGLDGIVGFYDFSKSSYLGKLQLDAPVTSM 550

>CAGL0H08932g join(871668..871685,872089..874779) highly similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
          Length = 902

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 36/90 (40%), Gaps = 11/90 (12%)

Query: 183 RESGLKYQSRCVRLVPDEEGYVQSSVDGRVAVEYFGDEGRKFAFRCHRMNLKDTQLVFPV 242
           +E G+ Y       +PD+   + SS D  V +  +  +        H  N         V
Sbjct: 183 QEKGVNYVDYYP--LPDKPYMITSSDDTTVKIFDYQTKSCVATLEGHMSN---------V 231

Query: 243 NALCFHPKTALLYTGGSDGRVFAWNLTTRK 272
           +   FHP   ++ +G  DG V  WN +T K
Sbjct: 232 SFAVFHPTLPIIISGSEDGTVKLWNSSTYK 261

>ACR194C [1241] [Homologous to ScYDL156W - SH] (690186..691727)
           [1542 bp, 513 aa]
          Length = 513

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 34/81 (41%), Gaps = 10/81 (12%)

Query: 242 VNALCFHP--KTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSV-----VKLCCNRRAL 294
           V ALCFHP  +  L+  G + G V  WN+       E P   DSV      KL     + 
Sbjct: 188 VTALCFHPSQEKKLIVGGDTAGTVGLWNVADENPDPEHP---DSVPDITRFKLFSRNVSK 244

Query: 295 VIAASDDSFKTSAVVEDIALQ 315
           +     DS K  A   D AL+
Sbjct: 245 IEVFPTDSSKILAASYDGALR 265

>KLLA0F04884g complement(478044..481682) similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 coatomer complex
           alpha chain of secretory pathway vesicles, start by
           similarity
          Length = 1212

 Score = 30.4 bits (67), Expect = 2.7,   Method: Composition-based stats.
 Identities = 12/41 (29%), Positives = 22/41 (53%)

Query: 242 VNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKVED 282
           V+++ FHP+  L+ + G D  V  W+L  R   ++  +  D
Sbjct: 256 VDSVIFHPQQNLIISVGEDKTVRVWDLDKRTPIKQFKREND 296

>AFL022W [3171] [Homologous to ScYBR234C (ARC40) - SH]
           complement(397359..398474) [1116 bp, 371 aa]
          Length = 371

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 7/75 (9%)

Query: 193 CVRLVPDEEGYVQSSVDGRVAVEYFGDEGRKFAFRCHRMNLKDTQLVFPVNALCFHPKTA 252
           CV   P+   +   S    ++V Y+  +   +  +  +  +K T     +NAL +H    
Sbjct: 104 CVSWAPNGYKFAVGSSARIISVCYYEHDNDWWVSKHIKKPIKST-----INALSWHENGV 158

Query: 253 LLYTGGSDG--RVFA 265
           LL  GG+DG  RVF+
Sbjct: 159 LLAAGGTDGYLRVFS 173

>KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA
           Kluyveromyces lactis Transcriptional repressor TUP1,
           start by similarity
          Length = 682

 Score = 30.0 bits (66), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 21/46 (45%)

Query: 242 VNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVKL 287
           + ++CF P    L TG  D  +  W+L T+K    L   E  +  L
Sbjct: 409 IRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSL 454

>Kwal_23.6429
          Length = 750

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 21/46 (45%)

Query: 242 VNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVKL 287
           + ++CF P    L TG  D  +  W+L TR+    L   E  +  L
Sbjct: 473 IRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSL 518

>AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH]
           complement(216252..216269,216423..218903) [2499 bp, 832
           aa]
          Length = 832

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 31/73 (42%), Gaps = 3/73 (4%)

Query: 242 VNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELP-KVEDS--VVKLCCNRRALVIAA 298
           V+   +HP   ++ +G  DG V  WN  T K    L   +E S  V      +R  + A 
Sbjct: 231 VSYAVYHPMLPIIISGSEDGTVKIWNSNTYKLERTLNLGLERSWCVAAHPTGKRNFIAAG 290

Query: 299 SDDSFKTSAVVED 311
            D+ F   A+  D
Sbjct: 291 FDNGFTVLAIGND 303

>Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement
          Length = 760

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 16/31 (51%)

Query: 242 VNALCFHPKTALLYTGGSDGRVFAWNLTTRK 272
           V+   FHP   ++ +G  DG V  WN  T K
Sbjct: 113 VSYAIFHPSLPIIISGSEDGTVKIWNANTYK 143

>CAGL0J06512g complement(620516..622153) similar to sp|Q04199
           Saccharomyces cerevisiae YML102w CAC2, start by
           similarity
          Length = 545

 Score = 29.6 bits (65), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 3/39 (7%)

Query: 242 VNALCFHPKTALLYTGGSDGRVFAWNLT---TRKKAEEL 277
           VN + F  +  +L + G DG+V  W LT   TRKK + +
Sbjct: 83  VNVIRFDHRGNVLASAGDDGQVLLWKLTNEETRKKQQRM 121

>Scas_660.8
          Length = 510

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 49/120 (40%), Gaps = 7/120 (5%)

Query: 22  SKDYLSGVCLVDEEGSQLIVSSWDGTASLYDWEK--NKRMGRLSHEWPLTSVAVCAGTRR 79
           S DY+  V  V      ++  S+DG   LYD     +  +  L H+ P+  +   + T+ 
Sbjct: 167 STDYVRSVTCVPSAPHMIVSGSYDGIIRLYDTRASGSSPIYSLLHDQPIEDIISISATQI 226

Query: 80  AYVGSAQGEVLELDWES---ERMVALQGVQCGLGISAM--GSYGQFVVVGSWDGSLAVVD 134
              G +  +V +L       ER    + V C   +S++        ++  S DG + V D
Sbjct: 227 VSCGGSNFKVWDLTSNKKLYERGNFNKTVTCLDHVSSLDDSPMNSALIASSLDGHVKVFD 286

>Scas_720.83d
          Length = 915

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 49/103 (47%), Gaps = 7/103 (6%)

Query: 37  SQLIVSSWDGTASLYDWEKNKRMGRLSH-EWPLTSVAV-CAGTRRAYVGSAQGEVLELDW 94
           + L+V   +G   LY+      + +LS  + P+ +VAV  +G   A+  S  G++L  +W
Sbjct: 271 NMLVVGFTNGEFRLYELPHFTLLQQLSMGQNPINTVAVNSSGEWLAFGSSKLGQLLVYEW 330

Query: 95  ESERMVALQGVQCGLGISAMGSY---GQFVVVGSWDGSLAVVD 134
           +SE  +  Q  Q     +   +Y   G  VV  + DG + V D
Sbjct: 331 QSESYILKQ--QGHFDATNSLTYSPDGSRVVTAAEDGKIKVWD 371

>YLR409C (UTP21) [3786] chr12 complement(934411..937230) Member of
           the Utp21-specific WD40 associated domain containing
           family, contains seven WD domains (WD-40 repeat), which
           may mediate protein-protein interactions, has high
           similarity to uncharacterized C. albicans Orf6.6423p
           [2820 bp, 939 aa]
          Length = 939

 Score = 29.6 bits (65), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 7/64 (10%)

Query: 113 AMGSYGQFVVVGSWDGSLAVVDTRRNTVR-----HIRRLTGKILSLDCGAARVVCMTTDG 167
           AM   G F  +GS +GS+ + + +   +R     H R +TG  +SLD    ++V    DG
Sbjct: 467 AMSQCGNFGFIGSSNGSITIYNMQSGILRKKYKLHKRAVTG--ISLDGMNRKMVSCGLDG 524

Query: 168 VYVF 171
           +  F
Sbjct: 525 IVGF 528

>KLLA0B01958g join(170646..170663,170896..173550) similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
           coatomer complex beta chain (beta -cop) of secretory
           pathway vesicles, hypothetical start
          Length = 890

 Score = 29.6 bits (65), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 31/79 (39%), Gaps = 9/79 (11%)

Query: 199 DEEGYVQSSVDGRVAVEYFGDEGRKFAFRCHRMNLKDTQLVFPVNALCFHPKTALLYTGG 258
           D+   + +S DG + V  +  +        H  N         V+   FHP   ++ +G 
Sbjct: 197 DKPYLITTSDDGTIKVWDYQTKSNVATLEGHMAN---------VSYAVFHPTLPIIISGS 247

Query: 259 SDGRVFAWNLTTRKKAEEL 277
            DG +  WN  T K  + L
Sbjct: 248 EDGTLKIWNANTYKLEKTL 266

>CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP, hypothetical start
          Length = 500

 Score = 29.3 bits (64), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 33/161 (20%), Positives = 59/161 (36%), Gaps = 7/161 (4%)

Query: 118 GQFVVVGSWDGSLAVVDTRRNTVRHIRRLTGKILSLDCGAARVVCMTTDGVYVFRTSDID 177
           G +V  GSW+G ++++D+  NT+     +T  + + D     +   + D V +    D  
Sbjct: 224 GNYVASGSWNGEVSIIDS--NTL----EVTQTLQNHDGKVGGIAWTSNDSVLITGGEDHL 277

Query: 178 AAPERRESGLKYQSRCVRLVPDEEGYVQSSVDGR-VAVEYFGDEGRKFAFRCHRMNLKDT 236
                R  G    S  +         +Q    G+ +    F    R +     +  L   
Sbjct: 278 ITVSNRSDGEFITSNSIGGHEGRITDLQVHPSGKFIGTSSFDSTWRLWDIEKQKQLLLQE 337

Query: 237 QLVFPVNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEEL 277
                +  L F    AL+ T G+D     W+L + K   +L
Sbjct: 338 GHSKELYCLAFQADGALVSTAGTDKTAIIWDLRSGKAVSQL 378

>CAGL0E01485g complement(138830..142840) similar to tr|Q08281
           Saccharomyces cerevisiae YOL138c, start by similarity
          Length = 1336

 Score = 29.3 bits (64), Expect = 5.1,   Method: Composition-based stats.
 Identities = 12/38 (31%), Positives = 19/38 (50%)

Query: 241 PVNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELP 278
           P   L +HP    + TGG DG+   W +  R+  ++ P
Sbjct: 398 PGLCLNWHPHQDYIATGGRDGKCSLWYVGDRRSTDQSP 435

>Kwal_56.23920
          Length = 937

 Score = 29.3 bits (64), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 18/27 (66%)

Query: 245 LCFHPKTALLYTGGSDGRVFAWNLTTR 271
           L +HP+T LL  G +DG +  W+L ++
Sbjct: 81  LQYHPETRLLAVGYNDGAIKIWDLLSK 107

>CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces
           cerevisiae YBR175w, start by similarity
          Length = 316

 Score = 28.9 bits (63), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 24/47 (51%)

Query: 241 PVNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVKL 287
           PV +LC++ K  LL+T   D  +  W++ T    + +    + VV +
Sbjct: 98  PVISLCYNNKGNLLFTSSMDESIKVWDVLTGTVMKTMSAHSEPVVSI 144

>KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces
           cerevisiae YML102w CAC2 chromatin assembly complex,
           subunit p60, start by similarity
          Length = 493

 Score = 28.9 bits (63), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 17/35 (48%), Gaps = 6/35 (17%)

Query: 241 PVNALCFHP------KTALLYTGGSDGRVFAWNLT 269
           P+ +LCF P       T  L+T G D ++  W L 
Sbjct: 16  PIYSLCFQPLSETNQNTRRLFTSGGDNKIRVWQLN 50

>Kwal_47.17465
          Length = 800

 Score = 28.9 bits (63), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 46/105 (43%), Gaps = 17/105 (16%)

Query: 193 CVRLVPDEEGYVQSSVDGRVAVEYFGDEGRKFAF------RCH-----RMNLKDTQLVFP 241
            VR  PD   ++ S  D R+ + +  DE +K         + H     R+   D      
Sbjct: 27  VVRFSPDG-NFLASGSDDRILLIWEKDEDQKQPIFGAENDKEHWNVRRRLVAHDND---- 81

Query: 242 VNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVK 286
           +  +C+ P +++L T G D  V  WN +T +K +    V  S+VK
Sbjct: 82  IQDICWAPDSSILVTVGLDRSVIVWNGSTFEKIKRF-DVHQSLVK 125

>Kwal_56.24163
          Length = 729

 Score = 28.9 bits (63), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 16/31 (51%)

Query: 242 VNALCFHPKTALLYTGGSDGRVFAWNLTTRK 272
           V+   FHP   ++ +G  DG +  WN  T K
Sbjct: 88  VSYAVFHPSLPIILSGSEDGTLKVWNSNTYK 118

>KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46, start by
           similarity
          Length = 434

 Score = 28.5 bits (62), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 24/48 (50%)

Query: 242 VNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVKLCC 289
           V+ +  HP   ++ T G D  V  W++ +R +   LP  +  + K+ C
Sbjct: 210 VHTVDVHPSLDIIATAGRDAVVRLWDIRSRSEIMVLPGHKSPINKVKC 257

>Scas_544.4
          Length = 524

 Score = 28.5 bits (62), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 242 VNALCFHP--KTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVKL 287
           ++A+ FHP  +  L+  G + G V  WN+      +EL + E + VKL
Sbjct: 196 ISAIYFHPSVEKKLIVAGDTSGNVGFWNVRDDPIEDELEEPEITRVKL 243

>YHR186C (KOG1) [2471] chr8 complement(475997..480670) Component of
            the TOR complex 1 (Tor1p or Tor2p-Kog1p-Lst8p), which is
            required for wild-type growth, maintenance of cell and
            vacuole size and morphology, protein synthesis,
            maintenance of glycogen homeostasis [4674 bp, 1557 aa]
          Length = 1557

 Score = 28.5 bits (62), Expect = 9.6,   Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 18/31 (58%)

Query: 38   QLIVSSWDGTASLYDWEKNKRMGRLSHEWPL 68
            QLI +    T +++DWEK K + + S+  P 
Sbjct: 1223 QLITADDRSTITVFDWEKGKTLSKFSNGTPF 1253

>YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741)
           Coatomer (COPI) complex beta' chain (beta'-COP) of
           secretory pathway vesicles, required for retrograde
           transport from Golgi to endoplasmic reticulum, member of
           the WD (WD-40) repeat family [2670 bp, 889 aa]
          Length = 889

 Score = 28.5 bits (62), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 19/36 (52%)

Query: 242 VNALCFHPKTALLYTGGSDGRVFAWNLTTRKKAEEL 277
           V+   FHP   ++ +G  DG +  WN +T K  + L
Sbjct: 231 VSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTL 266

>YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that
           targets proteins for ubiquitination by interacting with
           the SCF complex (Skp1p-Cdc53p-Cdc34p), regulates sulfur
           assimilation genes in response to S-adenosylmethionine
           levels, contains five WD (WD-40) repeats [1923 bp, 640
           aa]
          Length = 640

 Score = 28.5 bits (62), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 24/52 (46%)

Query: 253 LLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVKLCCNRRALVIAASDDSFK 304
           LL+TG  D  +  W+L T K    L    D V  L  + R L+  + D + +
Sbjct: 314 LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIR 365

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.134    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,596,192
Number of extensions: 386354
Number of successful extensions: 1474
Number of sequences better than 10.0: 92
Number of HSP's gapped: 1411
Number of HSP's successfully gapped: 101
Length of query: 318
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 216
Effective length of database: 13,065,073
Effective search space: 2822055768
Effective search space used: 2822055768
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)