Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADR356C80679132930.0
KLLA0F02596g6584216802e-78
Kwal_26.70526324086676e-77
CAGL0E05302g8294656261e-69
Scas_663.247374286052e-67
YOR329C (SCD5)8724265532e-59
YIR006C (PAN1)148084940.006
CAGL0J01892g137433741.1
KLLA0D09867g79428712.5
CAGL0F01969g44839693.8
Kwal_55.20976146853676.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADR356C
         (791 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADR356C [2097] [Homologous to ScYOR329C (SCD5) - SH] (1333929..1...  1273   0.0  
KLLA0F02596g 235864..237840 some similarities with sp|P34758 Sac...   266   2e-78
Kwal_26.7052                                                          261   6e-77
CAGL0E05302g complement(514064..516553) weakly similar to sp|P34...   245   1e-69
Scas_663.24                                                           237   2e-67
YOR329C (SCD5) [5110] chr15 complement(936726..939344) Multicopy...   217   2e-59
YIR006C (PAN1) [2671] chr9 complement(365463..369905) Protein in...    41   0.006
CAGL0J01892g 185011..189135 similar to sp|P32521 Saccharomyces c...    33   1.1  
KLLA0D09867g complement(831834..834218) similar to sp|P32567 Sac...    32   2.5  
CAGL0F01969g complement(191278..192624) similar to sp|Q12110 Sac...    31   3.8  
Kwal_55.20976                                                          30   6.6  

>ADR356C [2097] [Homologous to ScYOR329C (SCD5) - SH]
           (1333929..1336349) [2421 bp, 806 aa]
          Length = 806

 Score = 1273 bits (3293), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 650/791 (82%), Positives = 650/791 (82%)

Query: 1   MSFDWLNVPGLNVKDXXXXXXXXXXXXTVSFNFSEEQREDESAGRRTQDTQEEYRETAED 60
           MSFDWLNVPGLNVKD            TVSFNFSEEQREDESAGRRTQDTQEEYRETAED
Sbjct: 1   MSFDWLNVPGLNVKDGPESSAGSAPPPTVSFNFSEEQREDESAGRRTQDTQEEYRETAED 60

Query: 61  LRVPLSLSGSQLAPEELKTYRLWYKCMVXXXXXXXXXXXXDIFRFLGNFQLSDSVKERTR 120
           LRVPLSLSGSQLAPEELKTYRLWYKCMV            DIFRFLGNFQLSDSVKERTR
Sbjct: 61  LRVPLSLSGSQLAPEELKTYRLWYKCMVSRRRSRTLRLEEDIFRFLGNFQLSDSVKERTR 120

Query: 121 SIFRTCQMAVSPGQFYAIMRTIAHALQANVLPTRRMILERAAVPEPRSILSLDAGPETYE 180
           SIFRTCQMAVSPGQFYAIMRTIAHALQANVLPTRRMILERAAVPEPRSILSLDAGPETYE
Sbjct: 121 SIFRTCQMAVSPGQFYAIMRTIAHALQANVLPTRRMILERAAVPEPRSILSLDAGPETYE 180

Query: 181 EVEEDPKSAADNRVDFDSFASLLLTGKTXXXXXXXXXXXXXXXXXXXSFSENLVTFHXXX 240
           EVEEDPKSAADNRVDFDSFASLLLTGKT                   SFSENLVTFH   
Sbjct: 181 EVEEDPKSAADNRVDFDSFASLLLTGKTVRKNIRRKINKRNGRVKKVSFSENLVTFHEEL 240

Query: 241 XXXXXXXXXXXXXXXPNEPLDFSMPMDQLLKKMAERKTRNTALVSEAPKQPETVEEREEL 300
                          PNEPLDFSMPMDQLLKKMAERKTRNTALVSEAPKQPETVEEREEL
Sbjct: 241 PEEEAAEDAADGSEDPNEPLDFSMPMDQLLKKMAERKTRNTALVSEAPKQPETVEEREEL 300

Query: 301 ADMRDSLNHFKHIQTADNVAQGSFATQYMASVSSNADSGEEPALEPLKPTATGSANHLFR 360
           ADMRDSLNHFKHIQTADNVAQGSFATQYMASVSSNADSGEEPALEPLKPTATGSANHLFR
Sbjct: 301 ADMRDSLNHFKHIQTADNVAQGSFATQYMASVSSNADSGEEPALEPLKPTATGSANHLFR 360

Query: 361 SHMQATISSFTKAPAAPVTTPLLHQSEPSAPDTQGPRSELQGPSGARTQLSTPALQAQGT 420
           SHMQATISSFTKAPAAPVTTPLLHQSEPSAPDTQGPRSELQGPSGARTQLSTPALQAQGT
Sbjct: 361 SHMQATISSFTKAPAAPVTTPLLHQSEPSAPDTQGPRSELQGPSGARTQLSTPALQAQGT 420

Query: 421 GYYAQNGAPQQASTPALXXXXXXXXXXXXXXXXVITPALQAQGTGYYQQNGASQQASTPA 480
           GYYAQNGAPQQASTPAL                VITPALQAQGTGYYQQNGASQQASTPA
Sbjct: 421 GYYAQNGAPQQASTPALQAQGTGYYQQNGTQQQVITPALQAQGTGYYQQNGASQQASTPA 480

Query: 481 LXXXXXXXXXXXXXXXXVITPALQAQGTGYYQQNGAPQQASTPALQAQGTGYYPQNGTQQ 540
           L                VITPALQAQGTGYYQQNGAPQQASTPALQAQGTGYYPQNGTQQ
Sbjct: 481 LQTQGTGYYQQNGTQQQVITPALQAQGTGYYQQNGAPQQASTPALQAQGTGYYPQNGTQQ 540

Query: 541 PAATSIHQAHNAGFPXXXXXXXXXXXXXPGLYRNTASPLSAPTLQVQGSAYYQNSNPPLP 600
           PAATSIHQAHNAGFP             PGLYRNTASPLSAPTLQVQGSAYYQNSNPPLP
Sbjct: 541 PAATSIHQAHNAGFPQQDSSSSAHQAQAPGLYRNTASPLSAPTLQVQGSAYYQNSNPPLP 600

Query: 601 PQATGYYQGGNPPLLQVQGTGYYQQSQDSGSVPANRSSTPVLQPQSTGYYRXXXXXXXXX 660
           PQATGYYQGGNPPLLQVQGTGYYQQSQDSGSVPANRSSTPVLQPQSTGYYR         
Sbjct: 601 PQATGYYQGGNPPLLQVQGTGYYQQSQDSGSVPANRSSTPVLQPQSTGYYRSSSPMHSPM 660

Query: 661 XLPAMVXXXXXXXXHSLLAVPDPQRPYYGGGFQXXXXXXXTNQHTAPSQYAPTSGYVIPN 720
            LPAMV        HSLLAVPDPQRPYYGGGFQ       TNQHTAPSQYAPTSGYVIPN
Sbjct: 661 HLPAMVSQQSPQPSHSLLAVPDPQRPYYGGGFQPSSSPSSTNQHTAPSQYAPTSGYVIPN 720

Query: 721 TQPGYAALSSHPSQHEPAYLAANRYGXXXXXXXXXXLLHQQHLPHNNFLQPPQHASQPLP 780
           TQPGYAALSSHPSQHEPAYLAANRYG          LLHQQHLPHNNFLQPPQHASQPLP
Sbjct: 721 TQPGYAALSSHPSQHEPAYLAANRYGSPNPPFSSSPLLHQQHLPHNNFLQPPQHASQPLP 780

Query: 781 PKTNIIGDLRA 791
           PKTNIIGDLRA
Sbjct: 781 PKTNIIGDLRA 791

>KLLA0F02596g 235864..237840 some similarities with sp|P34758
           Saccharomyces cerevisiae YOR329c SCD5 suppressor of
           clathrin deficiency singleton, hypothetical start
          Length = 658

 Score =  266 bits (680), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 173/421 (41%), Positives = 217/421 (51%), Gaps = 65/421 (15%)

Query: 1   MSFDWLNVPGLNV-KDXXXXXXXXXXXXTVSFNFSEEQREDESA------------GRR- 46
           MSFDWLNVPGL++  D             VSF+F+   R  E +            GR  
Sbjct: 1   MSFDWLNVPGLDISNDSQASVSSSSPPPAVSFSFTTADRPQEPSNLQQPQSQQSLRGREG 60

Query: 47  -----------TQDTQEE-------------------YRETAEDLRVPLSLSGSQLAPEE 76
                       QD+Q +                   Y ETA++L+VPL++   QL P+E
Sbjct: 61  NKLTVSGSTSNFQDSQSKSHTIDGALHSHSESDIASSYVETAQELQVPLAVPEFQLTPDE 120

Query: 77  LKTYRLWYKCMVXXXXXXXXXXXXDIFRFLGNFQLSDSVKERTRSIFRTCQMAVSPGQFY 136
            K Y  W++ +             D+F FL NF++ D++KER   IFRTC+ AV+  QFY
Sbjct: 121 RKAYLRWFRDL-SSRIHSRPITLDDVFNFLANFRIDDTIKERITHIFRTCRYAVNEEQFY 179

Query: 137 AIMRTIAHALQANVLPTRRMILERAAVPEPRSILSLDAGPETYEEVEEDPKSAADNRVDF 196
           AI+R +AH LQ + LPTR MI E+A V  P+SILS +AG E YEEVEEDP +A D +VDF
Sbjct: 180 AIIRLVAHGLQQHFLPTRSMIPEKAPVLRPKSILSANAGQEVYEEVEEDPNNATDKKVDF 239

Query: 197 DSFASLLLTGKTXXXXXXXXXXXXXXXXXXXSFSENLVTFHXXXXXXXXXXXXXXXXXXP 256
           D FASLLLTGK                     FS+NLVTF                    
Sbjct: 240 DGFASLLLTGKAIQKNIRRRIMKRRDQIKKVRFSKNLVTFANDLSTKAMSSISRSGKPAV 299

Query: 257 NEP---------------LDFSMPMDQLLKKMAERKTRNTALVSEAPK--QPETVEEREE 299
             P               LD S+PM+QLL K++ R   N+ALV E P   QPET EERE 
Sbjct: 300 TAPDNAASTESSPSDDSTLDLSLPMEQLLAKLSSRNRNNSALVKELPSDTQPETQEEREV 359

Query: 300 LADMRDSLNHFKHIQTADNVAQGSFATQYMASVSSNADSGEEPALEPLKPTATGSANHLF 359
           L DM+DSL+HF+ IQ  D+V Q       M+S  S+  SG E ALEPLKPTATGSAN+LF
Sbjct: 360 LEDMKDSLSHFRQIQKVDSVTQ---LPNNMSSYESSNSSGREQALEPLKPTATGSANYLF 416

Query: 360 R 360
           R
Sbjct: 417 R 417

 Score =  249 bits (636), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 146/362 (40%), Positives = 189/362 (52%), Gaps = 50/362 (13%)

Query: 49  DTQEEYRETAEDLRVPLSLSGSQLAPEELKTYRLWYKCMVXXXXXXXXXXXXDIFRFLGN 108
           D    Y ETA++L+VPL++   QL P+E K Y  W++ +             D+F FL N
Sbjct: 93  DIASSYVETAQELQVPLAVPEFQLTPDERKAYLRWFRDL-SSRIHSRPITLDDVFNFLAN 151

Query: 109 FQLSDSVKERTRSIFRTCQMAVSPGQFYAIMRTIAHALQANVLPTRRMILERAAVPEPRS 168
           F++ D++KER   IFRTC+ AV+  QFYAI+R +AH LQ + LPTR MI E+A V  P+S
Sbjct: 152 FRIDDTIKERITHIFRTCRYAVNEEQFYAIIRLVAHGLQQHFLPTRSMIPEKAPVLRPKS 211

Query: 169 ILSLDAGPETYEEVEEDPKSAADNRVDFDSFASLLLTGKTXXXXXXXXXXXXXXXXXXXS 228
           ILS +AG E YEEVEEDP +A D +VDFD FASLLLTGK                     
Sbjct: 212 ILSANAGQEVYEEVEEDPNNATDKKVDFDGFASLLLTGKAIQKNIRRRIMKRRDQIKKVR 271

Query: 229 FSENLVTFHXXXXXXXXXXXXXXXXXXPNEP---------------LDFSMPMDQLLKKM 273
           FS+NLVTF                      P               LD S+PM+QLL K+
Sbjct: 272 FSKNLVTFANDLSTKAMSSISRSGKPAVTAPDNAASTESSPSDDSTLDLSLPMEQLLAKL 331

Query: 274 AERKTRNTALVSEAPK--QPETVEEREELADMRDSLNHFKHIQTADNVAQ---------- 321
           + R   N+ALV E P   QPET EERE L DM+DSL+HF+ IQ  D+V Q          
Sbjct: 332 SSRNRNNSALVKELPSDTQPETQEEREVLEDMKDSLSHFRQIQKVDSVTQLPNNMSSYES 391

Query: 322 ------------------GSFATQYMASV----SSNADSGEEPALEPLKPTATGSANHLF 359
                             GS    +  +V    + +A+  +   LEPLKPTATGSAN +F
Sbjct: 392 SNSSGREQALEPLKPTATGSANYLFRQTVPPSHNIDANKNDNHILEPLKPTATGSANEIF 451

Query: 360 RS 361
           ++
Sbjct: 452 KN 453

>Kwal_26.7052
          Length = 632

 Score =  261 bits (667), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 176/408 (43%), Positives = 222/408 (54%), Gaps = 39/408 (9%)

Query: 1   MSFDWLNVPGLNVKDXXXXXXXXXXXXTVSFNFSE------EQR---------------- 38
           MSFDWLNVPGL   D            +VSFNF        EQR                
Sbjct: 1   MSFDWLNVPGL-PSDDGDYAGASEPPPSVSFNFGNVSLEPVEQRSQSITTTKHDRVNSTH 59

Query: 39  EDESAGRRTQDTQEE-----YRETAEDLRVPLSLSGSQLAPEELKTYRLWYKCMVXXXXX 93
           E      RTQD   E     Y ET EDL+VPLSLS SQL  EE +TY  WY   +     
Sbjct: 60  EASQVSNRTQDHHGESQLVNYAETKEDLQVPLSLSKSQLTREEARTYLRWY-GYISSRKE 118

Query: 94  XXXXXXXDIFRFLGNFQLSDSVKERTRSIFRTCQMAVSPGQFYAIMRTIAHALQANVLPT 153
                  DIFRF+GNF L++  KER   IF+TC+ +++ GQF+AI+R I+ AL  NV+P 
Sbjct: 119 AKLISLDDIFRFMGNFPLAEMAKERIERIFKTCRNSLNIGQFFAILRLISRALTENVMPM 178

Query: 154 RRMILERAAVPEPRSILSLDAGPETYEEVEEDPKSAADNRVDFDSFASLLLTGKTXXXXX 213
           RRMI + A VP+P+SIL+     E YEEV ED +   + +VDFDSFASLLLTG+      
Sbjct: 179 RRMISQAAPVPKPKSILAA-GNEEVYEEV-EDSQDGPELKVDFDSFASLLLTGQKKKKMR 236

Query: 214 XXXXXXXXXXXXXXSFSENLVTFHXXXX-XXXXXXXXXXXXXXPNEPLDFSMPMDQLLKK 272
                          F++ LVTF                     NEPLD S+PMDQLLKK
Sbjct: 237 RRITNHHKKQKRVR-FTDKLVTFQDHAQPKTDENASEGNGVPDDNEPLDLSLPMDQLLKK 295

Query: 273 MAERKTRNTALVSE--APKQPETVEEREELADMRDSLNHFKHIQTADNVAQGSFATQYMA 330
           +A R+  N+ALVS+  + ++PE+ EE+E L DMR+SLNHF+ I   D+V+ G    Q ++
Sbjct: 296 LAARRN-NSALVSKPPSEQEPESQEEKEVLDDMRESLNHFQQIHNVDSVSVGGLPAQ-VS 353

Query: 331 SVSSNADSGEEPALEPLKPTATGSANHLFRSHMQATISSFTKAPAAPV 378
           +V  NA +  E  LEPLKPTATGSAN+LFRS  Q T       P  P+
Sbjct: 354 TVQKNAVA--ENHLEPLKPTATGSANYLFRSSQQQTPQVTISEPLQPL 399

>CAGL0E05302g complement(514064..516553) weakly similar to sp|P34758
           Saccharomyces cerevisiae YOR329c SCD5 suppressor of
           clathrin deficiency, start by similarity
          Length = 829

 Score =  245 bits (626), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 172/465 (36%), Positives = 229/465 (49%), Gaps = 108/465 (23%)

Query: 1   MSFDWLNVPGLNVKDXXXXXXXXXXXXTVSFNF------SEEQ----------------- 37
           MSFDWLNVPGLN               TVSF+F      S+EQ                 
Sbjct: 1   MSFDWLNVPGLNT---ATDDRQNSTLPTVSFDFGVTDDSSKEQGMHFLDETMKSSSDPSL 57

Query: 38  --REDESAGR-----------------RTQD---TQEEYR-------------------- 55
             + DE+  +                 R+Q+   T+E+++                    
Sbjct: 58  VRKLDEANSKLDVPPVSGAYLQQNGLHRSQEALATEEDHKTQKSNINGNRYHNPIHEEED 117

Query: 56  ---ETAEDLRVPLSLSGSQLAPEELKTYRLWYKCMVXXXXXXXXXXXXDIFRFLGNFQLS 112
              ET +DLRVPLSLS +QL  EEL+TY  WY   +            D+F+FL NF + 
Sbjct: 118 SYVETPDDLRVPLSLSQNQLTHEELRTYIRWYNY-ITARTHGKLIKLADVFQFLANFNVR 176

Query: 113 DSVKERTRSIFRTCQMAVSPGQFYAIMRTIAHALQANVLPTRRMILERAAVPEPRSILSL 172
           + +K+R   IFR+C+ A++ GQF+A++R +A A+  ++LP+R+MILE+A +P PR IL+ 
Sbjct: 177 EELKKRIFKIFRSCKNALNIGQFFAVLRLLARAMLEDMLPSRKMILEKAPIPRPRPILNK 236

Query: 173 DAGPETYEEVEED-PKSAAD---------NRVDFDSFASLLLTGKTXXXXXXXXXXXXXX 222
           + G E YEEVEED P S+            +VDFDSFASLLLTGKT              
Sbjct: 237 EGGNEFYEEVEEDVPASSGTTTSNNQPPGEKVDFDSFASLLLTGKTVRKRIRRKVKNSVF 296

Query: 223 XXXXXSFSENLVTFH--------XXXXXXXXXXXXXXXXXXPNEPLDFSMPMDQLLKKMA 274
                 F+E  VTF                            +EPLD S+PMDQLLK +A
Sbjct: 297 KNKKVRFAEK-VTFQDAPHYGKDKQNKDTSTTTDDDSSYVSTDEPLDLSLPMDQLLKVIA 355

Query: 275 ERKTRNTALVSEAPKQPETVEEREE-LADMRDSLNHFKHIQTADN-------VAQGSFAT 326
           +RK +N+ALVS  P + +  EE  E L+DM+DSL+HFK IQ  D+       VAQG  +T
Sbjct: 356 KRK-KNSALVSSVPTEQQETEEEREILSDMKDSLSHFKQIQGPDSVTQIPPLVAQGQQST 414

Query: 327 QYMASVSSNAD--------SGEEPALEPLKPTATGSANHLFRSHM 363
            +        D          +EP LEPLKPTATGSANHL +SHM
Sbjct: 415 IFNTGYKVTGDQPPAQTTSQPQEPVLEPLKPTATGSANHLMKSHM 459

>Scas_663.24
          Length = 737

 Score =  237 bits (605), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 157/428 (36%), Positives = 218/428 (50%), Gaps = 70/428 (16%)

Query: 1   MSFDWLNVPGLNVKDXXXXXXXXXXXXT----------------VSFNFS---------- 34
           MSFDWLN+PGLN +D            +                VSF+F           
Sbjct: 1   MSFDWLNIPGLNTEDNTNINNNNNTGASTNNGPGGLNGSLGPPSVSFDFGFPMNGNNTGL 60

Query: 35  -------EEQREDESAGRRTQDTQEEYRETAEDLRVPLSLSGSQLAPEELKTYRLWYKCM 87
                    Q +       + D   +Y ET++DLRVPLSLS +QL  EEL+TY  WY  +
Sbjct: 61  PTMDQSVRSQSDTSIVNMSSTDAVSDYSETSDDLRVPLSLSQTQLTNEELRTYLRWYNYI 120

Query: 88  VXXXXXXXXXXXXDIFRFLGNFQLSDSVKERTRSIFRTCQMAVSPGQFYAIMRTIAHALQ 147
           +            D+F+FL NF ++D +K R  +IFR+C+ A++ GQF+A++R ++ AL 
Sbjct: 121 IAKTHGKLVRLM-DVFKFLCNFNITDQLKNRIMAIFRSCKNALNIGQFFAVLRLVSKALL 179

Query: 148 ANVLPTRRMILERAAVPEPRSILSL--DAGPETYEEVEED------PKSAADNRVDFDSF 199
            NVLPTR+MIL++A +P+P+ I+++  D   E YEEV+ED        +  + +VDFDSF
Sbjct: 180 QNVLPTRKMILDKAPIPKPKPIITISTDNDQEVYEEVDEDTPNTANGNNNENGKVDFDSF 239

Query: 200 ASLLLTGKTXXXXXXXXXXXXXXXXXXXSFSENLVTFHX-----------------XXXX 242
            SLLLTG+T                    F+E+ +TF                       
Sbjct: 240 TSLLLTGRTARKRIRRKIKNAVFKNKRVRFAEH-ITFQEPPKPNSGNENNNNNAMILNQT 298

Query: 243 XXXXXXXXXXXXXPNEPLDFSMPMDQLLKKMAERKTRNTALVSEAPK-QPETVEEREELA 301
                        P  PLD S+PMDQLLK+MA RK  N+ALVS  P  Q ET EE+E L 
Sbjct: 299 TNNNNMDDSSSAVPQGPLDLSLPMDQLLKQMALRKKNNSALVSTLPNEQQETEEEKEVLE 358

Query: 302 DMRDSLNHFKHIQTADNV-----AQGSFATQYMASVSSNAD----SGEEPALEPLKPTAT 352
           DM+DSL+HFK+I T D+      +  +    YM + ++  +    S  +  L+PLKPTAT
Sbjct: 359 DMKDSLSHFKNITTVDSATLLPDSTSTMQPMYMNNENNALNQNNPSMNQVPLQPLKPTAT 418

Query: 353 GSANHLFR 360
           GSANHLFR
Sbjct: 419 GSANHLFR 426

>YOR329C (SCD5) [5110] chr15 complement(936726..939344) Multicopy
           suppressor of lethality caused by clathrin deficiency
           [2619 bp, 872 aa]
          Length = 872

 Score =  217 bits (553), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 158/426 (37%), Positives = 213/426 (50%), Gaps = 68/426 (15%)

Query: 1   MSFDWLNVPGLNVKDXXXXXXXXXXXX---TVSFNF------------------------ 33
           MSFDWLNVPGL++                 +VSF+F                        
Sbjct: 1   MSFDWLNVPGLDLSSGDQAEKRPSNGLGPPSVSFDFGINTAAPHDSSFWDQGSRSHSDTT 60

Query: 34  ------------------SEEQREDESAGR-RTQDTQEEYRETAEDLRVPLSLSGSQLAP 74
                             S  Q+++   G  RT    + Y E+ ED++VPLSLS +QL  
Sbjct: 61  LSYRNNHSNTAADNATNVSSPQKDNPPNGEVRTLSGGDVYAESPEDMQVPLSLSQNQLTH 120

Query: 75  EELKTYRLWYKCMVXXXXXXXXXXXXDIFRFLGNFQLSDSVKERTRSIFRTCQMAVSPGQ 134
           EE++TY  WY   +            D+FRFL NF LS  VK+R   IFR+C+ A++ GQ
Sbjct: 121 EEIRTYLRWYH-YICLRTHGKLVRLNDVFRFLTNFNLSQKVKDRIVEIFRSCKNALNIGQ 179

Query: 135 FYAIMRTIAHALQANVLPTRRMILERAAVPEPRSILSLDAGPETYEEVEEDPKSA--ADN 192
           F+A++R ++ A+   +LP RRMILE+A VP+PR ILS +   E YEEVE+D  SA   D 
Sbjct: 180 FFAVLRLVSRAIIYGILPLRRMILEKAPVPKPRPILSSENHEEVYEEVEDDDSSAKTGDQ 239

Query: 193 RVDFDSFASLLLTGKTXXXXXXXXXXXXXXXXXXXSFSENLVTFHXXXXXXXXXXXXXXX 252
           +VDFDSFASLLLTGKT                    FSE++                   
Sbjct: 240 KVDFDSFASLLLTGKTTRKRVRRRIKNLNFKSKKVRFSEHITFQDPPNLNQESSNNSEAR 299

Query: 253 XXXP-----------NEPLDFSMPMDQLLKKMAERKTRNTALVSEAPKQPETVEEREE-L 300
              P           + PLDF++PMDQLLK++ +R+ +N+ LVS  P + +  EE ++ L
Sbjct: 300 KQDPDAEDEDQDSNNDSPLDFTLPMDQLLKRLYKRR-KNSGLVSSLPSEQQETEEEKKVL 358

Query: 301 ADMRDSLNHFKHIQTADNVA---QGSFATQYMASVSSNADSGEEPA---LEPLKPTATGS 354
            DM+DSL+HFK IQT D+ +      F        +SN ++   P    LEPLKPTATGS
Sbjct: 359 EDMKDSLSHFKQIQTVDSASLPISSVFLQNGNTLPTSNVNNTTVPQQLPLEPLKPTATGS 418

Query: 355 ANHLFR 360
           ANHL R
Sbjct: 419 ANHLVR 424

>YIR006C (PAN1) [2671] chr9 complement(365463..369905) Protein
           involved in organization of the actin cytoskeleton and
           in endocytosis, binds to the ARP2/3 complex to stimulate
           actin polymerization [4443 bp, 1480 aa]
          Length = 1480

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 39/84 (46%), Gaps = 17/84 (20%)

Query: 583 TLQVQGSAYYQNSNP-------PLPPQATGYYQGGNPPL---------LQVQGTGYYQQS 626
           ++Q QG+ YYQ +N        PL  Q TGYY    P L         LQ QGTGYYQ  
Sbjct: 142 SIQPQGTGYYQAANTANVHSVQPLQSQGTGYYVS-TPNLISSNQTQQPLQAQGTGYYQSQ 200

Query: 627 QDSGSVPANRSSTPVLQPQSTGYY 650
                 P    S   L+PQ TG+Y
Sbjct: 201 PQQVPPPQQAQSLQPLKPQQTGFY 224

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 25/47 (53%), Gaps = 7/47 (14%)

Query: 502 ALQAQGTGYYQQNGAPQQASTPALQAQGTGYY-------PQNGTQQP 541
           ++Q QGTGYYQ        S   LQ+QGTGYY         N TQQP
Sbjct: 142 SIQPQGTGYYQAANTANVHSVQPLQSQGTGYYVSTPNLISSNQTQQP 188

>CAGL0J01892g 185011..189135 similar to sp|P32521 Saccharomyces
           cerevisiae YIR006c PAN1, hypothetical start
          Length = 1374

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%)

Query: 584 LQVQGSAYYQNSNPPLPPQATGYYQGGNPPLLQ 616
           L VQ +   Q S  PL PQ TG+Y+ GN P+L+
Sbjct: 138 LNVQNTVQSQQSVQPLLPQQTGFYRQGNQPVLE 170

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 14/20 (70%)

Query: 339 GEEPALEPLKPTATGSANHL 358
           G +P LEPLKPTATG  N  
Sbjct: 164 GNQPVLEPLKPTATGFVNSF 183

>KLLA0D09867g complement(831834..834218) similar to sp|P32567
           Saccharomyces cerevisiae YMR165c SMP2 involved in
           plasmid maintenance, respiration and cell proliferation
           singleton, start by similarity
          Length = 794

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 571 LYRNTASPLSAPTLQVQGSAYYQNSNPP 598
           +Y N  SPLS+P L+VQ S    N+N P
Sbjct: 641 MYLNLGSPLSSPVLKVQDSDLDMNTNSP 668

>CAGL0F01969g complement(191278..192624) similar to sp|Q12110
           Saccharomyces cerevisiae YLR049c, hypothetical start
          Length = 448

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 2/39 (5%)

Query: 612 PPLLQVQGTGYYQQSQDSGSVPANRSSTPVLQPQSTGYY 650
           P LL++ GTG   +SQDS + P+ +S   VL+ +  G Y
Sbjct: 301 PWLLRISGTG--SKSQDSRTSPSEKSQAAVLETKMYGSY 337

>Kwal_55.20976
          Length = 1468

 Score = 30.4 bits (67), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 27/53 (50%), Gaps = 11/53 (20%)

Query: 598 PLPPQATGYYQGGNPPLLQVQGTGYYQQSQDSGSVPANRSSTPVLQPQSTGYY 650
           PL  Q TG +    P  LQ Q TG+Y Q+          +S P LQPQ TG+Y
Sbjct: 256 PLQSQQTGSFAQAAPQALQPQQTGFYSQT----------TSQP-LQPQQTGFY 297

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.127    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 21,603,438
Number of extensions: 815906
Number of successful extensions: 2701
Number of sequences better than 10.0: 51
Number of HSP's gapped: 2597
Number of HSP's successfully gapped: 106
Length of query: 791
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 681
Effective length of database: 12,788,129
Effective search space: 8708715849
Effective search space used: 8708715849
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 66 (30.0 bits)