Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADR355C109753271e-40
YOR327C (SNC2)115613151e-38
Scas_663.25112613131e-38
KLLA0A03883g110613132e-38
CAGL0G06358g113613098e-38
YAL030W (SNC1)117613036e-37
CAGL0E05258g108612801e-33
Kwal_26.705474532753e-33
Kwal_56.23743162581268e-10
YLR093C (NYV1)253571211e-08
Scas_564.4*237571201e-08
CAGL0C00429g234571182e-08
AGR054C248581183e-08
KLLA0F19448g231581112e-07
Kwal_47.1712120047848e-04
AER109W20047810.002
Sklu_2258.720047810.002
Scas_571.120047800.003
CAGL0D03498g20547800.003
YKL196C (YKT6)20046800.004
KLLA0D02684g20046730.027
CAGL0L06908g43947557.5
Scas_623.544647557.6
YDL084W (SUB2)44647558.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADR355C
         (107 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADR355C [2096] [Homologous to ScYOR327C (SNC2) - SH; ScYAL030W (...   130   1e-40
YOR327C (SNC2) [5108] chr15 complement(930729..931076) Synaptobr...   125   1e-38
Scas_663.25                                                           125   1e-38
KLLA0A03883g join(344642..344725,344850..345098) similar to sp|P...   125   2e-38
CAGL0G06358g complement(612827..613168) no similarity, hypotheti...   123   8e-38
YAL030W (SNC1) [38] chr1 (87289..87390,87504..87755) Synaptobrev...   121   6e-37
CAGL0E05258g complement(511027..511353) highly similar to sp|P33...   112   1e-33
Kwal_26.7054                                                          110   3e-33
Kwal_56.23743                                                          53   8e-10
YLR093C (NYV1) [3508] chr12 complement(326514..327259,327401..32...    51   1e-08
Scas_564.4*                                                            51   1e-08
CAGL0C00429g 43086..43790 similar to tr|Q12255 Saccharomyces cer...    50   2e-08
AGR054C [4364] [Homologous to ScYLR093C (NYV1) - SH] (815110..81...    50   3e-08
KLLA0F19448g complement(1799571..1800266) similar to sgd|S000408...    47   2e-07
Kwal_47.17121                                                          37   8e-04
AER109W [2614] [Homologous to ScYKL196C (YKT6) - SH] complement(...    36   0.002
Sklu_2258.7 YKL196C, Contig c2258 11983-12585 reverse complement       36   0.002
Scas_571.1                                                             35   0.003
CAGL0D03498g complement(357058..357675) highly similar to sp|P36...    35   0.003
YKL196C (YKT6) [3076] chr11 complement(74937..75539) Synaptobrev...    35   0.004
KLLA0D02684g complement(228564..229166) highly similar to sp|P36...    33   0.027
CAGL0L06908g complement(777557..778876) highly similar to sp|Q07...    26   7.5  
Scas_623.5                                                             26   7.6  
YDL084W (SUB2) [784] chr4 (305237..306577) Essential pre-mRNA sp...    26   8.8  

>ADR355C [2096] [Homologous to ScYOR327C (SNC2) - SH; ScYAL030W
          (SNC1) - SH] (1333349..1333597,1333672..1333752) [330
          bp, 109 aa]
          Length = 109

 Score =  130 bits (327), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 63/75 (84%)

Query: 14 EGXXXXXXXXXXXXEIDDTVGIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANR 73
          EG            EIDDTVGIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANR
Sbjct: 14 EGAQSQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANR 73

Query: 74 VRKQMWWKDLKMRLC 88
          VRKQMWWKDLKMRLC
Sbjct: 74 VRKQMWWKDLKMRLC 88

>YOR327C (SNC2) [5108] chr15 complement(930729..931076)
          Synaptobrevin (v-SNARE) homolog present on post-Golgi
          vesicles [348 bp, 115 aa]
          Length = 115

 Score =  125 bits (315), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 58/61 (95%), Positives = 61/61 (100%)

Query: 28 EIDDTVGIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRL 87
          EIDDTVGIMRDNINKVAERGERLTSI+DKADNLA+SAQGFKRGANRVRKQMWWKDLKMR+
Sbjct: 34 EIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANRVRKQMWWKDLKMRM 93

Query: 88 C 88
          C
Sbjct: 94 C 94

>Scas_663.25
          Length = 112

 Score =  125 bits (313), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 59/61 (96%), Positives = 60/61 (98%)

Query: 28 EIDDTVGIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRL 87
          EIDDTVGIMRDNINKVAERGERLTSI+DKADNLAVSAQGFKRGANRVRKQMWWKDLKMR 
Sbjct: 31 EIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRA 90

Query: 88 C 88
          C
Sbjct: 91 C 91

>KLLA0A03883g join(344642..344725,344850..345098) similar to
          sp|P33328 Saccharomyces cerevisiae YOR327c SNC2
          synaptobrevin (v-SNARE) homolog present on post-Golgi
          vesicles or sp|P31109 Saccharomyces cerevisiae YAL030w
          SNC1 synaptic vesicle-associated membrane protein,
          start by similarity
          Length = 110

 Score =  125 bits (313), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 59/61 (96%), Positives = 60/61 (98%)

Query: 28 EIDDTVGIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRL 87
          EIDDTV IMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANRVRKQMWWKDLKMR+
Sbjct: 29 EIDDTVDIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRM 88

Query: 88 C 88
          C
Sbjct: 89 C 89

>CAGL0G06358g complement(612827..613168) no similarity,
          hypothetical start
          Length = 113

 Score =  123 bits (309), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 56/61 (91%), Positives = 60/61 (98%)

Query: 28 EIDDTVGIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRL 87
          EIDDTVGIMRDNINKVAERGERLTSI+DKADNLA+SAQGFKRGANRVRKQMW+KDLKM+ 
Sbjct: 32 EIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANRVRKQMWYKDLKMKF 91

Query: 88 C 88
          C
Sbjct: 92 C 92

>YAL030W (SNC1) [38] chr1 (87289..87390,87504..87755)
          Synaptobrevin (v-SNARE) homolog present on post-Golgi
          vesicles [354 bp, 117 aa]
          Length = 117

 Score =  121 bits (303), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 56/61 (91%), Positives = 60/61 (98%)

Query: 28 EIDDTVGIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRL 87
          EIDDTVGIMRDNINKVAERGERLTSI+DKADNLAVSAQGFKRGANRVRK MW+KDLKM++
Sbjct: 35 EIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKAMWYKDLKMKM 94

Query: 88 C 88
          C
Sbjct: 95 C 95

>CAGL0E05258g complement(511027..511353) highly similar to
          sp|P33328 Saccharomyces cerevisiae YOR327c SNC2, start
          by similarity
          Length = 108

 Score =  112 bits (280), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 53/61 (86%), Positives = 58/61 (95%)

Query: 28 EIDDTVGIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRL 87
          EIDDTV IMR+NINKVAERGE LTSI DKADNLA+SAQGFKRGANRVR+QMW+KDLKMR+
Sbjct: 27 EIDDTVDIMRNNINKVAERGEMLTSIDDKADNLAMSAQGFKRGANRVRRQMWYKDLKMRM 86

Query: 88 C 88
          C
Sbjct: 87 C 87

>Kwal_26.7054
          Length = 74

 Score =  110 bits (275), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%)

Query: 36 MRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRLC 88
          MRDNINKVAERGERLTSI+DKADNLAVSAQGFKRGANRVRKQMWWKDLKMRLC
Sbjct: 1  MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRLC 53

>Kwal_56.23743
          Length = 162

 Score = 53.1 bits (126), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 39/58 (67%)

Query: 28  EIDDTVGIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANRVRKQMWWKDLKM 85
           ++ D + +M DNI+K  +R ER++ + D+   L  S+  FKR A R++ +MWW+++K+
Sbjct: 83  DLQDIIHLMNDNIDKFLQRQERVSLLVDRTSKLNQSSYNFKRKAVRIKTKMWWQNVKL 140

>YLR093C (NYV1) [3508] chr12
           complement(326514..327259,327401..327416) Synaptobrevin
           (v-SNARE) homolog involved in vacuolar vesicle fusion
           [762 bp, 253 aa]
          Length = 253

 Score = 51.2 bits (121), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 36/57 (63%)

Query: 28  EIDDTVGIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANRVRKQMWWKDLK 84
           +I D + IM DNI+K  ER ER++ + DK   L  S+  F+R A  +++ MWW+ +K
Sbjct: 174 QIKDVIQIMNDNIDKFLERQERVSLLVDKTSQLNSSSNKFRRKAVNIKEIMWWQKVK 230

>Scas_564.4*
          Length = 237

 Score = 50.8 bits (120), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 38/57 (66%)

Query: 28  EIDDTVGIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANRVRKQMWWKDLK 84
           ++ D V IM +NI+K  ER ER++ + DK   L  ++  FK+ A R++++MWW+ +K
Sbjct: 158 DLQDVVNIMNNNIDKFLERQERISLLVDKTSQLNDNSHNFKKKAVRIKERMWWQRMK 214

>CAGL0C00429g 43086..43790 similar to tr|Q12255 Saccharomyces
           cerevisiae YLR093c, hypothetical start
          Length = 234

 Score = 50.1 bits (118), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 40/57 (70%)

Query: 28  EIDDTVGIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANRVRKQMWWKDLK 84
           ++ + + IM DNI+K  ER ER++ + DK  +L  +++ FKR A +++++MWW+ +K
Sbjct: 155 DMQEVIQIMNDNIDKFLERQERVSLLVDKTSHLNSNSRSFKRKAIKLKERMWWRRMK 211

>AGR054C [4364] [Homologous to ScYLR093C (NYV1) - SH]
           (815110..815795,815928..815988) [747 bp, 248 aa]
          Length = 248

 Score = 50.1 bits (118), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 37/58 (63%)

Query: 28  EIDDTVGIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANRVRKQMWWKDLKM 85
           ++   V +M DNI+K  +R ER++ + D+   L  S+  F+R A R++++MWW ++K 
Sbjct: 170 DLQTIVSVMNDNIDKFLQRQERISLLVDQTSQLNQSSFNFQRKAVRIKRKMWWNNIKF 227

>KLLA0F19448g complement(1799571..1800266) similar to sgd|S0004083
           Saccharomyces cerevisiae YLR093c NYV1 v-SNARE, vacuolar,
           start by similarity
          Length = 231

 Score = 47.4 bits (111), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 38/58 (65%)

Query: 28  EIDDTVGIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANRVRKQMWWKDLKM 85
           E+ + + IM DNI+K  +R ER++ + D  + L  ++  F+R ++++ ++MWW ++K 
Sbjct: 153 ELQNIIAIMNDNIDKFLQRQERISLLVDNTNQLNENSFKFQRKSSKIMRKMWWNNVKF 210

>Kwal_47.17121
          Length = 200

 Score = 37.0 bits (84), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 31/47 (65%)

Query: 28  EIDDTVGIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANRV 74
           E+D+T  ++   I  V +RGERL ++ DK+++L+ S++ F + A + 
Sbjct: 147 ELDETKIVLHKTIESVLQRGERLDNLVDKSESLSASSRMFYKQAKKT 193

>AER109W [2614] [Homologous to ScYKL196C (YKT6) - SH]
           complement(841793..842395) [603 bp, 200 aa]
          Length = 200

 Score = 35.8 bits (81), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 31/47 (65%)

Query: 28  EIDDTVGIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANRV 74
           E+D+T  ++   I  V +RGE+L ++ DK+++L+ S++ F + A + 
Sbjct: 147 ELDETKIVLHKTIESVLQRGEKLDNLVDKSESLSASSRMFYKQAKKT 193

>Sklu_2258.7 YKL196C, Contig c2258 11983-12585 reverse complement
          Length = 200

 Score = 35.8 bits (81), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 31/47 (65%)

Query: 28  EIDDTVGIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANRV 74
           E+D+T  ++   I  V +RGE+L ++ DK+++L+ S++ F + A + 
Sbjct: 147 ELDETKIVLHKTIESVLQRGEKLDNLVDKSESLSASSRMFYKQAKKT 193

>Scas_571.1
          Length = 200

 Score = 35.4 bits (80), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 30/47 (63%)

Query: 28  EIDDTVGIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANRV 74
           E+D+T  ++   I  V +RGE+L ++ DK+++L  S++ F + A + 
Sbjct: 147 ELDETKIVLHKTIENVLQRGEKLDNLVDKSESLTASSKMFYKQAKKT 193

>CAGL0D03498g complement(357058..357675) highly similar to sp|P36015
           Saccharomyces cerevisiae YKL196c YKT6, start by
           similarity
          Length = 205

 Score = 35.4 bits (80), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 30/47 (63%)

Query: 28  EIDDTVGIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANRV 74
           E+D+T  ++   I  V +RGE+L ++ DK+++L  S++ F + A + 
Sbjct: 152 ELDETKIVLHKTIENVLQRGEKLDNLVDKSESLTASSKMFYKQAKKT 198

>YKL196C (YKT6) [3076] chr11 complement(74937..75539) Synaptobrevin
           (v-SNARE) homolog with similarity to Sec22p, Snc1p, and
           Snc2p, essential for endoplasmic reticulum-Golgi
           transport [603 bp, 200 aa]
          Length = 200

 Score = 35.4 bits (80), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 30/46 (65%)

Query: 28  EIDDTVGIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANR 73
           E+D+T  ++   I  V +RGE+L ++ DK+++L  S++ F + A +
Sbjct: 147 ELDETKIVLHKTIENVLQRGEKLDNLVDKSESLTASSKMFYKQAKK 192

>KLLA0D02684g complement(228564..229166) highly similar to sp|P36015
           Saccharomyces cerevisiae YKL196c YKT6 SNARE protein for
           Endoplasmic Reticulum-Golgi transport singleton, start
           by similarity
          Length = 200

 Score = 32.7 bits (73), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 30/46 (65%)

Query: 28  EIDDTVGIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANR 73
           E+D+T   +   I  V +RGE+L ++ DK+++L+ +++ F + A +
Sbjct: 147 ELDETKITLHKTIENVLQRGEKLDNLVDKSESLSAASRMFYKQAKK 192

>CAGL0L06908g complement(777557..778876) highly similar to sp|Q07478
           Saccharomyces cerevisiae YDL084w SUB2, start by
           similarity
          Length = 439

 Score = 25.8 bits (55), Expect = 7.5,   Method: Composition-based stats.
 Identities = 11/47 (23%), Positives = 23/47 (48%)

Query: 42  KVAERGERLTSIQDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRLC 88
           K   R   LT + + ++  A++  G  +   R+ +   +KD + R+C
Sbjct: 307 KSTSRANELTKLLNASNFPAITVHGHMKQEERIARYKAFKDFEKRIC 353

>Scas_623.5
          Length = 446

 Score = 25.8 bits (55), Expect = 7.6,   Method: Composition-based stats.
 Identities = 11/47 (23%), Positives = 23/47 (48%)

Query: 42  KVAERGERLTSIQDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRLC 88
           K   R   LT + + ++  A++  G  +   R+ +   +KD + R+C
Sbjct: 314 KSTNRANELTKLLNDSNFPAITVHGHMKQEERIARYKAFKDFEKRIC 360

>YDL084W (SUB2) [784] chr4 (305237..306577) Essential pre-mRNA
           splicing factor, required for nuclear export of mRNA and
           for expression of lacZ fusions in yeast, involved in
           silencing at telomeres and ribosomal DNA, member of the
           DexD/H box family of RNA-dependent ATPases [1341 bp, 446
           aa]
          Length = 446

 Score = 25.8 bits (55), Expect = 8.8,   Method: Composition-based stats.
 Identities = 11/47 (23%), Positives = 23/47 (48%)

Query: 42  KVAERGERLTSIQDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRLC 88
           K   R   LT + + ++  A++  G  +   R+ +   +KD + R+C
Sbjct: 314 KSTTRANELTKLLNASNFPAITVHGHMKQEERIARYKAFKDFEKRIC 360

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.133    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 1,764,419
Number of extensions: 48333
Number of successful extensions: 160
Number of sequences better than 10.0: 24
Number of HSP's gapped: 160
Number of HSP's successfully gapped: 24
Length of query: 107
Length of database: 16,596,109
Length adjustment: 77
Effective length of query: 30
Effective length of database: 13,930,523
Effective search space: 417915690
Effective search space used: 417915690
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)