Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADR354W1558152981100.0
Kwal_26.70551555153359460.0
KLLA0A03905g1550153655100.0
Sklu_2164.51350135154140.0
CAGL0F00671g1566154653590.0
YOR326W (MYO2)1574155553190.0
Scas_663.261567155851690.0
YAL029C (MYO4)1471149934750.0
Scas_592.13*1419149234360.0
CAGL0G06336g141898328010.0
Scas_688.22187675213441e-156
Kwal_23.55341907109213331e-155
ACR068W180584313261e-154
YHR023W (MYO1)192884513131e-152
KLLA0E11572g1848117812691e-146
CAGL0J00693g1884117511871e-135
KLLA0B12562g126075011351e-132
YMR109W (MYO5)121975211131e-129
Kwal_26.7587125076111091e-128
CAGL0K07590g125281911061e-128
Scas_721.119123273210961e-127
CAGL0K03487g121775210721e-123
AEL306C129274210751e-123
YKL129C (MYO3)127175510681e-122
CAGL0J08657g557139840.14
ABR111C78972790.56
CAGL0D05258g1170251790.58
KLLA0E15598g905161790.60
Kwal_33.14659167891771.0
KLLA0E19030g821138751.6
CAGL0D02750g12441692.4
CAGL0G01760g855132742.5
CAGL0H09174g103131714.9
KLLA0E05225g1755170715.4
Kwal_23.4010874140705.8
Scas_610.171305188715.8
CAGL0M01496g951129706.6
CAGL0C00583g390174697.4
AGL106C456103698.0
ADL307W1072162699.2
Scas_532.1*48755689.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADR354W
         (1529 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADR354W [2095] [Homologous to ScYOR326W (MYO2) - SH; ScYAL029C (...  3128   0.0  
Kwal_26.7055                                                         2295   0.0  
KLLA0A03905g complement(345818..350470) similar to sp|P19524 Sac...  2127   0.0  
Sklu_2164.5 YOR326W, Contig c2164 5497-9549                          2090   0.0  
CAGL0F00671g complement(73893..78593) highly similar to sp|P1952...  2068   0.0  
YOR326W (MYO2) [5107] chr15 (925716..930440) Myosin heavy chain,...  2053   0.0  
Scas_663.26                                                          1995   0.0  
YAL029C (MYO4) [39] chr1 complement(87858..92273) Myosin heavy c...  1343   0.0  
Scas_592.13*                                                         1328   0.0  
CAGL0G06336g 607817..612073 similar to sp|P32492 Saccharomyces c...  1083   0.0  
Scas_688.22                                                           522   e-156
Kwal_23.5534                                                          518   e-155
ACR068W [1115] [Homologous to ScYHR023W (MYO1) - SH] complement(...   515   e-154
YHR023W (MYO1) [2310] chr8 (151658..157444) Myosin heavy chain (...   510   e-152
KLLA0E11572g complement(1018972..1024518) similar to sp|P08964 S...   493   e-146
CAGL0J00693g complement(61246..66900) similar to sp|P08964 Sacch...   461   e-135
KLLA0B12562g complement(1095953..1099735) similar to sp|Q04439 S...   441   e-132
YMR109W (MYO5) [4066] chr13 (486586..490245) Myosin type I, may ...   433   e-129
Kwal_26.7587                                                          431   e-128
CAGL0K07590g 748352..752110 highly similar to sp|P36006 Saccharo...   430   e-128
Scas_721.119                                                          426   e-127
CAGL0K03487g 322030..325683 highly similar to sp|Q04439 Saccharo...   417   e-123
AEL306C [2199] [Homologous to ScYMR109W (MYO5) - SH; ScYKL129C (...   418   e-123
YKL129C (MYO3) [3137] chr11 complement(196350..200165) Myosin ty...   416   e-122
CAGL0J08657g complement(855068..856741) similar to tr|Q12511 Sac...    37   0.14 
ABR111C [703] [Homologous to ScYPR090W - SH; ScYPR089W - SH] (59...    35   0.56 
CAGL0D05258g 500858..504370 similar to sp|P38989 Saccharomyces c...    35   0.58 
KLLA0E15598g 1388626..1391343 weakly similar to sp|P38853 Saccha...    35   0.60 
Kwal_33.14659                                                          34   1.0  
KLLA0E19030g 1684751..1687216 weakly similar to sp|P53148 Saccha...    33   1.6  
CAGL0D02750g 288647..289021 no similarity, hypothetical start          31   2.4  
CAGL0G01760g 158546..161113 similar to sp|Q06096 Saccharomyces c...    33   2.5  
CAGL0H09174g complement(898883..901978) some similarities with s...    32   4.9  
KLLA0E05225g 467253..472520 similar to sp|P25386 Saccharomyces c...    32   5.4  
Kwal_23.4010                                                           32   5.8  
Scas_610.17                                                            32   5.8  
CAGL0M01496g complement(171045..173900) similar to tr|Q04175 Sac...    32   6.6  
CAGL0C00583g 62224..63396 weakly similar to sp|P38272 Saccharomy...    31   7.4  
AGL106C [4206] [Homologous to ScYLR238W - SH; ScYDR200C - SH] (5...    31   8.0  
ADL307W [1434] [Homologous to ScYPR049C (CVT9) - SH] complement(...    31   9.2  
Scas_532.1*                                                            31   9.8  

>ADR354W [2095] [Homologous to ScYOR326W (MYO2) - SH; ScYAL029C (MYO4)
            - SH] complement(1328357..1333033) [4677 bp, 1558 aa]
          Length = 1558

 Score = 3128 bits (8110), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1517/1529 (99%), Positives = 1517/1529 (99%)

Query: 1    MSYEVGTRCWYPDKEQGWIGGEITKHRLVGDKYQLDLTLENGEVVEITAPSVEEGSCEEL 60
            MSYEVGTRCWYPDKEQGWIGGEITKHRLVGDKYQLDLTLENGEVVEITAPSVEEGSCEEL
Sbjct: 1    MSYEVGTRCWYPDKEQGWIGGEITKHRLVGDKYQLDLTLENGEVVEITAPSVEEGSCEEL 60

Query: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLY 120
            PLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLY
Sbjct: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLY 120

Query: 121  SQDMIQAYAGRRRGELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAGKTVSAKYIMRY 180
            SQDMIQAYAGRRRGELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAGKTVSAKYIMRY
Sbjct: 121  SQDMIQAYAGRRRGELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAGKTVSAKYIMRY 180

Query: 181  FATVEQSNLVGSGGSMHHIEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 240
            FATVEQSNLVGSGGSMHHIEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF
Sbjct: 181  FATVEQSNLVGSGGSMHHIEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 240

Query: 241  DKDISIIGARIRTYLLERSRLVFQPPSERNYHIFYQLLAGLPEETKKELKLGGVEEYHYM 300
            DKDISIIGARIRTYLLERSRLVFQPPSERNYHIFYQLLAGLPEETKKELKLGGVEEYHYM
Sbjct: 241  DKDISIIGARIRTYLLERSRLVFQPPSERNYHIFYQLLAGLPEETKKELKLGGVEEYHYM 300

Query: 301  NQGGASEIQGVDDREEYAITTKALSLVDITERTQTALFKVLAALLHIGNIDVKKTRNDAS 360
            NQGGASEIQGVDDREEYAITTKALSLVDITERTQTALFKVLAALLHIGNIDVKKTRNDAS
Sbjct: 301  NQGGASEIQGVDDREEYAITTKALSLVDITERTQTALFKVLAALLHIGNIDVKKTRNDAS 360

Query: 361  VSATDPSLEIACELLGIDAYNFAKWITKKQITTRSEKIVSNLNYGQAVVARDSVAKFIYS 420
            VSATDPSLEIACELLGIDAYNFAKWITKKQITTRSEKIVSNLNYGQAVVARDSVAKFIYS
Sbjct: 361  VSATDPSLEIACELLGIDAYNFAKWITKKQITTRSEKIVSNLNYGQAVVARDSVAKFIYS 420

Query: 421  ALFDWLVENINNVLCNPAVINEIASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480
            ALFDWLVENINNVLCNPAVINEIASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN
Sbjct: 421  ALFDWLVENINNVLCNPAVINEIASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480

Query: 481  QHVFKLEQEEYVKEEIQWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETWTQK 540
            QHVFKLEQEEYVKEEIQWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETWTQK
Sbjct: 481  QHVFKLEQEEYVKEEIQWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETWTQK 540

Query: 541  LYQTLDKPPTNTVFSKPRFGQTKFVVSHYAHDVAYDVEGFIEKNRDTVSDGHLEVLKGST 600
            LYQTLDKPPTNTVFSKPRFGQTKFVVSHYAHDVAYDVEGFIEKNRDTVSDGHLEVLKGST
Sbjct: 541  LYQTLDKPPTNTVFSKPRFGQTKFVVSHYAHDVAYDVEGFIEKNRDTVSDGHLEVLKGST 600

Query: 601  NETLLAILETIDRNAAKLAEKLESQKKPGPTTRTVNRKPTLGSLFKQSLVELMSTINSTN 660
            NETLLAILETIDRNAAKLAEKLESQKKPGPTTRTVNRKPTLGSLFKQSLVELMSTINSTN
Sbjct: 601  NETLLAILETIDRNAAKLAEKLESQKKPGPTTRTVNRKPTLGSLFKQSLVELMSTINSTN 660

Query: 661  VHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPTRWTYDEFALRYHILV 720
            VHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPTRWTYDEFALRYHILV
Sbjct: 661  VHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPTRWTYDEFALRYHILV 720

Query: 721  PSTNWTKIFATGTTEEEINQLCKNILDTTVTDKEKYQLGNTKIFFKAGMLAFLEKKRTDK 780
            PSTNWTKIFATGTTEEEINQLCKNILDTTVTDKEKYQLGNTKIFFKAGMLAFLEKKRTDK
Sbjct: 721  PSTNWTKIFATGTTEEEINQLCKNILDTTVTDKEKYQLGNTKIFFKAGMLAFLEKKRTDK 780

Query: 781  LNSSSTMIQKKIKGIYYRRRYLEITNAIKRTHSVAKGNLLRARIDLEFKTWAAITIQSLY 840
            LNSSSTMIQKKIKGIYYRRRYLEITNAIKRTHSVAKGNLLRARIDLEFKTWAAITIQSLY
Sbjct: 781  LNSSSTMIQKKIKGIYYRRRYLEITNAIKRTHSVAKGNLLRARIDLEFKTWAAITIQSLY 840

Query: 841  RGSLIRRDTIHLLDSIIRTQSLLRRSLARKELRARLETDAAITIQKNIRAFKPRTSYITN 900
            RGSLIRRDTIHLLDSIIRTQSLLRRSLARKELRARLETDAAITIQKNIRAFKPRTSYITN
Sbjct: 841  RGSLIRRDTIHLLDSIIRTQSLLRRSLARKELRARLETDAAITIQKNIRAFKPRTSYITN 900

Query: 901  RRSTIVVQSLVRRRFAKRKLETLKQEAKSVSHLKEVSYKLENKVIELTESLAAKVKENKD 960
            RRSTIVVQSLVRRRFAKRKLETLKQEAKSVSHLKEVSYKLENKVIELTESLAAKVKENKD
Sbjct: 901  RRSTIVVQSLVRRRFAKRKLETLKQEAKSVSHLKEVSYKLENKVIELTESLAAKVKENKD 960

Query: 961  LNSRIKELQLSLNESANIRELLKTKQEEYRKSIDQQKDTHAAAYEEVTGRLTLAMKEVDD 1020
            LNSRIKELQLSLNESANIRELLKTKQEEYRKSIDQQKDTHAAAYEEVTGRLTLAMKEVDD
Sbjct: 961  LNSRIKELQLSLNESANIRELLKTKQEEYRKSIDQQKDTHAAAYEEVTGRLTLAMKEVDD 1020

Query: 1021 ARQEIDQLKSKQEDLKLEVKAKIEELSKVRQDLSDSRTQNSDLSNEVSSLKEEIARLHNA 1080
            ARQEIDQLKSKQEDLKLEVKAKIEELSKVRQDLSDSRTQNSDLSNEVSSLKEEIARLHNA
Sbjct: 1021 ARQEIDQLKSKQEDLKLEVKAKIEELSKVRQDLSDSRTQNSDLSNEVSSLKEEIARLHNA 1080

Query: 1081 IRNAPATGTLSPTRSKRISSYSGLDNIGSPKQWNVVSLNNGLMEEETRSIMSQLSQINDE 1140
            IRNAPATGTLSPTRSKRISSYSGLDNIGSPKQWNVVSLNNGLMEEETRSIMSQLSQINDE
Sbjct: 1081 IRNAPATGTLSPTRSKRISSYSGLDNIGSPKQWNVVSLNNGLMEEETRSIMSQLSQINDE 1140

Query: 1141 LYKLLNDDRPLTSEIVEGLLKSGKIPQPGFAANLTRKEVLYPARVLIIILSDMWRLGLTE 1200
            LYKLLNDDRPLTSEIVEGLLKSGKIPQPGFAANLTRKEVLYPARVLIIILSDMWRLGLTE
Sbjct: 1141 LYKLLNDDRPLTSEIVEGLLKSGKIPQPGFAANLTRKEVLYPARVLIIILSDMWRLGLTE 1200

Query: 1201 QSERFLAEVLSTIQTLVTNLKGDNVIINGAFWLTNVRELYSFAIYAHDSILNDNAYIKDL 1260
            QSERFLAEVLSTIQTLVTNLKGDNVIINGAFWLTNVRELYSFAIYAHDSILNDNAYIKDL
Sbjct: 1201 QSERFLAEVLSTIQTLVTNLKGDNVIINGAFWLTNVRELYSFAIYAHDSILNDNAYIKDL 1260

Query: 1261 NEDEYKQYVTLVSVLKDDFESLSYNIYNIWLKKLQKELEKRAVSAVVMSQSLPGFIVPES 1320
            NEDEYKQYVTLVSVLKDDFESLSYNIYNIWLKKLQKELEKRAVSAVVMSQSLPGFIVPES
Sbjct: 1261 NEDEYKQYVTLVSVLKDDFESLSYNIYNIWLKKLQKELEKRAVSAVVMSQSLPGFIVPES 1320

Query: 1321 SAFLPKIFSSSSSYKMDDILTFFNTIYWSMKAYHVETEVYREVIMSLLRYVDAICFNDLI 1380
            SAFLPKIFSSSSSYKMDDILTFFNTIYWSMKAYHVETEVYREVIMSLLRYVDAICFNDLI
Sbjct: 1321 SAFLPKIFSSSSSYKMDDILTFFNTIYWSMKAYHVETEVYREVIMSLLRYVDAICFNDLI 1380

Query: 1381 MKRNFLSWKRGLQLNYNVTRLEEWCKVHHIPEGSDCLEHMXXXXXXXXXXXXNMEDINII 1440
            MKRNFLSWKRGLQLNYNVTRLEEWCKVHHIPEGSDCLEHM            NMEDINII
Sbjct: 1381 MKRNFLSWKRGLQLNYNVTRLEEWCKVHHIPEGSDCLEHMLQASKLLQLKKANMEDINII 1440

Query: 1441 WEICSSLKPAQIQKLISQYSAADYEVPIPQEILSFVADRVKKESALSNDGKSASHSSDIF 1500
            WEICSSLKPAQIQKLISQYSAADYEVPIPQEILSFVADRVKKESALSNDGKSASHSSDIF
Sbjct: 1441 WEICSSLKPAQIQKLISQYSAADYEVPIPQEILSFVADRVKKESALSNDGKSASHSSDIF 1500

Query: 1501 LPVATGSFADPFSQIEPREINKIEAHIPA 1529
            LPVATGSFADPFSQIEPREINKIEAHIPA
Sbjct: 1501 LPVATGSFADPFSQIEPREINKIEAHIPA 1529

>Kwal_26.7055
          Length = 1555

 Score = 2295 bits (5946), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1097/1533 (71%), Positives = 1296/1533 (84%), Gaps = 9/1533 (0%)

Query: 1    MSYEVGTRCWYPDKEQGWIGGEITKHRLVGD-KYQLDLTLENGEVVEITAPSVEEGSCEE 59
            MS+EVGTRCWYPDK++GW+G E+TK     + K+ L+L LENGE VEI   ++ E   E+
Sbjct: 1    MSFEVGTRCWYPDKKEGWVGSEVTKFSQPEEGKFLLELKLENGETVEIETETLNESQNEK 60

Query: 60   LPLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQL 119
            LPLLRNPPILEA EDLTSLSYLNEPAVLHAIKARY QLNIYTYSGIVLIATNPFDRV+QL
Sbjct: 61   LPLLRNPPILEAIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYSGIVLIATNPFDRVEQL 120

Query: 120  YSQDMIQAYAGRRRGELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAGKTVSAKYIMR 179
            YSQDMIQAYAGRRRGELEPHLFAIA+EAY LMK+ KQNQTIVVSGESGAGKTVSAKYIMR
Sbjct: 121  YSQDMIQAYAGRRRGELEPHLFAIADEAYRLMKHDKQNQTIVVSGESGAGKTVSAKYIMR 180

Query: 180  YFATVEQSNLVGSGGSMHHIEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEIL 239
            YFA+VEQ+N   +  S HH++MSETE++ILATNPIMEAFGNAKT+RNDNSSRFGKYLEIL
Sbjct: 181  YFASVEQAN-ADNASSDHHLQMSETEERILATNPIMEAFGNAKTSRNDNSSRFGKYLEIL 239

Query: 240  FDKDISIIGARIRTYLLERSRLVFQPPSERNYHIFYQLLAGLPEETKKELKLGGVEEYHY 299
            FD+  SIIGARIRTYLLERSRLVFQP  ERNYHIFYQL+ GL E  K+EL L  VE+YHY
Sbjct: 240  FDESTSIIGARIRTYLLERSRLVFQPQVERNYHIFYQLVEGLSESEKEELHLTKVEDYHY 299

Query: 300  MNQGGASEIQGVDDREEYAITTKALSLVDITERTQTALFKVLAALLHIGNIDVKKTRNDA 359
            + QGG   I+GVDD  EY +T  AL +V  ++ TQ  LFK+LAALLHIGNI+VKKTRNDA
Sbjct: 300  LRQGGDYRIKGVDDAAEYQVTVDALKMVGFSQDTQHQLFKILAALLHIGNIEVKKTRNDA 359

Query: 360  SVSATDPSLEIACELLGIDAYNFAKWITKKQITTRSEKIVSNLNYGQAVVARDSVAKFIY 419
            S+S+ +P+L+IAC+LLGIDA  F+KWITKKQITTRSEKIVSNL++ QA+VARDSVAKFI+
Sbjct: 360  SLSSDEPNLKIACDLLGIDASGFSKWITKKQITTRSEKIVSNLSFNQALVARDSVAKFIF 419

Query: 420  SALFDWLVENINNVLCNPAVINEIASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEF 479
            SALFDWLVENIN VLCNP V ++I+SFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEF
Sbjct: 420  SALFDWLVENINTVLCNPQVSDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEF 479

Query: 480  NQHVFKLEQEEYVKEEIQWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETWTQ 539
            NQHVFKLEQEEYV E+I+WSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDE+WTQ
Sbjct: 480  NQHVFKLEQEEYVNEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQ 539

Query: 540  KLYQTLDKPPTNTVFSKPRFGQTKFVVSHYAHDVAYDVEGFIEKNRDTVSDGHLEVLKGS 599
            KLYQTLDKPPTN+VFSKPRFGQTKFVVSHYA DVAYDV GFIEKNRDTVSDGHLEVLK S
Sbjct: 540  KLYQTLDKPPTNSVFSKPRFGQTKFVVSHYALDVAYDVGGFIEKNRDTVSDGHLEVLKAS 599

Query: 600  TNETLLAILETIDRNAAKLAEKLESQKKPGPTTRTVNRKPTLGSLFKQSLVELMSTINST 659
             N+TLL+IL+TID+NAA LAEK ++ KKPGP  R V +KPTLGS+FKQSL+ELM+TI+ST
Sbjct: 600  KNDTLLSILDTIDKNAAALAEKQDANKKPGP-ARMV-KKPTLGSMFKQSLIELMNTIDST 657

Query: 660  NVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPTRWTYDEFALRYHIL 719
            NVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFP+RWTY+EF LRYHIL
Sbjct: 658  NVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHIL 717

Query: 720  VPSTNWTKIFATGTTEEEINQLCKNILDTTVTDKEKYQLGNTKIFFKAGMLAFLEKKRTD 779
            +PS NWTKIF +  +E++I  LCK IL  TV D  KYQLGNTKIFFKAGMLA+LEK R+ 
Sbjct: 718  IPSDNWTKIFTSEASEDDIRNLCKQILGATVDDSNKYQLGNTKIFFKAGMLAYLEKLRST 777

Query: 780  KLNSSSTMIQKKIKGIYYRRRYLEITNAIKRTHSVAKGNLLRARIDLEFKTWAAITIQSL 839
            K+++S  +IQKKIKG+YYR++YL I NAI    +V  GN  R  +D EFKT AAI++Q++
Sbjct: 778  KMHNSCVLIQKKIKGVYYRKQYLAIKNAIHNVQAVIAGNYCRQSVDHEFKTLAAISLQTI 837

Query: 840  YRGSLIRRDTIHLLDSIIRTQSLLRRSLARKELRARLETDAAITIQKNIRAFKPRTSYIT 899
            +RG   R++    L SI+R QSL+R+ +A+KE+  + +++AA+TIQK IR F PR SY  
Sbjct: 838  FRGVRQRKNATIALASIVRVQSLVRKQIAQKEVLEKRQSEAAVTIQKKIRGFVPRQSYNA 897

Query: 900  NRRSTIVVQSLVRRRFAKRKLETLKQEAKSVSHLKEVSYKLENKVIELTESLAAKVKENK 959
             R S++ +QSLVRR+ A+++L+ LK +AKSV+HL+EVSYKLENKVI+LT+SLA KVKEN+
Sbjct: 898  TRGSSVKIQSLVRRKLAQKQLKQLKADAKSVNHLQEVSYKLENKVIQLTQSLAEKVKENR 957

Query: 960  DLNSRIKELQLSLNESANIRELLKTKQEEYRKSIDQQKDTHAAAYEEVTGRLTLAMKEVD 1019
            D+ ++I++LQ SLNESANI+ LL  +++++ + + +QK +H A        L  A  EV+
Sbjct: 958  DMTAKIQDLQKSLNESANIKSLLDAQKDDHSRDLQEQKTSHDAELANKKIELDNAKAEVE 1017

Query: 1020 DARQEIDQLKSKQEDLKLEVKAKIEELSKVRQDLSDSRTQNSDLSNEVSSLKEEIARLHN 1079
             A++EI+ L S+QE LK +V+AK+EEL+ V+Q+  DSRTQNSDL NEV SLK+EI RL  
Sbjct: 1018 AAKKEIEDLLSQQEQLKADVRAKVEELNNVQQEFEDSRTQNSDLRNEVKSLKDEINRLQT 1077

Query: 1080 AIRNAPATGTL---SPTRSKRISSYSGLDNIGSPKQWNVVSLNNGLMEEETRSIMSQLSQ 1136
            +IR+   + T+   +PT+S+R S++S L +  SP+Q NV+S+NNG ME++ RS  S LSQ
Sbjct: 1078 SIRSGANSNTILAHTPTKSRRFSAHSSLTD-ASPRQLNVISMNNG-MEDDARSTASALSQ 1135

Query: 1137 INDELYKLLNDDRPLTSEIVEGLLKSGKIPQPGFAANLTRKEVLYPARVLIIILSDMWRL 1196
            INDELYK+L D + L  EIVEGLLK  KIP+ G AA LTRKEVLYPAR++II+LSDMWRL
Sbjct: 1136 INDELYKILEDTKSLNIEIVEGLLKGFKIPETGVAAELTRKEVLYPARIMIIVLSDMWRL 1195

Query: 1197 GLTEQSERFLAEVLSTIQTLVTNLKGDNVIINGAFWLTNVRELYSFAIYAHDSILNDNAY 1256
            GLT+QSE FLAE +STIQ LV+ LKGD++I +GAFWLTNVRELYSF ++A +SILND++Y
Sbjct: 1196 GLTKQSESFLAEAMSTIQKLVSGLKGDDMICHGAFWLTNVRELYSFVVFAQESILNDDSY 1255

Query: 1257 IKDLNEDEYKQYVTLVSVLKDDFESLSYNIYNIWLKKLQKELEKRAVSAVVMSQSLPGFI 1316
               LNEDEYK+Y+TLV+ LKDDFESLSYNIYNIWLKKLQK+LEK+AVSAVVMSQSLPGFI
Sbjct: 1256 NSGLNEDEYKEYMTLVTELKDDFESLSYNIYNIWLKKLQKDLEKKAVSAVVMSQSLPGFI 1315

Query: 1317 VPESSAFLPKIFSSSSSYKMDDILTFFNTIYWSMKAYHVETEVYREVIMSLLRYVDAICF 1376
              ESS FLPK+FS S+ YKMDDILTFFN IYWSMK YHVE EV+REVI++LLRYVD+ICF
Sbjct: 1316 ANESSQFLPKLFSQSNYYKMDDILTFFNNIYWSMKTYHVEQEVFREVIITLLRYVDSICF 1375

Query: 1377 NDLIMKRNFLSWKRGLQLNYNVTRLEEWCKVHHIPEGSDCLEHMXXXXXXXXXXXXNMED 1436
            NDLIM+RNFLSWKRGLQLNYNVTRLEEWCK HHIPEG+DCL+HM            N++D
Sbjct: 1376 NDLIMRRNFLSWKRGLQLNYNVTRLEEWCKSHHIPEGTDCLQHMLQASKLLQLKKANLDD 1435

Query: 1437 INIIWEICSSLKPAQIQKLISQYSAADYEVPIPQEILSFVADRVKKESALSNDGKSASHS 1496
            I+IIWEICSSLKPAQIQKLI+QY+ ADYEVPIPQEIL+FVA+RVK ES+LS++GKS +HS
Sbjct: 1436 IDIIWEICSSLKPAQIQKLITQYAVADYEVPIPQEILTFVANRVKSESSLSSNGKSQTHS 1495

Query: 1497 SDIFLPVATGSFADPFSQIEPREINKIEAHIPA 1529
             DIFLPV  G F DPF+ IE R   KIEA+IPA
Sbjct: 1496 IDIFLPVENGPFKDPFNLIETRRFGKIEAYIPA 1528

>KLLA0A03905g complement(345818..350470) similar to sp|P19524
            Saccharomyces cerevisiae YOR326w MYO2 myosin heavy chain,
            start by similarity
          Length = 1550

 Score = 2127 bits (5510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1025/1536 (66%), Positives = 1247/1536 (81%), Gaps = 18/1536 (1%)

Query: 1    MSYEVGTRCWYPDKEQGWIGGEITKHRLVGDKYQLDLTLENGEVVEITAPSVEEGSCEEL 60
            M YEVGTRCWYP K+QGWIG E+TKH L GD Y L+LTLE+G+ VE+   S++E     L
Sbjct: 1    MPYEVGTRCWYPSKDQGWIGAEVTKHTLQGDSYNLELTLEDGQKVELLVSSLDETKEPSL 60

Query: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLY 120
            PLLRNPPILE TEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLY
Sbjct: 61   PLLRNPPILETTEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLY 120

Query: 121  SQDMIQAYAGRRRGELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAGKTVSAKYIMRY 180
            SQ+MIQAYAG+ RGELEPHLFAIAEEAY LMK + QNQTI+VSGESGAGKTVSAKYIMRY
Sbjct: 121  SQEMIQAYAGKLRGELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGAGKTVSAKYIMRY 180

Query: 181  FATVEQSNLVGSGGSMHHIEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 240
            FA+VE++N      + H++EMSETEKKILATNPIMEAFGNAKT RNDNSSRFGKYLEILF
Sbjct: 181  FASVEENN---EENAHHNLEMSETEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLEILF 237

Query: 241  DKDISIIGARIRTYLLERSRLVFQPPSERNYHIFYQLLAGLPEETKKELKLGGVEEYHYM 300
            D D SIIGAR+RTYLLERSRLVFQP +ERNYHIFYQ+L+GL ++ K +LKL  +++YHYM
Sbjct: 238  DDDTSIIGARVRTYLLERSRLVFQPKTERNYHIFYQILSGLSDDEKSQLKLTDIQDYHYM 297

Query: 301  NQGGASEIQGVDDREEYAITTKALSLVDITERTQTALFKVLAALLHIGNIDVKKTRNDAS 360
            NQGG S I+GVDD  EY  T +ALSLV I++ TQ  LFK+LAALLHIGNI+VKK RNDAS
Sbjct: 298  NQGGDSHIEGVDDASEYGDTVEALSLVGISKDTQFQLFKILAALLHIGNIEVKKVRNDAS 357

Query: 361  VSATDPSLEIACELLGIDAYNFAKWITKKQITTRSEKIVSNLNYGQAVVARDSVAKFIYS 420
            +S+ +P+L+IA +LLGIDA++FAKW+TKKQI TRSEKIVS+L Y QA+V+RDSVAKFIYS
Sbjct: 358  LSSDEPNLQIAADLLGIDAFDFAKWVTKKQIVTRSEKIVSSLPYHQAIVSRDSVAKFIYS 417

Query: 421  ALFDWLVENINNVLCNPAVINEIASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480
            ALFDWLV+NIN VLCNP V++EI +FIGVLDIYGFEHF+KNSFEQFCINYANEKLQQEFN
Sbjct: 418  ALFDWLVDNINTVLCNPEVVSEIYTFIGVLDIYGFEHFQKNSFEQFCINYANEKLQQEFN 477

Query: 481  QHVFKLEQEEYVKEEIQWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETWTQK 540
            QHVFKLEQEEYVKE+I+WSFIEFNDNQPCIDLIENK+GILSLLDEESRLPAG+DE WT K
Sbjct: 478  QHVFKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKVGILSLLDEESRLPAGTDEGWTHK 537

Query: 541  LYQTLDKPPTNTVFSKPRFGQTKFVVSHYAHDVAYDVEGFIEKNRDTVSDGHLEVLKGST 600
            LY+TL+KPPTN VFSKPRFGQT+F+VSHYA DV YDV+GFIEKNRDTVSDGHLEVLK S 
Sbjct: 538  LYETLNKPPTNEVFSKPRFGQTQFIVSHYALDVTYDVDGFIEKNRDTVSDGHLEVLKASN 597

Query: 601  NETLLAILETIDRNAAKLAE----KLESQKKPGPTTRTVNRKPTLGSLFKQSLVELMSTI 656
            NETLL+ILET+D+NA KLAE    K ESQKKPGP +R + RKPTLGS+FKQSL++LM TI
Sbjct: 598  NETLLSILETVDKNAEKLAEKQAQKQESQKKPGPASRKIVRKPTLGSMFKQSLIDLMETI 657

Query: 657  NSTNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPTRWTYDEFALRY 716
            NSTNVHYIRCIKPNE+KEAWKFDNLMVLSQLRACGVLETIRISCAGFP+RWTY EFALRY
Sbjct: 658  NSTNVHYIRCIKPNEDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYTEFALRY 717

Query: 717  HILVPSTNWTKIFATGTTEEEINQLCKNILDTTVTDKEKYQLGNTKIFFKAGMLAFLEKK 776
            HILVPS  W+ I  +  +EE++  LCK IL  T+ D  KYQ GNTKIFFKAGMLA LEK 
Sbjct: 718  HILVPSELWSNILLSDPSEEDVKNLCKEILKRTMDDTAKYQAGNTKIFFKAGMLAHLEKL 777

Query: 777  RTDKLNSSSTMIQKKIKGIYYRRRYLEITNAIKRTHSVAKGNLLRARIDLEFKTWAAITI 836
            RTDKL SSS MIQKKIKG++YR+ YL   +AIKR  +   G ++R R + EFK  AA+ I
Sbjct: 778  RTDKLFSSSVMIQKKIKGLHYRKTYLRTVDAIKRLQANVSGKIIRLRTENEFKNNAALLI 837

Query: 837  QSLYRGSLIRRDTIHLLDSIIRTQSLLRRSLARKELRARLETDAAITIQKNIRAFKPRTS 896
            QS YRG  +R +   ++ SIIR QS+ R+ +  KEL  R   DAA+TIQK++R+F+PR S
Sbjct: 838  QSAYRGISVRDNVSSIIISIIRIQSMARKQITCKELLERRRGDAAVTIQKSVRSFQPRKS 897

Query: 897  YITNRRSTIVVQSLVRRRFAKRKLETLKQEAKSVSHLKEVSYKLENKVIELTESLAAKVK 956
            ++  ++ T+V+QS +R+ +A+RKL+ LK EAKSV+HL+EVSYKLENKVIELTESLA+KVK
Sbjct: 898  FLHEKKGTVVIQSFIRKHYAQRKLKQLKSEAKSVNHLQEVSYKLENKVIELTESLASKVK 957

Query: 957  ENKDLNSRIKELQLSLNESANIRELLKTKQEEYRKSIDQQKDTHAAAYEEVTGRLTLAMK 1016
            ENK+L SR++ LQ SLNES NI+  L+ ++E + K++  QK  H   Y +V  +L  A +
Sbjct: 958  ENKELVSRLENLQKSLNESENIKSSLEEEKEGHTKALADQKSIHEEEYGKVNDQLIAAKE 1017

Query: 1017 EVDDARQEIDQLKSKQEDLKLEVKAKIEELSKVRQDLSDSRTQNSDLSNEVSSLKEEIAR 1076
            E+  A+ E+D+L +KQ++LK E+ + +EEL+  R +L  S+++N+DL  EV SLKEE+AR
Sbjct: 1018 EIISAKAEVDELLNKQKNLKDEIASTLEELTSARDELLTSQSENADLKKEVFSLKEEVAR 1077

Query: 1077 LHNAIRNAPATG---TLSPTRSKRISSYSGLDNIGSPKQWNVVSLNNGLMEEETRSIMSQ 1133
            L +++R+    G     +P +++R S+ S L++  SPKQ NVVS+NN    E+  ++M  
Sbjct: 1078 LQSSMRSGVYVGGGINATPVKNRRFSANSTLNDGSSPKQLNVVSINNNFNTEDVSALM-- 1135

Query: 1134 LSQINDELYKLLNDDRPLTSEIVEGLLKSGKIPQPGFAANLTRKEVLYPARVLIIILSDM 1193
             SQINDELYK+  D R L +EI+EGLLK GK+P  G + NLTRKEVLYP+RVLIIILSDM
Sbjct: 1136 -SQINDELYKMFEDSRSLNTEIIEGLLKGGKVPPTGVSVNLTRKEVLYPSRVLIIILSDM 1194

Query: 1194 WRLGLTEQSERFLAEVLSTIQTLVTNLKGDNVIINGAFWLTNVRELYSFAIYAHDSILND 1253
            WRLGLT QSE FLAEVL  IQ +++NLK D +I +GAFW TNVREL+SF +YA++SI  D
Sbjct: 1195 WRLGLTSQSETFLAEVLDAIQKIISNLKPDVMIEHGAFWYTNVRELHSFVVYAYESITTD 1254

Query: 1254 NAYIKDLNEDEYKQYVTLVSVLKDDFESLSYNIYNIWLKKLQKELEKRAVSAVVMSQSLP 1313
              Y   +NE+EY +YV LV  LKDDFE+LS+N+YN+W+KKL+K LEK AV AVV+SQSLP
Sbjct: 1255 ETYNSGMNEEEYNRYVNLVKELKDDFEALSFNVYNLWMKKLRKNLEKIAVPAVVVSQSLP 1314

Query: 1314 GFIVPESSAFLPKIFSSSSSYKMDDILTFFNTIYWSMKAYHVETEVYREVIMSLLRYVDA 1373
            GF+VPE S FL K   +SS+YKMDD+LTFFN IYW+MK+Y +E EV+ +VI +LL+ +DA
Sbjct: 1315 GFVVPEPSQFLQKFLQNSSTYKMDDVLTFFNNIYWAMKSYDIEMEVFEDVITNLLKLLDA 1374

Query: 1374 ICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKVHHIPEGSDCLEHMXXXXXXXXXXXXN 1433
            +CFNDLI+++NFLSWKRGLQLNYNVTR+EEWCK HHI E S CL+H+             
Sbjct: 1375 LCFNDLILRKNFLSWKRGLQLNYNVTRIEEWCKSHHISEVSVCLQHILQAAKLLQLKKRI 1434

Query: 1434 MEDINIIWEICSSLKPAQIQKLISQYSAADYEVPIPQEILSFVADRVKKESALSNDGKSA 1493
            + DI+IIW+IC+ LKP Q+++LI+QYS ADYE PI  EIL +VA++VK +++     K+ 
Sbjct: 1435 VADIDIIWDICNCLKPIQLKQLITQYSVADYEEPIAPEILQYVAEKVKNDTS-----KAE 1489

Query: 1494 SHSSDIFLPVATGSFADPFSQIEPREINKIEAHIPA 1529
              ++D+FLPV  G F DP+ ++E R   KIEA+IPA
Sbjct: 1490 VGNNDVFLPVDNGPFEDPYQKVEVRAFGKIEAYIPA 1525

>Sklu_2164.5 YOR326W, Contig c2164 5497-9549
          Length = 1350

 Score = 2090 bits (5414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1018/1351 (75%), Positives = 1183/1351 (87%), Gaps = 6/1351 (0%)

Query: 1    MSYEVGTRCWYPDKEQGWIGGEITKHRLVGDKYQLDLTLENGEVVEITAPSVEEGSCEEL 60
            MSYEVGTRCWYPDK+QGWIGGEITKH  + +K+QL+LTLE+ ++VEI + +++E   + L
Sbjct: 1    MSYEVGTRCWYPDKQQGWIGGEITKHTNLSNKHQLELTLEDNQIVEIESETLDETKDDRL 60

Query: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLY 120
            PLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRV+QLY
Sbjct: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVEQLY 120

Query: 121  SQDMIQAYAGRRRGELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAGKTVSAKYIMRY 180
            SQDMIQAYAG+RRGELEPHLFAIAEEAY LMKN KQNQTIVVSGESGAGKTVSAKYIMRY
Sbjct: 121  SQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180

Query: 181  FATVEQSNLVGSGGSMHHIEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 240
            FA+VEQ+N      + H++EMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF
Sbjct: 181  FASVEQNN---EENAHHNLEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 237

Query: 241  DKDISIIGARIRTYLLERSRLVFQPPSERNYHIFYQLLAGLPEETKKELKLGGVEEYHYM 300
            DK+ISIIGARIRTYLLERSRLVFQP SERNYHIFYQLLAGL  E K +LKL GVE+YHYM
Sbjct: 238  DKEISIIGARIRTYLLERSRLVFQPKSERNYHIFYQLLAGLTNEEKSQLKLTGVEDYHYM 297

Query: 301  NQGGASEIQGVDDREEYAITTKALSLVDITERTQTALFKVLAALLHIGNIDVKKTRNDAS 360
            NQGG ++I+G+DD EEY  T +ALSLV I++ TQ  LFK+LAALLHIGN+++KKTRNDAS
Sbjct: 298  NQGGEAQIKGIDDAEEYQTTVEALSLVGISKDTQYQLFKILAALLHIGNVEIKKTRNDAS 357

Query: 361  VSATDPSLEIACELLGIDAYNFAKWITKKQITTRSEKIVSNLNYGQAVVARDSVAKFIYS 420
            +S+ +P+L IACELLGID++NFAKWITKKQI TRSEKIVSNLNY QA+VARDSVAKFIYS
Sbjct: 358  LSSDEPNLAIACELLGIDSFNFAKWITKKQINTRSEKIVSNLNYNQALVARDSVAKFIYS 417

Query: 421  ALFDWLVENINNVLCNPAVINEIASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480
            ALF+WLV+NIN VLCNP V +EI SFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN
Sbjct: 418  ALFEWLVDNINTVLCNPEVASEINSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 477

Query: 481  QHVFKLEQEEYVKEEIQWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETWTQK 540
            QHVFKLEQEEYVKEEI+WSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETWTQK
Sbjct: 478  QHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETWTQK 537

Query: 541  LYQTLDKPPTNTVFSKPRFGQTKFVVSHYAHDVAYDVEGFIEKNRDTVSDGHLEVLKGST 600
            LYQTLDKPPTNTVFSKPRFGQTKFVVSHYA DV+YDVEGFIEKNRDTVSDGHLEVLK ST
Sbjct: 538  LYQTLDKPPTNTVFSKPRFGQTKFVVSHYALDVSYDVEGFIEKNRDTVSDGHLEVLKAST 597

Query: 601  NETLLAILETIDRNAAKLAEKLESQKKPGPTTRTVNRKPTLGSLFKQSLVELMSTINSTN 660
            NETLL+ILET+D++AAKLAEK +  KKPGP  R VNRKPTLGS+FKQSL+ELM TINSTN
Sbjct: 598  NETLLSILETLDKHAAKLAEKEQVNKKPGP-ARMVNRKPTLGSIFKQSLIELMGTINSTN 656

Query: 661  VHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPTRWTYDEFALRYHILV 720
            VHYIRCIKPNE KEAW FDNLMVLSQLRACGVLETIRISCAGFP+RWTY+EF LRYHIL+
Sbjct: 657  VHYIRCIKPNEVKEAWVFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHILI 716

Query: 721  PSTNWTKIFATGTTEEEINQLCKNILDTTVTDKEKYQLGNTKIFFKAGMLAFLEKKRTDK 780
            PS +W+K+F++ TTEE+I  LC+ IL   V DK+KYQLGNTKIFFKAGMLA+LEK R+D+
Sbjct: 717  PSEHWSKMFSSDTTEEDIRDLCRTILGAIVEDKQKYQLGNTKIFFKAGMLAYLEKLRSDR 776

Query: 781  LNSSSTMIQKKIKGIYYRRRYLEITNAIKRTHSVAKGNLLRARIDLEFKTWAAITIQSLY 840
            L++SS +IQKK+K +YYR++YL I ++I+  HS ++G L R ++DLEFKT AAI IQS+ 
Sbjct: 777  LHNSSVLIQKKVKAVYYRKKYLAIISSIRNFHSRSEGFLTRQKVDLEFKTQAAILIQSMV 836

Query: 841  RGSLIRRDTIHLLDSIIRTQSLLRRSLARKELRARLETDAAITIQKNIRAFKPRTSYITN 900
            R +  R  TI LL +I R QSL+R+ LA+KEL  R + DAA++IQK IRAF+PR S+ T 
Sbjct: 837  RSTSTRNKTISLLSAITRLQSLVRKQLAQKELLQRRQRDAAVSIQKKIRAFEPRQSFNTT 896

Query: 901  RRSTIVVQSLVRRRFAKRKLETLKQEAKSVSHLKEVSYKLENKVIELTESLAAKVKENKD 960
            RRST+VVQSLVR++FA++KL+ LK EAKSV+HLKEVSYKLENKVI+LTESLA KVKENK 
Sbjct: 897  RRSTVVVQSLVRKKFAQKKLKDLKTEAKSVNHLKEVSYKLENKVIQLTESLAEKVKENKG 956

Query: 961  LNSRIKELQLSLNESANIRELLKTKQEEYRKSIDQQKDTHAAAYEEVTGRLTLAMKEVDD 1020
            + +RI+ELQ SLNESANI+ELL ++++E+ K + QQKD H   + EV  +L  A KEV++
Sbjct: 957  MTARIQELQQSLNESANIKELLNSQKDEHSKVLQQQKDAHDVQFNEVQEKLVNAKKEVEE 1016

Query: 1021 ARQEIDQLKSKQEDLKLEVKAKIEELSKVRQDLSDSRTQNSDLSNEVSSLKEEIARLHNA 1080
            A++EI+QL +KQ++LK EV+ KIEEL+K ++  ++ +TQNSDL NEV SLK+EIARL  A
Sbjct: 1017 AKEEIEQLIAKQDELKAEVRTKIEELNKAKKTFTEFQTQNSDLKNEVKSLKDEIARLQAA 1076

Query: 1081 IR--NAPATGTLSPTRSKRISSYSGLDNIGSPKQWNVVSLNNGLMEEETRSIMSQLSQIN 1138
            +R     +T T +PT S+R S++S + +  SP+Q NV+S+NNG +E++ RS  S LSQIN
Sbjct: 1077 VRSGVTSSTITSTPTASRRFSAHSSVADGTSPRQLNVISMNNGGIEDDARSTASALSQIN 1136

Query: 1139 DELYKLLNDDRPLTSEIVEGLLKSGKIPQPGFAANLTRKEVLYPARVLIIILSDMWRLGL 1198
            DELYKLL D + L +EIVEGLLK  KIP+ G A  LTRKEVLYPAR+LII+LSDMWRLGL
Sbjct: 1137 DELYKLLEDTKSLNTEIVEGLLKGFKIPETGVAVELTRKEVLYPARILIIVLSDMWRLGL 1196

Query: 1199 TEQSERFLAEVLSTIQTLVTNLKGDNVIINGAFWLTNVRELYSFAIYAHDSILNDNAYIK 1258
            T+QSE FLAEVLSTIQ LVTNLKGD++I++GAFWLTNVRELYSF ++A +SILND++Y  
Sbjct: 1197 TKQSESFLAEVLSTIQKLVTNLKGDDMILHGAFWLTNVRELYSFVVFAQESILNDDSYNN 1256

Query: 1259 DLNEDEYKQYVTLVSVLKDDFESLSYNIYNIWLKKLQKELEKRAVSAVVMSQSLPGFIVP 1318
             LNEDEYK+YVTLV+ LKDDFESLSYNIYNIWLKKLQK+LE++A+SAVVMSQSLPGFI P
Sbjct: 1257 GLNEDEYKEYVTLVTELKDDFESLSYNIYNIWLKKLQKDLERKAISAVVMSQSLPGFIAP 1316

Query: 1319 ESSAFLPKIFSSSSSYKMDDILTFFNTIYWS 1349
            ESS FLPK+FS SS YKMDDI+TFFN IYWS
Sbjct: 1317 ESSPFLPKLFSQSSHYKMDDIVTFFNNIYWS 1347

>CAGL0F00671g complement(73893..78593) highly similar to sp|P19524
            Saccharomyces cerevisiae YOR326w MYO2 or sp|P32492
            Saccharomyces cerevisiae YAL029c MYO4, start by
            similarity
          Length = 1566

 Score = 2068 bits (5359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1012/1546 (65%), Positives = 1230/1546 (79%), Gaps = 21/1546 (1%)

Query: 1    MSYEVGTRCWYPDKEQGWIGGEITKHRLVGDKYQLDLTLENGEVVEITAPSVEEGSCEEL 60
            MS+EVGTRCWYP KE GWIG E+TK+ L    Y ++L LE+G+ V I    + + S E L
Sbjct: 1    MSFEVGTRCWYPSKELGWIGAEVTKNDLKDGTYHMELALEDGKSVNIETKDLTDESDESL 60

Query: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLY 120
            PLLRNPPILEATEDLTSLSYLNEPAVLHAIK RY+QLNIYTYSGIVLIATNPFDRVDQLY
Sbjct: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLY 120

Query: 121  SQDMIQAYAGRRRGELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAGKTVSAKYIMRY 180
            SQDMIQAYAG++RGE+EPHLFAIAEEAY LMK++K+NQTIVVSGESGAGKTVSAKYIMRY
Sbjct: 121  SQDMIQAYAGKQRGEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTVSAKYIMRY 180

Query: 181  FATVEQSNLVGSGGSMHHIEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 240
            FA+VE+ N   S    H +EMSETE+KILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF
Sbjct: 181  FASVEEEN---SMTVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 237

Query: 241  DKDISIIGARIRTYLLERSRLVFQPPSERNYHIFYQLLAGLPEETKKELKLGGVEEYHYM 300
            DKD SIIGA+IRTYLLERSRLV+QP +ERNYHIFYQ++AGL  + K EL L G E+Y+YM
Sbjct: 238  DKDTSIIGAKIRTYLLERSRLVYQPETERNYHIFYQMMAGLSPKEKAELHLKGAEDYYYM 297

Query: 301  NQGGASEIQGVDDREEYAITTKALSLVDITERTQTALFKVLAALLHIGNIDVKKTRNDAS 360
            NQGG  +I+GVDD++EY  T  AL+LV I+  TQ  +FK+LAALLHIGNI++KKTRNDAS
Sbjct: 298  NQGGDVKIEGVDDKQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNIEIKKTRNDAS 357

Query: 361  VSATDPSLEIACELLGIDAYNFAKWITKKQITTRSEKIVSNLNYGQAVVARDSVAKFIYS 420
            +S+ + +L+IACELLGID++NFAKWITKKQI TRSEKIVSNLNY QA+VARDSVAKFIYS
Sbjct: 358  LSSDEENLKIACELLGIDSFNFAKWITKKQIITRSEKIVSNLNYSQALVARDSVAKFIYS 417

Query: 421  ALFDWLVENINNVLCNPAVINEIASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480
            ALFDWLVENIN VLCNPAV++++ASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN
Sbjct: 418  ALFDWLVENINTVLCNPAVVDKVASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 477

Query: 481  QHVFKLEQEEYVKEEIQWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETWTQK 540
            QHVFKLEQEEYVKE+I+WSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDE+WTQK
Sbjct: 478  QHVFKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 537

Query: 541  LYQTLDKPPTNTVFSKPRFGQTKFVVSHYAHDVAYDVEGFIEKNRDTVSDGHLEVLKGST 600
            LYQTLDKPPTN VFSKPRFGQTKFVVSHYA DVAYDVEGFIEKNRDTVSDGHLEVLK ST
Sbjct: 538  LYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKAST 597

Query: 601  NETLLAILETIDRNAAKL-----AEKLESQKKPGPTTRTVNRKPTLGSLFKQSLVELMST 655
            NETL+ IL+T++RNA KL     AE+     KPGP  RTV RKPTLGS+FKQSL+ELM+T
Sbjct: 598  NETLINILDTLERNANKLEDAKKAEQESKPAKPGP-MRTVQRKPTLGSMFKQSLIELMTT 656

Query: 656  INSTNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPTRWTYDEFALR 715
            I STN HYIRCIKPN +KEAWKFDNLMVLSQLRACGVLETIRISCAGFP+RWT++EF LR
Sbjct: 657  IRSTNAHYIRCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFILR 716

Query: 716  YHILVPSTNWTKIFA-TGTTEEEINQLCKNILDTTVTDKEKYQLGNTKIFFKAGMLAFLE 774
            Y+IL+P++ W+ IF     TE+++  LC  IL  TV +KEKYQ+GNTKIFFKAGMLAFLE
Sbjct: 717  YYILLPASEWSFIFTKKDMTEDDVIGLCNKILAVTVKEKEKYQIGNTKIFFKAGMLAFLE 776

Query: 775  KKRTDKLNSSSTMIQKKIKGIYYRRRYLEITNAIKRTHSVAKGNLLRARIDLEFKTWAAI 834
            K R+DK++ SS +IQK I+  YYRR +L I +AI       KG + R+ ID EFK  AA 
Sbjct: 777  KLRSDKMHISSVLIQKNIRAKYYRREFLRIMSAITSLQQRVKGEVRRSIIDREFKNKAAT 836

Query: 835  TIQSLYRGSLIRRDTIHLLDSIIRTQSLLRRSLARKELRARLETDAAITIQKNIRAFKPR 894
             IQSL RG   R   + ++ SI   Q  +R+ L RK  + + ETDAA+ IQ  +R+FKPR
Sbjct: 837  EIQSLLRGYRRRSQILSIISSIRCIQLKVRKELNRKHAQVQHETDAAVAIQSKVRSFKPR 896

Query: 895  TSYITNRRSTIVVQSLVRRRFAKRKLETLKQEAKSVSHLKEVSYKLENKVIELTESLAAK 954
             +++ +RR T+VVQSL+RRRFA++KL+ LK +AKSV+HLKEVSYKLENKV+ELT++LAAK
Sbjct: 897  KAFLEDRRKTVVVQSLIRRRFAQKKLKQLKADAKSVNHLKEVSYKLENKVVELTQNLAAK 956

Query: 955  VKENKDLNSRIKELQLSLNESANIRELLKTKQEEYRKSIDQQKDTHAAAYEEVTGRLTLA 1014
            VKENK L++R+ ELQ SL ESA ++E LK  + ++   + +QKD  A   +++   L  A
Sbjct: 957  VKENKSLSARVVELQTSLEESALLQEELKQIKSKHDAELLEQKDVFAEKGKQIEEELNAA 1016

Query: 1015 MKEVDDARQEIDQLKSKQEDLKLEVKAKIEELSKVRQDLSDSRTQNSDLSNEVSSLKEEI 1074
              +V++ + ++  L  + E+ K   K+ +EEL K + +L + +T NSDL NEV+SLKEE+
Sbjct: 1017 NLQVEEYKSKLLDLTQEYEEHKATTKSYLEELEKTKAELIEVQTFNSDLQNEVNSLKEEL 1076

Query: 1075 ARLHNAIRNAPATGTLSP-TRSKRISSYSGLDN---IGSPKQWNVVSLN-------NGLM 1123
            +RL   I     T  + P T SK I     + N   IG   + NV  +N       + + 
Sbjct: 1077 SRLQTQISLGTVTANVLPQTPSKDIHMQRNVTNGTDIGPGSELNVRPVNSKDAGSVSNMG 1136

Query: 1124 EEETRSIMSQLSQINDELYKLLNDDRPLTSEIVEGLLKSGKIPQPGFAANLTRKEVLYPA 1183
             +   S  + L+QIN+EL++LL D   L +EI +GLLK  ++P  G    L+R++V+YPA
Sbjct: 1137 MDSYASDSNALTQINEELFRLLEDIEVLNNEITDGLLKDFEVPAAGVGMQLSRRDVVYPA 1196

Query: 1184 RVLIIILSDMWRLGLTEQSERFLAEVLSTIQTLVTNLKGDNVIINGAFWLTNVRELYSFA 1243
            R+LIIILS+MWR GLT+QSE FLA+VL+TIQ +VT LKG+++I  GAFWL NVRELYSF 
Sbjct: 1197 RILIIILSEMWRFGLTKQSEGFLAQVLTTIQKVVTTLKGNDLIPAGAFWLANVRELYSFV 1256

Query: 1244 IYAHDSILNDNAYIKDLNEDEYKQYVTLVSVLKDDFESLSYNIYNIWLKKLQKELEKRAV 1303
            ++A  SIL + ++   + +DEYK+YV+LV+ LK+DFESLSYNIYNIWLKKLQ+EL+K+AV
Sbjct: 1257 VFAQHSILTEESFKSGMTDDEYKEYVSLVTELKEDFESLSYNIYNIWLKKLQRELQKKAV 1316

Query: 1304 SAVVMSQSLPGFIVPESSAFLPKIFSSSSSYKMDDILTFFNTIYWSMKAYHVETEVYREV 1363
            +AVV+S++LPGF   +S   L KIFSS   Y MDDILTFFN+IYWSMK++ +E EV+ +V
Sbjct: 1317 NAVVLSEALPGFSAGQSGGLLNKIFSSGEEYTMDDILTFFNSIYWSMKSFQIENEVFHKV 1376

Query: 1364 IMSLLRYVDAICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKVHHIPEGSDCLEHMXXX 1423
            + +LL YVDAICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCK H +P+G+DCL+H+   
Sbjct: 1377 VTTLLNYVDAICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGVPDGTDCLQHLIQT 1436

Query: 1424 XXXXXXXXXNMEDINIIWEICSSLKPAQIQKLISQYSAADYEVPIPQEILSFVADRVKKE 1483
                     ++EDI+I+  ICSSL PAQ+QKLI+QY  ADYE PIPQEIL +VAD VK E
Sbjct: 1437 SKLLQVRKYSIEDIDILRGICSSLTPAQLQKLITQYQVADYESPIPQEILKYVADIVKSE 1496

Query: 1484 SALSNDGKSASHSSDIFLPVATGSFADPFSQIEPREINKIEAHIPA 1529
            ++LS   K+ +HS+DIF+   TG F DPF+ IE  + +++EA+IPA
Sbjct: 1497 ASLSASSKAPTHSNDIFITPETGPFNDPFADIETHKFDQVEAYIPA 1542

>YOR326W (MYO2) [5107] chr15 (925716..930440) Myosin heavy chain,
            class V, involved in polarized growth, secretion and
            cytokinesis, required for mitochondrial distribution into
            growing bud [4725 bp, 1574 aa]
          Length = 1574

 Score = 2053 bits (5319), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1010/1555 (64%), Positives = 1228/1555 (78%), Gaps = 30/1555 (1%)

Query: 1    MSYEVGTRCWYPDKEQGWIGGEITKHRLVGDKYQLDLTLENGEVVEITAPSVEEGSCEEL 60
            MS+EVGTRCWYP KE GWIG E+ K+     KY L+L LE+ E+V +    +     + L
Sbjct: 1    MSFEVGTRCWYPHKELGWIGAEVIKNEFNDGKYHLELQLEDDEIVSVDTKDLNNDKDQSL 60

Query: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLY 120
            PLLRNPPILEATEDLTSLSYLNEPAVLHAIK RY+QLNIYTYSGIVLIATNPFDRVDQLY
Sbjct: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLY 120

Query: 121  SQDMIQAYAGRRRGELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAGKTVSAKYIMRY 180
            +QDMIQAYAG+RRGELEPHLFAIAEEAY LMKN KQNQTIVVSGESGAGKTVSAKYIMRY
Sbjct: 121  TQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180

Query: 181  FATVEQSNLVGSGGSMHHIEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 240
            FA+VE+ N   S    H +EMSETE+KILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF
Sbjct: 181  FASVEEEN---SATVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 237

Query: 241  DKDISIIGARIRTYLLERSRLVFQPPSERNYHIFYQLLAGLPEETKKELKLGGVEEYHYM 300
            DKD SIIGARIRTYLLERSRLV+QPP ERNYHIFYQL+AGLP +TK+EL L    +Y YM
Sbjct: 238  DKDTSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDASDYFYM 297

Query: 301  NQGGASEIQGVDDREEYAITTKALSLVDITERTQTALFKVLAALLHIGNIDVKKTRNDAS 360
            NQGG ++I G+DD +EY IT  AL+LV IT+ TQ  +FK+LAALLHIGNI++KKTRNDAS
Sbjct: 298  NQGGDTKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRNDAS 357

Query: 361  VSATDPSLEIACELLGIDAYNFAKWITKKQITTRSEKIVSNLNYGQAVVARDSVAKFIYS 420
            +SA +P+L++ACELLGIDAYNFAKW+TKKQI TRSEKIVSNLNY QA+VA+DSVAKFIYS
Sbjct: 358  LSADEPNLKLACELLGIDAYNFAKWVTKKQIITRSEKIVSNLNYSQALVAKDSVAKFIYS 417

Query: 421  ALFDWLVENINNVLCNPAVINEIASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480
            ALFDWLVENIN VLCNPAV ++I+SFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN
Sbjct: 418  ALFDWLVENINTVLCNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 477

Query: 481  QHVFKLEQEEYVKEEIQWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETWTQK 540
            QHVFKLEQEEYVKEEI+WSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDE+WTQK
Sbjct: 478  QHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 537

Query: 541  LYQTLDKPPTNTVFSKPRFGQTKFVVSHYAHDVAYDVEGFIEKNRDTVSDGHLEVLKGST 600
            LYQTLDK PTN VFSKPRFGQTKF+VSHYA DVAYDVEGFIEKNRDTVSDGHLEVLK ST
Sbjct: 538  LYQTLDKSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKAST 597

Query: 601  NETLLAILETIDRNAAKL--AEKLE----SQKKPGPTTRTVNRKPTLGSLFKQSLVELMS 654
            NETL+ ILE +++ A KL  A+KLE      KKPGP  RTVNRKPTLGS+FKQSL+ELM+
Sbjct: 598  NETLINILEGLEKAAKKLEEAKKLELEQAGSKKPGP-IRTVNRKPTLGSMFKQSLIELMN 656

Query: 655  TINSTNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPTRWTYDEFAL 714
            TINSTNVHYIRCIKPN +KEAW+FDNLMVLSQLRACGVLETIRISCAGFP+RWT++EF L
Sbjct: 657  TINSTNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVL 716

Query: 715  RYHILVPSTNWTKIFATG-TTEEEINQLCKNILDTTVTDKEKYQLGNTKIFFKAGMLAFL 773
            RY+IL+P   W  IF    TTEE+I  + K ILD TV DK KYQ+GNTKIFFKAGMLA+L
Sbjct: 717  RYYILIPHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAGMLAYL 776

Query: 774  EKKRTDKLNSSSTMIQKKIKGIYYRRRYLEITNAIKRTHSVAKGNLLRARIDLEFKTWAA 833
            EK R++K+++S  MIQKKI+  YYR++YL+I+ AIK   +  KG ++R R++ E K   A
Sbjct: 777  EKLRSNKMHNSIVMIQKKIRAKYYRKQYLQISQAIKYLQNNIKGFIIRQRVNDEMKVNCA 836

Query: 834  ITIQSLYRGSLIRRDTIHLLDSIIRTQSLLRRSLARKELRARLETDAAITIQKNIRAFKP 893
              +Q+ YRG  IR +   +L +I   Q  +R+ L +++L+   E +AA+TIQ  +R F+P
Sbjct: 837  TLLQAAYRGHSIRANVFSVLRTITNLQKKIRKELKQRQLKQEHEYNAAVTIQSKVRTFEP 896

Query: 894  RTSYITNRRSTIVVQSLVRRRFAKRKLETLKQEAKSVSHLKEVSYKLENKVIELTESLAA 953
            R+ ++  ++ T+VVQSL+RRR A+RKL+ LK +AKSV+HLKEVSYKLENKVIELT++LA+
Sbjct: 897  RSRFLRTKKDTVVVQSLIRRRAAQRKLKQLKADAKSVNHLKEVSYKLENKVIELTQNLAS 956

Query: 954  KVKENKDLNSRIKELQLSLNESANIRELLKTKQEEYRKSIDQQKDTHAAAYEEVTGRLTL 1013
            KVKENK++  RIKELQ+ + ESA ++E L+  ++E+   ID QK       + +   L  
Sbjct: 957  KVKENKEMTERIKELQVQVEESAKLQETLENMKKEHLIDIDNQKSKDMELQKTIENNLQS 1016

Query: 1014 AMKEVDDARQEIDQLKSKQEDLKLEVKAKIEELSKVRQDLSDSRTQNSDLSNEVSSLKEE 1073
              + + DA+ E++ +  + ++LK E K ++EEL + ++ L + +T N DL NEV SLKEE
Sbjct: 1017 TEQTLKDAQLELEDMVKQHDELKEESKKQLEELEQTKKTLVEYQTLNGDLQNEVKSLKEE 1076

Query: 1074 IARLHNAIRNAPATGTLSPTRSKRISSYSGLDNIG---------SPKQWNVVSL---NNG 1121
            IARL  A+     T ++ P    +     G  N           SP   N+ S    ++G
Sbjct: 1077 IARLQTAMSLGTVTTSVLPQTPLKDVMGGGASNFNNMMLENSDLSPNDLNLKSRSTPSSG 1136

Query: 1122 LMEEETRSIMSQ----LSQINDELYKLLNDDRPLTSEIVEGLLKSGKIPQPGFAANLTRK 1177
                ++ S+  +     +QIN+ELY+LL D   L  EI EGLLK  ++P  G A  L+++
Sbjct: 1137 NNHIDSLSVDRENGVNATQINEELYRLLEDTEILNQEITEGLLKGFEVPDAGVAIQLSKR 1196

Query: 1178 EVLYPARVLIIILSDMWRLGLTEQSERFLAEVLSTIQTLVTNLKGDNVIINGAFWLTNVR 1237
            +V+YPAR+LII+LS+MWR GLT+QSE FLA+VL+TIQ +VT LKG+++I +G FWL NVR
Sbjct: 1197 DVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTQLKGNDLIPSGVFWLANVR 1256

Query: 1238 ELYSFAIYAHDSILNDNAYIKDLNEDEYKQYVTLVSVLKDDFESLSYNIYNIWLKKLQKE 1297
            ELYSF ++A +SIL +  +   + ++EYK+YV+LV+ LKDDFE+LSYNIYNIWLKKLQK+
Sbjct: 1257 ELYSFVVFALNSILTEETFKNGMTDEEYKEYVSLVTELKDDFEALSYNIYNIWLKKLQKQ 1316

Query: 1298 LEKRAVSAVVMSQSLPGFIVPESSAFLPKIFSSSSSYKMDDILTFFNTIYWSMKAYHVET 1357
            L+K+A++AVV+S+SLPGF   E+S FL KIF+++  Y MDDILTFFN+IYW MK++H+E 
Sbjct: 1317 LQKKAINAVVISESLPGFSAGETSGFLNKIFANTEEYTMDDILTFFNSIYWCMKSFHIEN 1376

Query: 1358 EVYREVIMSLLRYVDAICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKVHHIPEGSDCL 1417
            EV+  V+ +LL YVDAICFN+LIMKRNFLSWKRGLQLNYNVTRLEEWCK H + +G++CL
Sbjct: 1377 EVFHAVVTTLLNYVDAICFNELIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGLTDGTECL 1436

Query: 1418 EHMXXXXXXXXXXXXNMEDINIIWEICSSLKPAQIQKLISQYSAADYEVPIPQEILSFVA 1477
            +H+             +EDI+I+  IC SL PAQ+QKLISQY  ADYE PIPQEIL +VA
Sbjct: 1437 QHLIQTAKLLQVRKYTIEDIDILRGICYSLTPAQLQKLISQYQVADYESPIPQEILRYVA 1496

Query: 1478 DRVKKESALS---NDGKSASHSSDIFLPVATGSFADPFSQIEPREINKIEAHIPA 1529
            D VKKE+ALS   ND K   HSS IF+   TG F DPFS I+ R+ +++EA+IPA
Sbjct: 1497 DIVKKEAALSSSGNDSKGHEHSSSIFITPETGPFTDPFSLIKTRKFDQVEAYIPA 1551

>Scas_663.26
          Length = 1567

 Score = 1995 bits (5169), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 981/1558 (62%), Positives = 1218/1558 (78%), Gaps = 43/1558 (2%)

Query: 1    MSYEVGTRCWYPDKEQGWIGGEITKHRLVGDKYQLDLTLENGEVVEITAPSVEEGSCEEL 60
            MS+EVGTRCWYP KEQGWIG E+TK+ L    Y ++LTLE+ EVV +    +       L
Sbjct: 1    MSFEVGTRCWYPSKEQGWIGAEVTKNDLKDGTYFMELTLEDNEVVNVETKDLTNEKDPSL 60

Query: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLY 120
            PLLRNPPILE+TEDLT+LSYLNEPAVLHAIK RY+QLNIYTYSGIVLIATNPFDR+DQLY
Sbjct: 61   PLLRNPPILESTEDLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRMDQLY 120

Query: 121  SQDMIQAYAGRRRGELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAGKTVSAKYIMRY 180
            SQDMIQAY+G+RRGE+EPHLFAIAEEAY LMKN KQNQTIVVSGESGAGKTVSAKYIMRY
Sbjct: 121  SQDMIQAYSGKRRGEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180

Query: 181  FATVEQSNLVGSGGSMHHIEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 240
            FA+ ++ N    G   H  EMSETE++ILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF
Sbjct: 181  FASCDEENSSNMGNLQHTAEMSETEERILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 240

Query: 241  DKDISIIGARIRTYLLERSRLVFQPPSERNYHIFYQLLAGLPEETKKELKLGGVEEYHYM 300
            DK+ +IIGA++RTYLLERSRLV+QP +ERNYHIFYQ+LAGLPE+ K+EL L   ++Y YM
Sbjct: 241  DKETAIIGAKMRTYLLERSRLVYQPKTERNYHIFYQILAGLPEDVKQELHLTKADDYFYM 300

Query: 301  NQGGASEIQGVDDREEYAITTKALSLVDITERTQTALFKVLAALLHIGNIDVKKTRNDAS 360
            NQGG  EI G+DD  EY IT KAL+LV +   TQ  +FK+LAALLHIGNI++KKTRND+S
Sbjct: 301  NQGGEPEIAGIDDVSEYGITIKALTLVGVAPETQQHIFKILAALLHIGNIEIKKTRNDSS 360

Query: 361  VSATDPSLEIACELLGIDAYNFAKWITKKQITTRSEKIVSNLNYGQAVVARDSVAKFIYS 420
            +S+ +P+L+IACELLG+D  NFAKWITKKQI TRSEKIVSNLNY QA+VARDSVAKFIYS
Sbjct: 361  LSSDEPNLKIACELLGVDPSNFAKWITKKQIVTRSEKIVSNLNYSQALVARDSVAKFIYS 420

Query: 421  ALFDWLVENINNVLCNPAVINEIASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480
            ALFDWLV NIN VLCNPAV+++I SFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN
Sbjct: 421  ALFDWLVTNINTVLCNPAVLDQIHSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480

Query: 481  QHVFKLEQEEYVKEEIQWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETWTQK 540
            QHVFKLEQEEY+KEEI+WSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDE+WTQK
Sbjct: 481  QHVFKLEQEEYIKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 540

Query: 541  LYQTLDKPPTNTVFSKPRFGQTKFVVSHYAHDVAYDVEGFIEKNRDTVSDGHLEVLKGST 600
            LYQTLDKPPTN VFSKPRFGQTKFVVSHYA DVAYDVEGFIEKNRDTVSDGHLEVLK +T
Sbjct: 541  LYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKATT 600

Query: 601  NETLLAILETIDRNAAKLAEKLESQ--------KKPGPTTRTVNRKPTLGSLFKQSLVEL 652
            N+TL  ILE+++ +A K+ E  ++         KKP P  R V RKPTLGS+FK SL+EL
Sbjct: 601  NDTLSTILESVEESARKVEEAKKNAASQDQKQLKKPTP-IRQVQRKPTLGSMFKLSLIEL 659

Query: 653  MSTINSTNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPTRWTYDEF 712
            M TINSTNVHYIRCIKPN EKEAWKFDNLMVLSQLRACGVLETIRISCAGFP+RWT++EF
Sbjct: 660  MQTINSTNVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEF 719

Query: 713  ALRYHILVPSTNWTKIFATGT-TEEEINQLCKNILDTTVTDKEKYQLGNTKIFFKAGMLA 771
             LRY+IL+P   W  IF     TE+++  LCK IL  TV DKEKYQ+GNTKIFFKAGMLA
Sbjct: 720  ILRYYILIPPVEWAPIFQKNDLTEQDVINLCKKILAATVQDKEKYQIGNTKIFFKAGMLA 779

Query: 772  FLEKKRTDKLNSSSTMIQKKIKGIYYRRRYLEITNAIKRTHSVAKGNLLRARIDLEFKTW 831
            + EK R+ K+NS+  +IQK I+  YYR++Y+ +  ++    + +KG ++R R++ E +  
Sbjct: 780  YFEKLRSTKMNSAIVLIQKHIRSKYYRKQYMLMKASLSLLGAYSKGTVIRQRVEYELEQH 839

Query: 832  AAITIQSLYRGSLIRRDTIHLLDSIIRTQSLLRRSLARKELRARLETDAAITIQKNIRAF 891
            AA  IQ++YRG   R     ++ SI++ QS +R  L ++E++++ E++AAI+IQ  IRAF
Sbjct: 840  AATLIQTMYRGYSKRSYISGVISSIVKLQSRIREELEQREMQSKYESNAAISIQSRIRAF 899

Query: 892  KPRTSYITNRRSTIVVQSLVRRRFAKRKLETLKQEAKSVSHLKEVSYKLENKVIELTESL 951
             PR +Y + RR TIVVQSL+RRR A+R  + LK +AKSV HLKEVSYKLENKVI+LT++L
Sbjct: 900  VPRKAYESKRRDTIVVQSLIRRRIAQRDFKKLKADAKSVHHLKEVSYKLENKVIQLTQNL 959

Query: 952  AAKVKENKDLNSRIKELQLSLNESANIRELLKTKQEEYRKSIDQQKDTHAAAYEEVTGRL 1011
            AAKVKEN+ L+ R++ELQ ++   + +++ L+ ++ E +K++  QKD      + +  +L
Sbjct: 960  AAKVKENRQLSKRLEELQATMVTVSELQDQLEAQKMENQKALADQKDGFVLDSKSLKDQL 1019

Query: 1012 TLAMKEVDDARQEIDQLKSKQEDLKLEVKAKIEELSKVRQDLSDSRTQNSDLSNEVSSLK 1071
              A K+V+  + E+  L +K  +++ E K +++EL + +  L++S+TQNSDL +E+ SLK
Sbjct: 1020 IKANKDVESVKFELATLTAKYTEMEAESKNQLDELERTKTLLTESKTQNSDLYSEIKSLK 1079

Query: 1072 EEIARLHNAIRNAPATGTL---------SPTRSKRISSY-----------SGLDNIGSPK 1111
            EE+A L  +I    A GT+         +P+R  R+ S            + L +I S  
Sbjct: 1080 EELAHLQTSI----ALGTVTTNTNIVPHTPSRENRMPSGHMRAAEENISPNQLKSIPSDT 1135

Query: 1112 QWNVVSLNNGLMEEETRSIMSQLSQINDELYKLLNDDRPLTSEIVEGLLKSGKIPQPGFA 1171
              + VS+N   M+++  +  + L+QIN+ELY+LL     L +EI EGLLK  ++P  G A
Sbjct: 1136 AADHVSVNGYGMDDDIIN-TNTLTQINEELYRLLEGTDVLNNEITEGLLKGFQVPDAGVA 1194

Query: 1172 ANLTRKEVLYPARVLIIILSDMWRLGLTEQSERFLAEVLSTIQTLVTNLKGDNVIINGAF 1231
              L+R++V+YPAR+LII+LS+MWR GLT+QSE FLA+VL+TIQ +VT LKG ++I +GAF
Sbjct: 1195 IQLSRRDVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTTLKGIDLIPSGAF 1254

Query: 1232 WLTNVRELYSFAIYAHDSILNDNAYIKDLNEDEYKQYVTLVSVLKDDFESLSYNIYNIWL 1291
            WL NVRELYSF ++A  SIL + ++ K +N++EY +YV+LV+ LK+DFESLSYNIYNIWL
Sbjct: 1255 WLANVRELYSFVVFAQHSILTEESFKKGMNDEEYNEYVSLVTELKEDFESLSYNIYNIWL 1314

Query: 1292 KKLQKELEKRAVSAVVMSQSLPGFIVPESSAFLPKIFSSSSSYKMDDILTFFNTIYWSMK 1351
            KKLQK+L+K+A++AVV+S+SLPGF   ES+ FL KIF+S   Y MDDILTFFN I+W MK
Sbjct: 1315 KKLQKDLQKKAINAVVVSESLPGFNASESNGFLNKIFNSGEEYTMDDILTFFNNIFWCMK 1374

Query: 1352 AYHVETEVYREVIMSLLRYVDAICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKVHHIP 1411
            ++H+E EV+R VI++LL YVD ICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCK H +P
Sbjct: 1375 SFHIENEVFRTVIITLLNYVDTICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGLP 1434

Query: 1412 EGSDCLEHMXXXXXXXXXXXXNMEDINIIWEICSSLKPAQIQKLISQYSAADYEVPIPQE 1471
            +G+  L+H+             +EDI+++  ICSSL PAQ+QKLISQY  ADYE PIPQ+
Sbjct: 1435 DGAQYLQHLIQTAKLLQLRKYTIEDIDMVRGICSSLSPAQLQKLISQYHVADYESPIPQD 1494

Query: 1472 ILSFVADRVKKESALSNDGKSASHSSDIFLPVATGSFADPFSQIEPREINKIEAHIPA 1529
            IL +VAD VKKE        S S  +DIFL   TG F DPF  ++ R+ +++EA+IP+
Sbjct: 1495 ILKYVADIVKKE--------STSAHNDIFLHPETGPFNDPFVAVKTRKFDQVEAYIPS 1544

>YAL029C (MYO4) [39] chr1 complement(87858..92273) Myosin heavy chain,
            class V [4416 bp, 1471 aa]
          Length = 1471

 Score = 1343 bits (3475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 724/1499 (48%), Positives = 971/1499 (64%), Gaps = 80/1499 (5%)

Query: 1    MSYEVGTRCWYPDKEQGWIGGEITKHRLVGDKYQLDLTLENGEVVEITAPSVE-EGSCEE 59
            MS+EVGT+CWYP KEQGWIGGE+TK+      + L+L LE+GE V I   S E +     
Sbjct: 1    MSFEVGTKCWYPHKEQGWIGGEVTKNDFFEGTFHLELKLEDGETVSIETNSFENDDDHPT 60

Query: 60   LPLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQL 119
            LP+LRNPPILE+T+DLT+LSYLNEPAVLHAIK RY    IYTYSGIVLIA NPFD+VD L
Sbjct: 61   LPVLRNPPILESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHL 120

Query: 120  YSQDMIQAYAGRRRGELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAGKTVSAKYIMR 179
            YS++MIQ Y+ +R+ ELEPHLFAIAEEAY  M + K NQT+VVSGESGAGKTVSAKYIMR
Sbjct: 121  YSREMIQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMR 180

Query: 180  YFATVEQSNLVGSGGSMHHIEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEIL 239
            YFA+V++SN          +EMS+ E +ILATNPIMEAFGNAKTTRNDNSSRFGKYL+IL
Sbjct: 181  YFASVQESN-----NREGEVEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQIL 235

Query: 240  FDKDISIIGARIRTYLLERSRLVFQPPSERNYHIFYQLLAGLPEETKKELKLGGVEEYHY 299
            FD++ +I G++IRTYLLE+SRLV+QP +ERNYHIFYQ+L GLPE  K+EL L   ++YHY
Sbjct: 236  FDENTTIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHY 295

Query: 300  MNQGGASEIQGVDDREEYAITTKALSLVDITERTQTALFKVLAALLHIGNIDVKKTRNDA 359
             NQGG   I G+D+  EY ITT ALSLV I   TQ  +FK+LA LLHIGNI++K TRNDA
Sbjct: 296  TNQGGQPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDA 355

Query: 360  SVSATDPSLEIACELLGIDAYNFAKWITKKQITTRSEKIVSNLNYGQAVVARDSVAKFIY 419
            S+S+ + +L+IACELLGID +NFAKWI KKQI TRSEKIV+NLNY QA++ARDSVAKFIY
Sbjct: 356  SLSSEEQNLQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVAKFIY 415

Query: 420  SALFDWLVENINNVLCNPAV--INEIASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQ 477
            S LFDWLV+NIN  L +P +   + + SFIG+LDIYGFEHFEKNSFEQFCINYANEKLQQ
Sbjct: 416  STLFDWLVDNINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQ 475

Query: 478  EFNQHVFKLEQEEYVKEEIQWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETW 537
            EFNQHVFKLEQEEYVKEEI+WSFIEF+DNQPCIDLIENKLGILSLLDEESRLP+GSDE+W
Sbjct: 476  EFNQHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPSGSDESW 535

Query: 538  TQKLYQTLDKPPTNTVFSKPRFGQTKFVVSHYAHDVAYDVEGFIEKNRDTVSDGHLEVLK 597
              KLY   +KPP+N VFSKPRFGQTKF+VSHYA DV Y+VEGFIEKNRD+VS GHL+V K
Sbjct: 536  ASKLYSAFNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFK 595

Query: 598  GSTNETLLAILETIDRNAAKLAEKLESQKKPGPTTRTVNRKPTLGSLFKQSLVELMSTIN 657
             +TN     IL+  +  +    E+  ++KK     R   +KPTLGS+FK+SL ELM+ IN
Sbjct: 596  ATTNPIFKQILDNRELRSDDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGELMAIIN 655

Query: 658  STNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPTRWTYDEFALRYH 717
            STNVHYIRCIKPN EK+ W+FDNLMVLSQLRACGVLETIRISCAGFP+RWT+DEF  RY 
Sbjct: 656  STNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRYF 715

Query: 718  ILVPSTNWTKI-FATGTTEEEINQLCKNILDTTVTDKEKYQLGNTKIFFKAGMLAFLEKK 776
            +L   + W+ I +     +E I   C++ILD T++D  KYQ+GNTKIFFKAGMLAFLEK 
Sbjct: 716  LLTDYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAFLEKL 775

Query: 777  RTDKLNSSSTMIQKKIKGIYYRRRYLEITNAIKRTHSVAKGNLLRARIDLEFKTWAAITI 836
            RT+K+N    +IQKKI+  YYR +YL+   +IK+  S  +  L+R R+D E KT AAI +
Sbjct: 776  RTNKMNEICIIIQKKIRARYYRLQYLQTMESIKKCQSQIRSLLVRTRVDHELKTRAAILL 835

Query: 837  QSLYRGSLIRRDTIHLLDSIIRTQSLLRRSLARKELRARLETDAAITIQKNIRAFKPRTS 896
            Q+  R    R      +  II+ Q   +R L    +  +    AA+ IQ  IR++  +T 
Sbjct: 836  QTNIRALWKREYYRAAIGQIIKLQCTCKRKLILDSVNRKFMLMAAVIIQSYIRSYGHKTD 895

Query: 897  YITNRRSTIVVQSLVRRRFAKRKLETLKQEAKSVSHLKEVSYKLENKVIELTESLAAKVK 956
            Y T +RS+I+VQS +R + A+R+   L++E +  +        L  + IE   S    ++
Sbjct: 896  YRTLKRSSILVQSAMRMQLARRRYIVLQKEVEERNIRASYGIGLLEEAIEFKNSFILNLE 955

Query: 957  ENKDLNSRIKELQLSLNESANIRELLKTKQEEYRKSIDQQKDTHAAAYEEVTGRLTLAMK 1016
               D  +R+   QL   + +NI     +KQ        Q+ +T    Y +   +L     
Sbjct: 956  MLNDSYTRLT--QLLQGDLSNI----PSKQR-------QEYETIVNGYNDKISKLKTLQV 1002

Query: 1017 EVDDARQEIDQLKSKQEDLKLEVKAKIEELSKVRQDLSDSRTQNSDLSNEVSSLKEEIAR 1076
            E+ +   + + LK +++     +++ ++ L+ ++ +      + S LS+EV S+K+E+A 
Sbjct: 1003 EIMNTLNKKNALKERKKKQSSLIQSHMQSLAAIKGN------KPSRLSDEVKSMKQELAF 1056

Query: 1077 LHNAIRNAPATGTLSPTRSKRISSYSGLDNIGSPKQWNVVSLNNGLMEEETRSIMSQLSQ 1136
            + N I     T T S  ++ ++           PK  NV+   +G               
Sbjct: 1057 IENVIAQ-DFTTTYSANKNDKVKGLGIAGQQVKPKLVNVIRRESG--------------- 1100

Query: 1137 INDELYKLLNDDRPLTSEIVEGLLKSGKIPQPGFAANLTRKEVLYPARVLIIILSDMWRL 1196
             N +L +LL D    T E+ EG LK   + +      +    VL P  V+  ++S + R 
Sbjct: 1101 -NPDLLELLMDLNCYTLEVTEGYLKKVNVTE------VNGDNVLGPIHVITTVVSSLVRN 1153

Query: 1197 GLTEQSERFLAEVLSTIQTLVTNLKGDNVIINGAFWLTNVRELYSFAIYAHDSILNDNAY 1256
            GL  QS +F+++VL T++++V +L  D  ++ G FWL+N+  L +FA         +   
Sbjct: 1154 GLLIQSSKFISKVLLTVESIVMSLPKDETMLGGIFWLSNLSRLPAFAA--------NQKT 1205

Query: 1257 IKDLNEDEYKQYVTLVSVLKDDFESLSY--NIYNIWLKKLQKELEKR-AVSAVVMSQSLP 1313
            + + N  + K  +TL+ +   + E+L     IY+ WL K  K       +  +V+++   
Sbjct: 1206 LYEANGGDEKDKLTLIYLNDLENETLKVFDKIYSTWLVKFMKHASAHIEIFDMVLNE--- 1262

Query: 1314 GFIVPESSAFLPKIFSSSSSYKMDDILTFFNTIYWSMKAYHVETEVYREVIMSLLRYVDA 1373
                        K+F +S   K   + TF N     +  + V   ++ ++    L+Y++ 
Sbjct: 1263 ------------KLFKNSGDEKFAKLFTFLNEFDAVLCKFQVVDSMHTKIFNDTLKYLNV 1310

Query: 1374 ICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKVHHIPEGSDCLEHMXXXXXXXXXXXXN 1433
            + FNDLI K   L+WK G +++ N+ RL  W +   I +    L  +            N
Sbjct: 1311 MLFNDLITKCPALNWKYGYEVDRNIERLVSWFE-PRIEDVRPNLIQIIQAVKILQLKISN 1369

Query: 1434 MEDINIIWEICSSLKPAQIQKLISQYSAADY-EVPIPQEILSFVADRVKKESALSNDGK 1491
            + +  ++++   +L PAQIQ ++ +Y  A+  E  +P EIL+++A+ +K+E+ LS  GK
Sbjct: 1370 LNEFKLLFDFWYALNPAQIQAILLKYKPANKGEAGVPNEILNYLANVIKREN-LSLPGK 1427

>Scas_592.13*
          Length = 1419

 Score = 1328 bits (3436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 701/1492 (46%), Positives = 944/1492 (63%), Gaps = 143/1492 (9%)

Query: 1    MSYEVGTRCWYPDKEQGWIGGEITKHRLVGDKYQLDLTLENGEVVEITAPSVE-----EG 55
            MS+EVGTRCWYP+ E GWIG E+TK+      Y ++LT E G V+ I    +E     E 
Sbjct: 1    MSFEVGTRCWYPNSEAGWIGCEVTKNDFQDGTYHIELTSETGLVIPIETKHLESNNAMEN 60

Query: 56   SCEELPLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDR 115
            + E LP+LRNPPILEAT DLT+LSYLNEPAVLHAIK RY Q NIYTYSGIVLIATNPFD+
Sbjct: 61   NHEFLPVLRNPPILEATHDLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFDK 120

Query: 116  VDQLYSQDMIQAYAGRRRGELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAGKTVSAK 175
            V++LYS +MIQAYA + R E+ PH+FAIAEEAY  M N+ QNQTI+VSGESGAGKTVSAK
Sbjct: 121  VEELYSSEMIQAYARKNRDEMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKTVSAK 180

Query: 176  YIMRYFATVEQSNLVGSGGSMHHIEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKY 235
            YIMR+FA+VE+ +    G S H  EMS+ E KILATNP+MEAFGNAKTTRNDNSSRFGKY
Sbjct: 181  YIMRFFASVEEEHFNKEGDSKHQEEMSDIEVKILATNPVMEAFGNAKTTRNDNSSRFGKY 240

Query: 236  LEILFDKDISIIGARIRTYLLERSRLVFQPPSERNYHIFYQLLAGLPEETKKELKLGGVE 295
            L+ILFD + +IIG+ I+TYLLERSRLVFQP SERNYHIFYQ+L+GL  + KK+L L   E
Sbjct: 241  LQILFDSNKNIIGSSIKTYLLERSRLVFQPTSERNYHIFYQMLSGLSSDMKKQLYLTNAE 300

Query: 296  EYHYMNQGGASEIQGVDDREEYAITTKALSLVDITERTQTALFKVLAALLHIGNIDVKKT 355
            ++ Y+NQGG S I G+DD  EY+ T ++LS V I    Q  +FK+LAALLHIGNI++KKT
Sbjct: 301  DFFYLNQGGESTINGIDDSLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIEIKKT 360

Query: 356  RNDASVSATDPSLEIACELLGIDAYNFAKWITKKQITTRSEKIVSNLNYGQAVVARDSVA 415
            R DA++S+TDPSL+ ACELLG+D   F+KWITKKQI TRSEKI+SNL++ QA+VARDSVA
Sbjct: 361  RTDATLSSTDPSLQKACELLGLDPLTFSKWITKKQINTRSEKIISNLSFNQALVARDSVA 420

Query: 416  KFIYSALFDWLVENINNVLCNPAVINEIASFIGVLDIYGFEHFEKNSFEQFCINYANEKL 475
            KFIYS+LFDWLV NINNVLC   V   I SFIGVLDIYGFEHFE+NSFEQFCINYANEKL
Sbjct: 421  KFIYSSLFDWLVGNINNVLCTSQVSETINSFIGVLDIYGFEHFEQNSFEQFCINYANEKL 480

Query: 476  QQEFNQHVFKLEQEEYVKEEIQWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDE 535
            QQEFN HVFKLEQEEYVKEEI+WSFIEF+DNQPCIDLIENKLGILSLLDEESRLPAGSDE
Sbjct: 481  QQEFNHHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPAGSDE 540

Query: 536  TWTQKLYQTLDKPPTNTVFSKPRFGQTKFVVSHYAHDVAYDVEGFIEKNRDTVSDGHLEV 595
            +WT KLYQT +KPP+NTVF KPRFGQ KF++SHYA DV Y+V+GFIEKN+DT+S+  LEV
Sbjct: 541  SWTTKLYQTFNKPPSNTVFGKPRFGQNKFIISHYAVDVTYEVDGFIEKNKDTISESQLEV 600

Query: 596  LKGSTNETLLAILETID-RNAAKLAEKLESQKKPGPTTRTVNRKPTLGSLFKQSLVELMS 654
            LK +TN TL  I E  +  N   + E+  + ++     +T+NRKPTLGS+FK+SLVELM 
Sbjct: 601  LKATTNPTLATIFEFSEAENKTNITEQAGTIQR-----KTINRKPTLGSIFKRSLVELME 655

Query: 655  TINSTNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPTRWTYDEFAL 714
            TINSTNVHYIRCIKPN EKEAWKFDNLMVLSQLRACGVLETI+ISCAGFP+RW ++EF  
Sbjct: 656  TINSTNVHYIRCIKPNTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFPSRWAFEEFIQ 715

Query: 715  RYHILVPSTNWTKIFA-TGTTEEEINQLCKNILDTTVTDKEKYQLGNTKIFFKAGMLAFL 773
            RY++L P+  W ++ A    + E++   C  IL   +  K+KYQ+G TKIFFKAG+LA+L
Sbjct: 716  RYYLLAPTDQWGRVTADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFKAGVLAYL 775

Query: 774  EKKRTDKLNSSSTMIQKKIKGIYYRRRYLEITNAIKRTHSVAKGNLLRARIDLEFKTWAA 833
            EK R+DK+   + +IQK I+  YYR  YL+   +IK   S+ +G   R R+D E KT AA
Sbjct: 776  EKIRSDKVTELAVLIQKHIRAKYYRSLYLQAMLSIKNCQSLIRGVQSRQRVDFEMKTDAA 835

Query: 834  ITIQSLYRGSLIRRDTIHLLDSIIRTQSLLRRSLARKELRARLETDAAITIQKNIRAFKP 893
              +Q+L+R + +R      L +I+  Q+ +RR L    ++   E+ +AI IQ  IRA  P
Sbjct: 836  TLLQTLHRSTRVRSQVFETLKNILEVQTAIRRVLVSNFIQREFESRSAIMIQSKIRANSP 895

Query: 894  RTSYITNRRSTIVVQSLVRRRFAKRKLETLKQEAKSVSHLKEVSYKLENKVIELTESLAA 953
            +  Y T +  TI++Q+LVRR+ ++ KL+ LK +A+S + LK  +  ++ ++I   E L +
Sbjct: 896  KHRYQTLKTGTILIQALVRRKQSQEKLKQLKIQAESAASLKNSAAGIQKELIGFIEELIS 955

Query: 954  KVKENKDLNSRIKELQLSLNESANIRELLKTKQEEYRKSIDQQKDTHAAAYEEVTGRLTL 1013
             +KEN                          K  EY+  +            E T     
Sbjct: 956  NIKEN------------------------DAKTTEYKSLLKHTSLPVVTGTNERTAAYIS 991

Query: 1014 AMKEVDDARQEIDQLKSKQEDLKLEVKAKIEELSKVRQDLSDSRTQNSDLSNEVSSLKEE 1073
               +V++ +  I  + +K E LK   + +++ L  + + ++D +  +S L + +  +K +
Sbjct: 992  TKNQVEEDKVTIRTILTKYETLKDLCRKELKSLESLEKGVNDEKFASS-LQSSLELIKRD 1050

Query: 1074 IARLH-NAI-RNAPATGTLSPTRSKRISSYSGLDNIGSPKQWNVVSLNNGLMEEETRSIM 1131
            I+ L  NAI ++   T T S  +     + + +  I + +Q +                 
Sbjct: 1051 ISDLRINAIEKDNERTSTSSELKDGTDCTDNAVVQILTKRQGD----------------- 1093

Query: 1132 SQLSQINDELYKLLNDDRPLTSEIVEGLLKSGKIPQPGFAANLTRKEVLYPARVLIIILS 1191
                        L+ND       +V  +    +IPQ G   +    E  YP ++LI I++
Sbjct: 1094 ------------LIND-------LVNVVFLEFQIPQRGRTKDC---EHFYPVKLLISIVN 1131

Query: 1192 DMWRLGLTEQSERFLAEVLSTIQTLVTNLKGDNVIINGAFWLTNVRELYSFAIYAHDSIL 1251
             M + GL + S   L + +  +   ++++     +  G +W+ ++ +L S          
Sbjct: 1132 LMNKFGLRKSSHSILKQTVQDLIGKISSMDAKKCVTFGLYWIISLHKLSSLP-------- 1183

Query: 1252 NDNAYIKDLNEDEYKQYVTLVSVLKDDFESLSYNIYNIWLKKLQKELEKRAVSAVVMSQS 1311
                           Q   +++ L+D F       Y  WLK+   +++            
Sbjct: 1184 ---------------QEPAVLNKLQDKF-------YKTWLKQCFNQMK------------ 1209

Query: 1312 LPGFIVPESSAFLPKIFSSSSSYKMDDILTFFNTIYWSMKAYHVETEVYREVIMSLLRYV 1371
                                    +D IL  F+TI      +   TE+   +I +LL+++
Sbjct: 1210 -----------------------TVDSILILFDTISEFTLFFQGTTELLTNIITALLQHI 1246

Query: 1372 DAICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKVHHIPEGSDCLEHMXXXXXXXXXXX 1431
            +A  FNDL++K+N LSW  GL+ +  + ++ +WC  H I   ++ L ++           
Sbjct: 1247 NAKWFNDLLIKQNTLSWTHGLEKDSEIKKVLDWCNSHKIRNSTEYLRNVNQACKLLQLRI 1306

Query: 1432 XNMEDINIIWEICSSLKPAQIQKLISQYSAADYEVPIPQEILSFVADRVKKE 1483
             N+ D  ++ E C  L   Q+  L+++Y    +E PIP ++L+ +++  ++E
Sbjct: 1307 SNISDFQLVCEFCYDLSSLQMHALLTKYRPTQFEKPIPVDVLNHLSNTARRE 1358

>CAGL0G06336g 607817..612073 similar to sp|P32492 Saccharomyces
           cerevisiae YAL029c MYO4 or sp|P19524 Saccharomyces
           cerevisiae YOR326w MYO2, start by similarity
          Length = 1418

 Score = 1083 bits (2801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/983 (55%), Positives = 705/983 (71%), Gaps = 39/983 (3%)

Query: 1   MSYEVGTRCWYPDKEQGWIGGEITKHRLVGDKYQLDLTLENGEVVEITAPSVE------- 53
           M++EVGTRCWYP  E GWI  E++K+     KY L  TLE+G ++++   S++       
Sbjct: 1   MTFEVGTRCWYPS-ENGWIPCEVSKNEPRDGKYHLQFTLEDGSLIDLDTDSIDYNDSLSN 59

Query: 54  EGSCEELPLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPF 113
           EGS   +P+LRNP   E+T+DLT+LSYLNEPAVLHAIK RY    IYTYSGIVL+ATNPF
Sbjct: 60  EGS--PMPVLRNPHSRESTQDLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPF 117

Query: 114 DRVDQLYSQDMIQAYAG-RRRGELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAGKTV 172
            ++++LYS DMI+ Y+    R EL+PHLFAIA +AY+ M +  +NQTIVVSGESGAGKTV
Sbjct: 118 AQMEELYSNDMIKKYSRITSREELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGAGKTV 177

Query: 173 SAKYIMRYFATVEQSNLVGSGGSMHHIEMSETEKKILATNPIMEAFGNAKTTRNDNSSRF 232
           SAKYIMRYFA+++ +N           EMS+ EKKILATNPIMEAFGNAKT RNDNSSRF
Sbjct: 178 SAKYIMRYFASLDDNNAAVVS------EMSDIEKKILATNPIMEAFGNAKTIRNDNSSRF 231

Query: 233 GKYLEILFDKDISIIGARIRTYLLERSRLVFQPPSERNYHIFYQLLAGLPEETKKELKLG 292
           GKYL+I+FD   +IIGA+IRTYLLERSRLVFQ  SERNYHIFYQLLAGLP   K+EL + 
Sbjct: 232 GKYLQIMFDAKKNIIGAQIRTYLLERSRLVFQQQSERNYHIFYQLLAGLPAAIKEELCIS 291

Query: 293 GVEEYHYMNQGGASEIQGVDDREEYAITTKALSLVDITERTQTALFKVLAALLHIGNIDV 352
             E+++Y+NQG    I GVDD +E+  T  ALS++ I +  Q  +FK+LA LLHIGNI++
Sbjct: 292 NPEQFYYLNQGSDPRIDGVDDAQEFQDTIAALSVIGINDSLQMEVFKILAGLLHIGNIEI 351

Query: 353 KKTRNDASVSATDPSLEIACELLGIDAYNFAKWITKKQITTRSEKIVSNLNYGQAVVARD 412
           K++   +S+S  +P+L++ACELLG+D Y F+KW+TKK+ITTRSEKIV+NL   QA+V RD
Sbjct: 352 KQSSTSSSISPDEPNLKLACELLGLDPYEFSKWLTKKEITTRSEKIVTNLKKEQALVVRD 411

Query: 413 SVAKFIYSALFDWLVENINNVLCNPAVINEIASFIGVLDIYGFEHFEKNSFEQFCINYAN 472
           SV+KFIYS LFDWLV  IN +L    V +++ SFIGVLDIYGFEHFE NSFEQFCINYAN
Sbjct: 412 SVSKFIYSLLFDWLVNQINTMLHGAEVSDQVRSFIGVLDIYGFEHFEMNSFEQFCINYAN 471

Query: 473 EKLQQEFNQHVFKLEQEEYVKEEIQWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAG 532
           EKLQQEFNQHVFKLEQEEYV+E+I+WSFIEFNDNQPCIDLIEN+LGILSLLDEESRLP+G
Sbjct: 472 EKLQQEFNQHVFKLEQEEYVREKIEWSFIEFNDNQPCIDLIENRLGILSLLDEESRLPSG 531

Query: 533 SDETWTQKLYQTLDKPPTNTVFSKPRFGQTKFVVSHYAHDVAYDVEGFIEKNRDTVSDGH 592
           +DE+WTQKLYQTLDKPP N VFSKP+FGQTKFV+SHYA +V YDVEGFIEKNRDTVS+  
Sbjct: 532 TDESWTQKLYQTLDKPPMNQVFSKPKFGQTKFVISHYADNVEYDVEGFIEKNRDTVSESL 591

Query: 593 LEVLKGSTNETLLAILETIDRNAAKLAEKLESQKKPGPTT------RTVNRKPTLGSLFK 646
           + VLK S N+TL++           L +  E    P P T      + +N+KPTLG +FK
Sbjct: 592 MNVLKNSQNDTLIS-----------LTKPTEETSTPPPQTASISRPKLINKKPTLGFMFK 640

Query: 647 QSLVELMSTINSTNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPTR 706
           +SL ELM  IN+TNVHYIRC+KPN  K AW+FD+ MVLSQLRACG+LETI+ISCAGFP+R
Sbjct: 641 KSLGELMEIINNTNVHYIRCVKPNSSKVAWEFDDGMVLSQLRACGILETIKISCAGFPSR 700

Query: 707 WTYDEFALRYHILVPSTNWTKIFATGTTEEEINQLCKNILDTTVTDKEKYQLGNTKIFFK 766
           W++ EF  RY++LV +T W+ + ++ +  E   + CK IL  T    EK Q+G TKIFFK
Sbjct: 701 WSFQEFIDRYYMLVDTTLWSDVASSESNAESSIKFCKEILGATELSHEKCQIGQTKIFFK 760

Query: 767 AGMLAFLEKKRTDKLNSSSTMIQKKIKGIYYRRRYLEITNAIKRTHSVAKGNLLRARIDL 826
           +G+LA LE  R  K+   +  IQKKI+    R  YLEI N ++   +  +  L+R  ++ 
Sbjct: 761 SGVLAELESLRLKKMKGIAITIQKKIRAYKIRTWYLEIVNCVRDLQNRIRSKLVRLDVEH 820

Query: 827 EFKTWAAITIQSLYRGSLIRRDTIHLLDSIIRTQSLLRRSLARKELRARLETDAAITIQK 886
           + KT  A+ +Q+  R   +R      LD II  Q   R  LA++ L+      A+I IQ 
Sbjct: 821 QLKTKLALMMQATLRSYRVRIRVAKELDDIILLQCKFRTVLAQRYLQELKRNKASIMIQS 880

Query: 887 NIRAFKPRTSYITNRRSTIVVQSLVRRRFAKRKLETLKQEAKSVSHLKEVSY-KLENKVI 945
            IR +K +T Y   R++   +Q+L R   A+  +  L+ E++ V+ +  V+Y +L + V 
Sbjct: 881 YIRGYKHKTQYRYFRKNYQAIQALSRSMLARSLMLKLRSESE-VTQINGVTYTELHSIVK 939

Query: 946 ELTESLAAK---VKENKDLNSRI 965
           ++ +S+ +    +KE  + N  I
Sbjct: 940 DIHDSMTSNNQIIKELDEFNGVI 962

>Scas_688.22
          Length = 1876

 Score =  522 bits (1344), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 294/752 (39%), Positives = 446/752 (59%), Gaps = 58/752 (7%)

Query: 65  NPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLYSQDM 124
           NP   +  ++++ L++LNE +VLH ++ RY    IYTYSG+ L+A NP+  + ++Y+Q+ 
Sbjct: 62  NPTSFDKVDNMSELTHLNEASVLHNLEKRYKDDMIYTYSGLFLVAINPYCNI-KIYTQEY 120

Query: 125 IQAYAGRRRGELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAGKTVSAKYIMRYFATV 184
           I  Y G  + + +PH++AIAEEAY  +   KQ+Q+++V+GESGAGKT + K I++Y A++
Sbjct: 121 INLYNGSSKEDNKPHIYAIAEEAYQKLLTEKQDQSVLVTGESGAGKTENTKKILQYLASI 180

Query: 185 -------EQSNLVGSGGSMHHIEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLE 237
                   +++L+ S       +    E KIL +NPI+E+FGNA+T RN+NSSRFGK+++
Sbjct: 181 TSNKSKYSEADLLVSQNDNEINQFESFEMKILQSNPILESFGNAQTVRNNNSSRFGKFIK 240

Query: 238 ILFDKDISIIGARIRTYLLERSRLVFQPPSERNYHIFYQLLAGLP--EETKKELKLGGVE 295
           I FD+   I GA I  YLLE+SR++ Q P ERNYHIFYQLLAGL   E  K EL    V 
Sbjct: 241 IEFDERGKINGAHIEWYLLEKSRVINQHPEERNYHIFYQLLAGLSLQELRKLELTSKSVS 300

Query: 296 EYHYMNQGGASEIQGVDDREEYAITTKALSLVDITERTQTALFKVLAALLHIGNIDVKKT 355
           +Y Y+++   S I GV+D +++    KA + V  T      +++VL+ +LHIGN+D    
Sbjct: 301 DYKYLSKSNPS-IPGVNDAQDFQDLLKAFTTVGFTHEEVNNIWQVLSIILHIGNVDFTSE 359

Query: 356 RNDASVSATDPSLEIACELLGIDAYNFAKWITKKQITTRSEKIVSNLNYGQAVVARDSVA 415
           ++  +    DPS     +LLG+    F   +   +     E +  + N  QA    +S++
Sbjct: 360 KSQQATFKNDPS--TLAKLLGVTEKEFTTAVLTPKTKAGKEWVTQSKNASQARFILNSLS 417

Query: 416 KFIYSALFDWLVENINNVLCNPAVINEIASFIGVLDIYGFEHFEKNSFEQFCINYANEKL 475
           + +Y  LF ++VE INN L + ++    A++IG+LDI GFE F+ NSFEQ CINY NEKL
Sbjct: 418 RTLYEKLFSFIVERINNSLDHSSM---TANYIGLLDIAGFEIFKHNSFEQLCINYTNEKL 474

Query: 476 QQEFNQHVFKLEQEEYVKEEIQWSFIEFN-DNQPCIDLIENK---LGILSLLDEESRLPA 531
           QQ FN H+F LEQ EY+KE IQW+F++F  D Q  IDLIENK    G+L LLDEES LP 
Sbjct: 475 QQFFNHHMFVLEQNEYMKENIQWNFVDFGKDLQASIDLIENKSSPTGVLPLLDEESILPN 534

Query: 532 GSDETWTQKLYQTLDKPPTNTVFSKPRFGQTK----FVVSHYAHDVAYDVEGFIEKNRDT 587
            SD+++  KL  T D+         P+F ++K    FV+ HYA +V Y++EG++ KN+D 
Sbjct: 535 SSDDSFFSKLISTWDQKS-------PKFIRSKLPQCFVLKHYAGEVEYNIEGWLSKNKDP 587

Query: 588 VSDGHLEVLKGSTNETLLAILETIDRNAAKLAEKLESQKKPGPTTRTVNRKPTLGSLFKQ 647
           +S+  + +L  STNE + +     ++N              G + RT + +       ++
Sbjct: 588 LSECMISMLSSSTNEIVTSFFNESNKNVR------------GSSFRTASAR------HRE 629

Query: 648 SLVELMSTINSTNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPTRW 707
             + L+  + +T+ H++RCI PN  K+A  FD  ++L QLR  GVLE IRI+  G+P R 
Sbjct: 630 QQMLLLKQLETTHPHFVRCIIPNNRKKAKDFDRKLILDQLRCNGVLEGIRIAREGYPNRI 689

Query: 708 TYDEFALRYHILVPSTNWTKIFATGTTEEEINQLCKNILDTTVTDKEKYQLGNTKIFFKA 767
            + EF  RY +L    +    FATG       + C+ +L +   D   Y++G +K+FFKA
Sbjct: 690 FFKEFFQRYRLLSDENH----FATG-----FKKNCEILLSSLHLDPSLYKIGTSKLFFKA 740

Query: 768 GMLAFLEKKRTDKLNSSSTMIQKKIKGIYYRR 799
           G+LA LE K+  ++ S        ++G   R+
Sbjct: 741 GVLAELETKKDQRIRSIVIRFNSHLRGRIIRK 772

>Kwal_23.5534
          Length = 1907

 Score =  518 bits (1333), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 359/1092 (32%), Positives = 586/1092 (53%), Gaps = 113/1092 (10%)

Query: 9    CWYPDKEQGWIGGEITKHRLVGDKYQLDLTLENGEVVEITAPSVEEGSCEELPLLRNPPI 68
             W PD EQ ++  ++   + V +K   D   E   VV +     +E + EE+  + NP  
Sbjct: 4    VWIPDAEQVFVRAQLVDEKTVRNKQNKD---EKWVVVRVNGRE-QEVAFEEVYAV-NPST 58

Query: 69   LEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLYSQDMIQAY 128
             +  +D++ L++LNEP+VLH ++ RYA  NIYTYSG+ L+A NP+  + ++YSQD +  Y
Sbjct: 59   FDRIDDMSELTHLNEPSVLHNLENRYADDNIYTYSGLFLVAINPYSNI-RIYSQDYVNLY 117

Query: 129  AGRRRGELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAGKTVSAKYIMRYFATVEQSN 188
             G  + + +PH+FAIAEEAY  + + +++Q+I+V+GESGAGKT + K I++Y A++   +
Sbjct: 118  HGSPKEDNKPHIFAIAEEAYQNLLSERRDQSILVTGESGAGKTENTKKILQYLASITSDD 177

Query: 189  LVGSGGSMHHIEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDISIIG 248
             +    S    E     +KIL +NPI+E+FGNA+T RN+NSSRFGK+++I FD+   I G
Sbjct: 178  KLSPDTSQESFE-----RKILQSNPILESFGNAQTVRNNNSSRFGKFIKIEFDELGKING 232

Query: 249  ARIRTYLLERSRLVFQPPSERNYHIFYQLLAGLPEETKKELKLGGVE-----EYHYMNQG 303
            A +  YLLE+SR++ Q   ERNYHIFYQ+L+G+   + +EL+  G+E     +Y Y+   
Sbjct: 233  AHVDWYLLEKSRVIQQNSRERNYHIFYQMLSGM---SAQELRRYGLETNSIKDYGYLRNS 289

Query: 304  GASEIQGVDDREEYAITTKALSLVDITERTQTALFKVLAALLHIGNIDVKKTRNDASVSA 363
              S I GVDD +++     +  +V  +E    ++   ++ +LHIGNI+    R  A  ++
Sbjct: 290  NPS-IPGVDDSQDFRTLLSSFQIVGFSEDEIQSMLTCISIILHIGNIEFVSER--AEQAS 346

Query: 364  TDPSLEIACELLGIDAYNFAKWITKKQITTRSEKIVSNLNYGQAVVARDSVAKFIYSALF 423
             D S+E  C LLG+   +F   + K +     + +    N  QA    +S+++ +Y  LF
Sbjct: 347  FDGSVETLCNLLGVTEADFKVAVLKPRAKAGKDWVSQAKNAHQARFILNSLSRSLYENLF 406

Query: 424  DWLVENINNVLCNPAVINEIASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV 483
              +V+ INN L + ++     ++IG+LDI GFE F+ NSFEQ CINY NEKLQQ FN H+
Sbjct: 407  AHIVQRINNNLDHGSM---TENYIGLLDIAGFEIFKHNSFEQLCINYTNEKLQQFFNHHM 463

Query: 484  FKLEQEEYVKEEIQWSFIEFN-DNQPCIDLIE---NKLGILSLLDEESRLPAGSDETWTQ 539
            F LEQ EY+KE +QW+FI++  D Q  IDLIE    K GIL LLDEES LP  +DE++  
Sbjct: 464  FVLEQNEYLKENVQWNFIDYGKDLQSTIDLIERKDTKPGILPLLDEESILPKSTDESFYS 523

Query: 540  KLYQTLDKPPTNTVFSKPRFGQTKFVVSHYAHDVAYDVEGFIEKNRDTVSDGHLEVLKGS 599
            KL +T       +   K    Q  FV+ HYA DV Y+V+G++ KN+D + +  L++L  S
Sbjct: 524  KL-ETF--YSDKSSKFKRSKKQRCFVLKHYAGDVEYNVDGWLSKNKDPLHENLLQMLSNS 580

Query: 600  TNETLLAILETIDRNAAKLAEKLESQKKPGPTTRTVNRKPTLGSLFKQSLVELMSTINST 659
            +NE +       D   +               T ++  +  L S        L+  ++ST
Sbjct: 581  SNELIRGFYSEKDSRGSSFK------------TTSIRHRDQLKS--------LLDRLSST 620

Query: 660  NVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPTRWTYDEFALRYHIL 719
              H++RCI PN++K+A  F+  ++L QLR  GVLE IRI+  G+P R  + EF  RY IL
Sbjct: 621  EPHFVRCIIPNDKKKAHDFNRKLILDQLRCNGVLEGIRIAREGYPNRIFFKEFFQRYKIL 680

Query: 720  VPSTNWTKIFATGTTEEEINQLCKNILDTTVTDKEKYQLGNTKIFFKAGMLAFLEKKRTD 779
                 ++               C+ +L +   D   +++GN+K+FFKAG+LA LE K+  
Sbjct: 681  SDEYRFSNTSKKN---------CEIVLSSLRLDPSVFKVGNSKLFFKAGVLASLEAKKEG 731

Query: 780  KLNSSSTMIQKKIKGIYYRRRYLEITNAIKRTHSVAKGNLLRARI-DLEFKTWAAITIQ- 837
            +++  ++ +  +I G           NA++R+ S     L  A++    F+T+  +    
Sbjct: 732  RISDMASKLNARING-----------NAVRRSTSQKLKKLQAAQVLGSAFETYQKMMGDP 780

Query: 838  --SLYRGSLIRRDTIHLLDSIIRTQSLLRRSLARKEL-RARLETDAAITIQKNIRAFKPR 894
              SLY                ++ + LL  +   +E+ + R   +    +++ ++  + +
Sbjct: 781  WFSLY----------------VKIKPLLEST---QEISKTRKIAEQVKNLEEKLKTLELQ 821

Query: 895  TSYITNRRSTIVVQ-SLVRRRFAKRKLETLKQEAKSVSHLKEVSYKLENKVIELTESLAA 953
               +   +S I V  + V+ R A    E L Q+ K +  +     +L+ K+ E  E L  
Sbjct: 822  NQALGEEKSAISVNLASVKERLATESQE-LAQKQKDLDSVLAKEAELKQKLNESNE-LQQ 879

Query: 954  KVKENKDLNSRIKELQLSLNESANIRE-LLKTKQEEYRKSIDQQKD--THAAAYEEVTGR 1010
            ++ + KD      EL+L L+ES  +RE     K+ E ++  D+ +    H  A +E    
Sbjct: 880  EIMQKKDT-----ELKLKLDESNKLREQTFAEKEAELQQKFDESEKLRQHFLAEKEAL-- 932

Query: 1011 LTLAMKEVDDARQEIDQLKSKQEDLKLEVKAKIEELSKVRQDLSDSRTQNSDLSNEVSSL 1070
                 KE  +AR + DQ + + E  +   K  + E  +++  +++  T+  D      S+
Sbjct: 933  ----QKEYSEARAKADQNREETEKSQSLYKKLLSENDQLKNQVTNLTTKIDDGERSFRSI 988

Query: 1071 KEEIARLHNAIR 1082
            + + A LH+ I+
Sbjct: 989  ESDKASLHDQIK 1000

>ACR068W [1115] [Homologous to ScYHR023W (MYO1) - SH]
           complement(480141..485558) [5418 bp, 1805 aa]
          Length = 1805

 Score =  515 bits (1326), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 308/843 (36%), Positives = 474/843 (56%), Gaps = 96/843 (11%)

Query: 10  WYPDKEQGWIGGEITKHRLVGDKYQLD----LTLENG---EVVEITAPSVEEGSCEELPL 62
           W PD E+ ++ G++   + + +K   D    L   NG   EV+E+   +V          
Sbjct: 9   WVPDAEEVFVKGQLVSTKTIKNKQNKDEKVCLVRVNGKEREVLEVETAAV---------- 58

Query: 63  LRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLYSQ 122
             NP   +  +D++ L++LNE +VL+ ++ RY    IYTYSG+ L+A NP+  + ++Y+Q
Sbjct: 59  --NPSTFDKIDDMSELTHLNEASVLYNLENRYKDDMIYTYSGLFLVALNPYSNI-KVYTQ 115

Query: 123 DMIQAYAGRRRGELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAGKTVSAKYIMRYFA 182
           D +  Y G  + + EPH+FA+AE+AY  +   +Q+Q+++V+GESGAGKT + K I++Y A
Sbjct: 116 DYVNLYHGSPKEDNEPHIFAVAEQAYRNLLTQRQDQSVLVTGESGAGKTENTKKILQYLA 175

Query: 183 TVEQSNLVGSGGSMHHIEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDK 242
           ++       S   + H  +   E+KIL  NPI+E+FGNA+T RN+NSSRFGK+++I FD+
Sbjct: 176 SI------TSDEKLAHTNLESFERKILQANPILESFGNAQTVRNNNSSRFGKFIKIEFDE 229

Query: 243 DISIIGARIRTYLLERSRLVFQPPSERNYHIFYQLLAGLPEETKKELKL--GGVEEYHYM 300
              I GA I  YLLE+SR++ Q   ERNYH+FYQLL+G+P    K L+L    + +Y Y+
Sbjct: 230 FGKINGAHIEWYLLEKSRIIQQNIRERNYHVFYQLLSGMPAGKLKTLELVSNSITDYAYL 289

Query: 301 NQGGASEIQGVDDREEYAITTKALSLVDITERTQTALFKVLAALLHIGNIDVKKTRNDAS 360
                S I GVDD  +++    A ++V   E     +F+ +A +LHIGN++   TR + +
Sbjct: 290 RDSNPS-IPGVDDAHDFSSLLSAFNVVGFKEDEIHDIFQCIAIILHIGNVEFTSTRAEQA 348

Query: 361 VSATDPSLEIACELLGIDAYNFAKWITKKQITTRSEKIVSNLNYGQAVVARDSVAKFIYS 420
               D +    C+L+G+D   F   + K +     E +  + N  Q+    +S+++ +Y 
Sbjct: 349 TIKNDVA--PLCKLIGVDEAAFKMAVLKPKSKAGKEWVSQSKNAAQSRFILNSLSRSLYE 406

Query: 421 ALFDWLVENINNVLCNPAVINEIASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480
            LF  +V  IN  L + ++     ++IG+LDI GFE F+ NSFEQ CINY NEKLQQ FN
Sbjct: 407 KLFAHIVRRINRSLDHGSM---TENYIGLLDIAGFEIFKDNSFEQLCINYTNEKLQQFFN 463

Query: 481 QHVFKLEQEEYVKEEIQWSFIEFN-DNQPCIDLIE---NKLGILSLLDEESRLPAGSDET 536
            H+F LEQ EYVKE+IQW FI++  D +  I+LIE   N  GILS+LDEES LP  +DE+
Sbjct: 464 HHMFVLEQREYVKEDIQWDFIDYGKDLEYTIELIEKKNNPAGILSILDEESILPKSTDES 523

Query: 537 WTQKLYQTLD-KPPTNTVFSKPRFGQTKFVVSHYAHDVAYDVEGFIEKNRDTVSDGHLEV 595
           +  KL    D K P    F + +  Q  FV+ HYA DV Y+V+ ++ KN+D ++D  L +
Sbjct: 524 FYSKLMSAWDGKSPK---FKRSKLQQC-FVLEHYAADVEYNVKDWLSKNKDPLNDHLLTL 579

Query: 596 LKGSTNETLLAILETIDRNAAKLAEKLESQKKPGPTTRTVNRKPTLGSLFKQSLVELMST 655
           L  S+N               KL  +  +++  G  ++T + +       K+ L  L+  
Sbjct: 580 LSESSN---------------KLISEFYTEQSRGHFSKTASNR------HKEQLTLLLDQ 618

Query: 656 INSTNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPTRWTYDEFALR 715
           ++ST+ H++RCI PN +K+A  FD  ++L QLR  GVLE IRI+  G+P R  + EF  R
Sbjct: 619 LSSTDPHFVRCIVPNTKKKAKTFDRKLILDQLRCNGVLEGIRIAREGYPNRIFFREFFQR 678

Query: 716 YHILVPSTNWTKIFATGTTEEEINQLCKNILDTTVTDKEKYQLGNTKIFFKAGMLAFLEK 775
           Y IL         F+  + +      C+ +L     D   Y++GNTK+FFKAG+LA LE 
Sbjct: 679 YKILGADPK----FSNNSKKN-----CEYLLSCISLDPSLYKVGNTKLFFKAGVLAQLE- 728

Query: 776 KRTDKLNSSSTMIQKKIKGIYYRRRYLEITNAIKRTHSVAKGNLLRARIDLEFKTWAAIT 835
                     T  ++KI GI            +   +++  G  +R  I+L+F+   A  
Sbjct: 729 ----------TQKEEKISGI------------VTGLNAIIHGKTVRTAINLQFQKLQAAK 766

Query: 836 IQS 838
           + S
Sbjct: 767 VLS 769

>YHR023W (MYO1) [2310] chr8 (151658..157444) Myosin heavy chain
           (myosin II), coiled-coil protein involved in septation
           and cell wall organization [5787 bp, 1928 aa]
          Length = 1928

 Score =  510 bits (1313), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 315/845 (37%), Positives = 490/845 (57%), Gaps = 57/845 (6%)

Query: 9   CWYPDKEQGWIGGE-----ITKHRLVGDKYQLDLT--LENGEVVEITAPSVEEGSCEELP 61
            W PD+++ ++ GE     I K++  G + Q+ +   L++ EV  +    +     +  P
Sbjct: 13  VWIPDEKEVFVKGELMSTDINKNKFTGQEEQIGIVHPLDSTEVSNLVQVRI----SDVFP 68

Query: 62  LLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLYS 121
           +  NP   +  E+++ L++LNEP+VL+ ++ RY    IYTYSG+ L+A NP+  ++ LYS
Sbjct: 69  V--NPSTFDKVENMSELTHLNEPSVLYNLEKRYDCDLIYTYSGLFLVAINPYHNLN-LYS 125

Query: 122 QDMIQAYAGRR------------RGELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAG 169
           +D I  Y  +               +L PH+FAIAEEAY  + +  ++Q+I+V+GESGAG
Sbjct: 126 EDHINLYHNKHNRLSKSRLDENSHEKLPPHIFAIAEEAYENLLSEGKDQSILVTGESGAG 185

Query: 170 KTVSAKYIMRYFATVEQ---SNLVGSGGS--MHHIEMSETEKKILATNPIMEAFGNAKTT 224
           KT + K I++Y A++     SN+    GS  +   EM     KIL +NPI+E+FGNA+T 
Sbjct: 186 KTENTKKILQYLASITSGSPSNIAPVSGSSIVESFEM-----KILQSNPILESFGNAQTV 240

Query: 225 RNDNSSRFGKYLEILFDKDISIIGARIRTYLLERSRLVFQPPSERNYHIFYQLLAGLPEE 284
           RN+NSSRFGK+++I F++   I GA I  YLLE+SR+V Q   ERNYHIFYQLL+GL + 
Sbjct: 241 RNNNSSRFGKFIKIEFNEHGMINGAHIEWYLLEKSRIVHQNSKERNYHIFYQLLSGLDDS 300

Query: 285 TKKELKLG--GVEEYHYMNQGGASEIQGVDDREEYAITTKALSLVDITERTQTALFKVLA 342
             K L+L    V++Y  ++      I G++D E +     AL+++  ++     +F+V+A
Sbjct: 301 ELKNLRLKSRNVKDYKILSNSNQDIIPGINDVENFKELLSALNIIGFSKDQIRWIFQVVA 360

Query: 343 ALLHIGNIDVKKTRNDASVSATDPSLEIACELLGIDAYNFAKWITKKQITTRSEKIVSNL 402
            +L IGNI+    R + +    D S    C  LG+D  +F   I + +     E +  + 
Sbjct: 361 IILLIGNIEFVSDRAEQASFKNDVS--AICSNLGVDEKDFQTAILRPRSKAGKEWVSQSK 418

Query: 403 NYGQAVVARDSVAKFIYSALFDWLVENIN-NVLCNPAVINEIASFIGVLDIYGFEHFEKN 461
           N  QA    +++++ +Y  LF ++V+ IN N+    A +N    +IG+LDI GFE FE N
Sbjct: 419 NSQQAKFILNALSRNLYERLFGYIVDMINKNLDHGSATLN----YIGLLDIAGFEIFENN 474

Query: 462 SFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIQWSFIEFN-DNQPCIDLIENK---L 517
           SFEQ CINY NEKLQQ FN H+F LEQ EY+KE IQW +I++  D Q  IDLIE+K    
Sbjct: 475 SFEQLCINYTNEKLQQFFNNHMFVLEQSEYLKENIQWDYIDYGKDLQLTIDLIESKGPPT 534

Query: 518 GILSLLDEESRLPAGSDETWTQKLYQTLDKPPTNTVFSKPRFGQTKFVVSHYAHDVAYDV 577
           G+L LLDEE+ LP  +DE++  KL  T D+  +    S+ + G   F++ HYA DV Y V
Sbjct: 535 GVLPLLDEEAVLPKSTDESFYSKLISTWDQNSSKFKRSRLKNG---FILKHYAGDVEYTV 591

Query: 578 EGFIEKNRDTVSDGHLEVLKGSTNETLLAILE-TIDRNAAKLAEKLESQKKPGPTTRTVN 636
           EG++ KN+D ++D  L +L  S N+ +  + +   +++++   E   S ++   + RT  
Sbjct: 592 EGWLSKNKDPLNDNLLSLLSSSQNDIISKLFQPEGEKSSSAGVEANISNQEVKKSARTST 651

Query: 637 RKPTLGSLFKQSLVELMSTINSTNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETI 696
            K T  S  ++  + L++ + ST+ H++RCI PN  K+   F+  ++L QLR  GVLE I
Sbjct: 652 FKTT-SSRHREQQITLLNQLASTHPHFVRCIIPNNVKKVKTFNRRLILDQLRCNGVLEGI 710

Query: 697 RISCAGFPTRWTYDEFALRYHILVPSTNWTKIFATGTTEEEINQLCKNILDTTVTDKEKY 756
           R++  G+P R  + EF  RY IL P  + T  F++   +    Q C+ +L +   D + Y
Sbjct: 711 RLAREGYPNRIAFQEFFQRYRILYPENSTTTTFSS-KLKASTKQNCEFLLTSLQLDTKVY 769

Query: 757 QLGNTKIFFKAGMLAFLEKKRTDKLNSSSTMIQKKIKGIYYRRRYLEITNAIKRTHSVAK 816
           ++GNTK+FFKAG+LA LEK++  KLN+    +   I+G   R+        +K+T  +  
Sbjct: 770 KIGNTKLFFKAGVLADLEKQKDVKLNNIMIKLTATIRGYTVRKEITYHLQKLKKTRVI-- 827

Query: 817 GNLLR 821
           GN  R
Sbjct: 828 GNTFR 832

>KLLA0E11572g complement(1018972..1024518) similar to sp|P08964
            Saccharomyces cerevisiae YHR023w MYO1 myosin-1 isoform
            (type II myosin) heavy chain, start by similarity
          Length = 1848

 Score =  493 bits (1269), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 370/1178 (31%), Positives = 620/1178 (52%), Gaps = 124/1178 (10%)

Query: 8    RCWYPDKEQGWIGGEITKHRLV----GDKYQLDLTLENGEVVEITAPSVEEGSCEELPLL 63
            + W  D+ + ++ G++ + ++V    G +  + +   NG+  E +   V   S       
Sbjct: 7    KVWVSDEREVFVQGQLVERKVVKNKQGQEQAVAVVSVNGKETEFSEDDV--ASV------ 58

Query: 64   RNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLYSQD 123
             NP   +  +DL+ L++LNE +VL  ++ RY    IYTYSG+ L+A NP+  + ++YS  
Sbjct: 59   -NPSTFDKVDDLSELTHLNEASVLFNLQNRYQDDLIYTYSGLFLVAINPYSNI-KIYSNS 116

Query: 124  MIQAYAGRRRGELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAGKTVSAKYIMRYFAT 183
             I+ Y G  + + +PH+FA+AE+AY  + + KQ+Q+I+V+GESGAGKT + K I++Y A+
Sbjct: 117  YIKLYHGSPKEDNKPHIFAVAEQAYQNLLHQKQDQSILVTGESGAGKTENTKKILQYLAS 176

Query: 184  VEQSNLVGSGGSMHHIEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKD 243
            +   + +    +    E     +KIL +NPI+E+FGNA+T RN+NSSRFGK+++I FD+ 
Sbjct: 177  ITTDDKILLNQTNESFE-----RKILQSNPILESFGNAQTVRNNNSSRFGKFIKIDFDEY 231

Query: 244  ISIIGARIRTYLLERSRLVFQPPSERNYHIFYQLLAGLPEETKKELKLGGVE-----EYH 298
              I GA I  YLLE+SR++     ERNYHIFYQ+L+G+   +K+EL+  G+E     +Y 
Sbjct: 232  GKINGAHIEWYLLEKSRVIQAHARERNYHIFYQILSGM---SKQELRAIGLESNSIVDYQ 288

Query: 299  YMNQGGASEIQGVDDREEYAITTKALSLVDITERTQTALFKVLAALLHIGNIDVKKTRND 358
            Y+     S I G+DD + Y     A   V  T+    ++ K ++ +LHIGN++    R++
Sbjct: 289  YLRHSNPS-IPGIDDGQNYQELVSAFETVGFTKDDIQSILKCISIILHIGNVEFVSERSE 347

Query: 359  ASVSATDPSLEIACELLGIDAYNFAKWITKKQITTRSEKIVSNLNYGQAVVARDSVAKFI 418
             +    D  ++  C+LLG+   +F   + K +     E +    N  QA    +S+++ +
Sbjct: 348  QASIKND--IKPLCKLLGVQEDDFKSAVLKPKSKAGKEWVSQAKNASQARSILNSLSRSL 405

Query: 419  YSALFDWLVENINNVLCNPAVINEIASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQE 478
            Y  LF+++V  IN  L + ++      FIG+LDI GFE F+ NSFEQ CINY NEKLQQ 
Sbjct: 406  YEKLFEYIVNQINKSLEHGSM---TEYFIGLLDIAGFEIFKDNSFEQLCINYTNEKLQQF 462

Query: 479  FNQHVFKLEQEEYVKEEIQWSFIEFN-DNQPCIDLIENK----LGILSLLDEESRLPAGS 533
            FN H+F LEQ EY KE+IQW+FI++  D Q  IDLIE K     GIL +L+EES LP  S
Sbjct: 463  FNHHMFVLEQNEYQKEDIQWNFIDYGKDLQTTIDLIEQKNSSIPGILPILEEESILPKSS 522

Query: 534  DETWTQKLYQTLDKPPTNTVFSKPRFGQTKFVVSHYAHDVAYDVEGFIEKNRDTVSDGHL 593
            D ++  KL  + D   T   F + +     F++ HYA DV Y+V  ++ KN+D +++  L
Sbjct: 523  DASFYSKLLSSWDNKSTK--FKRSKLDNC-FILKHYAGDVEYNVTDWLSKNKDPLNENLL 579

Query: 594  EVLKGSTNETLLAILETIDRNAAKLAEKLESQKKPGPTTRTVNRKPTLGSLFKQSLVELM 653
            +VL    N                L  +  + +  G + RT + K       ++ L  L+
Sbjct: 580  QVLNDCAN---------------PLVSQFFADRIRGSSFRTSSNK------HREQLHTLI 618

Query: 654  STINSTNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPTRWTYDEFA 713
              + +T+ H++RCI PN +K+A  FD  ++L QLR  GVLE IRI+  G+P R  + EF 
Sbjct: 619  EQLGNTDPHFVRCIIPNNKKKAGDFDKKLILDQLRCNGVLEGIRIARDGYPNRIFFKEFF 678

Query: 714  LRYHILVPSTNWTKIFATGTTEEEINQLCKNILDTTVTDKEKYQLGNTKIFFKAGMLAFL 773
             RY IL     +T               C+ +L +   D   Y++GNTK+FFKAG+LA L
Sbjct: 679  QRYKILSDECRFTNNSKKN---------CEILLSSLHLDPTIYKVGNTKLFFKAGVLANL 729

Query: 774  EKKRTDKLNSSSTMIQKKIKGIYYRRRYLEITNAIKRTHSVAKGNLLRARI-DLEFKTWA 832
            E  +  +L+++ T +   I     R+   EI + +K+        L  ARI  + F+T+ 
Sbjct: 730  ELLKEQRLSAAVTRLNAIISANSVRK---EIRSHLKK--------LQAARILKVTFETYD 778

Query: 833  AITIQSLYRGSLIRRDTIHLLDS---IIRTQSL------LRRSLARKELRARLETDAAIT 883
             +     Y    +    + LLDS   I++T+ +      L   LA  E    +  DA   
Sbjct: 779  RLMENPWYN---LYMKLLPLLDSSNTILKTKKIAEQVKQLENKLAESEKSTTVMVDAKRL 835

Query: 884  IQKNIRAFKP----RTSYITNRRSTIVVQSLVRRRFAKRKLETLKQEAKSVSHLKEVSYK 939
            +++ +   K      TS +   +  +      + +  ++  ETL  +    +   E+S +
Sbjct: 836  VEQELEKVKALLLKETSELQQSQELLEATKTKQIQIQQKWDETLSIKDSLETENLELSKE 895

Query: 940  LENKVIELTESL-AAKVKENK--DLNSRIKELQLSLNESANIRELLKTKQEEYRKSIDQQ 996
             +N  +EL ++  A+ + E+K  +L+   ++L++++NE  N  +++K  +    +++D +
Sbjct: 896  ADNLRLELEKTKNASDLSEDKFRELSHDKEKLEITVNELKNKLDVVKNDE----RALDSE 951

Query: 997  KDTHAAAYEEVTGRLTLAMKEVDDARQEIDQLKSKQEDLKLEVKAKIEELSKVRQDLSDS 1056
            KD       ++   ++   KE+ +    +  +++K  D ++ +  K++ L K     S+ 
Sbjct: 952  KD-------KLIREISDLKKEIQEKTMSLKDMEAKVNDSEIAIDVKLKSLEKHLAATSNR 1004

Query: 1057 RT----QNSDLSNEVSSLKEEIARLHNAIRNAPATGTLSPTRSKRISSYSGLDNIGSPKQ 1112
                  +N+ L+ +V SLK +IA  ++   N  A   L+    K     S ++++   K+
Sbjct: 1005 MKGFFEENTQLAAQVKSLKNDIATKNSLFENKSA--ELNRVNVKVSEQESMVNSLSKEKE 1062

Query: 1113 ---WNVVSLNNGL--MEEETRSIMSQLSQINDELYKLL 1145
                 V+SL+  L  + +E  S   +L  IN+E  KLL
Sbjct: 1063 SLLIQVLSLSKELKAVRQENDSNKCKLESINEEYSKLL 1100

>CAGL0J00693g complement(61246..66900) similar to sp|P08964
            Saccharomyces cerevisiae YHR023w MYO1, hypothetical start
          Length = 1884

 Score =  461 bits (1187), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 361/1175 (30%), Positives = 578/1175 (49%), Gaps = 156/1175 (13%)

Query: 8    RCWYPDKEQGWIGGEITKHRLVGDKY-----QLDLTLEN--GEVVEITAPSVEEGSCEEL 60
            R W PD  + ++ G++    +V DK+     Q+ L  ++  GE        +        
Sbjct: 6    RVWVPDPVEIFVRGDLLNTDIVKDKFTGVEQQVGLVKKDNDGETATFKISEI-------F 58

Query: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLY 120
            P+  NP   +  ++++ L++LNEP+VL+ ++ RY    IYTYSG+ L+A NP+  +  LY
Sbjct: 59   PV--NPANFDRVDNMSELTHLNEPSVLNNLENRYKDNLIYTYSGLFLVAINPYKEISNLY 116

Query: 121  SQDMIQAY-AGRRRGELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAGKTVSAKYIMR 179
            S   I++Y +       +PH+F +AE AY  +K+ KQ+Q+I+V+GESGAGKT + K I++
Sbjct: 117  SNSTIKSYHSSNEETSQKPHIFEVAESAYRDLKSKKQDQSILVTGESGAGKTENTKKILQ 176

Query: 180  YFATVEQSNLVGSGGSMHHIEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEIL 239
            Y A++   +   S            E KIL +NP++E+FGNA+T RN+NSSRFGK+++I 
Sbjct: 177  YLASITSDSFEVSNN---------FEMKILQSNPVLESFGNAQTVRNNNSSRFGKFIKIE 227

Query: 240  FDKDISIIGARIRTYLLERSRLVFQPPSERNYHIFYQLLAGLPEETKKEL-KLGGVEEYH 298
            FD+   I GA I  YLLE+SR+  +  +ERNYHIFYQLL G  ++  + + KL   +  H
Sbjct: 228  FDQSGKINGAFIEWYLLEKSRITNENRNERNYHIFYQLLKGTSQKDLESIYKLSSNDFAH 287

Query: 299  YMNQGGASE-IQGVDDREEYAITTKALSLVDITERTQTALFKVLAALLHIGNIDVKKTRN 357
            Y     ++  I GVDD  E+     AL  V   +    ++FK++A +LH GNI+    ++
Sbjct: 288  YQILANSNHVIPGVDDAAEFQKLLVALETVGFGKDQINSIFKIVAVILHCGNIEFVSEKS 347

Query: 358  DASVSATDPSLEIACELLGIDAYNFAKWITKKQITTRSEKIVSNLNYGQAVVARDSVAKF 417
            + +   +D S  IA  LLG+   +F   I K +     E +    N  QA    +S+ + 
Sbjct: 348  EQASFKSDISA-IAT-LLGVSESDFKTAILKPRSKAGREWVSQAKNANQARFIINSLCRT 405

Query: 418  IYSALFDWLVENINNVLCNPAVINEIASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQ 477
            +Y  LF ++V+ IN  L + ++    A++IG+LDI GFE FE NSFEQ CINY NEKLQQ
Sbjct: 406  LYEHLFGYIVDTINMSLNHGSM---TANYIGLLDIAGFEIFEHNSFEQLCINYTNEKLQQ 462

Query: 478  EFNQHVFKLEQEEYVKEEIQWSFIEFN-DNQPCIDLIENK---LGILSLLDEESRLPAGS 533
             FN H+F LEQ EY+KE IQW ++++  D Q  I+L+E K    GIL LLDEE+ LP   
Sbjct: 463  FFNHHMFVLEQSEYLKENIQWDYVDYGKDLQSTINLLEAKGPPTGILPLLDEETILPKSE 522

Query: 534  DETWTQKLYQTLDKPPTNTVFSKPRFGQTKFVVSHYAHDVAYDVEGFIEKNRDTVSDGHL 593
            D ++  KL  T  +  T   F + +     FV+ HYA DV Y V G++ KN+D +++  +
Sbjct: 523  DSSFYSKLISTWQQNSTK--FKRSKLDMC-FVLKHYAGDVEYHVNGWLAKNKDPLNENLV 579

Query: 594  EVLKGSTNETLLAILETID------RNAAKLAEKLESQKKPGPTTRTVNRKPTLGSLFKQ 647
             +L  S+N  +       +       +  +L     S           N K  L S  ++
Sbjct: 580  NILSVSSNRLISEFFSGFESISSPSSSPTRLTHSSSSASINSLGKGRTNLKTAL-SRHRE 638

Query: 648  SLVELMSTINSTNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPTRW 707
                L+S +  TN H++RCI PN +K +  FD  ++L QLR  GVLE IRI+  G+P R 
Sbjct: 639  QQSSLLSQLALTNPHFVRCIIPNNKKMSETFDRRLILDQLRCNGVLEGIRIAREGYPNRI 698

Query: 708  TYDEFALRYHILVPSTNWTKIFATGTTEEEIN--QLCKNILDTTVTDKEKYQLGNTKIFF 765
             + EF  RY IL    +         + + IN  Q  + ++     D   Y++G +K+FF
Sbjct: 699  LFKEFYERYRILSEHLD--------KSSDAINYKQSSQILISELHLDPTTYKVGTSKLFF 750

Query: 766  KAGMLAFLEKKRTDKLNSSSTMIQKKIKGIYYRRR------------------------- 800
            KAG LA LE K+   L   +      I+G   R+R                         
Sbjct: 751  KAGTLAELESKKESILFEITVRFNSIIRGWSQRKRTKGEIQKMRASEMIGNVFRKYNEKM 810

Query: 801  -------YLEITNAIKRTHSVAKGNLLRARID-LEFKTWAAITIQSLYRGSLIRRDTIHL 852
                   Y++I   +  + ++        +I  LE K  A  T + ++       D ++ 
Sbjct: 811  QDPWFNMYMKIKPLLASSQNIVDSRKYTEKIKVLEQKLTAVETEKKIHTAK--HNDLLNE 868

Query: 853  LDSIIRTQSLLRRSLARKELRARLETDAAITIQKNIRAFKPRTSYITNRRSTIVVQ---- 908
            L+ +     + +  L R E       +    I+  I+  +   S + + +   + +    
Sbjct: 869  LNDVKNLLDVEKEKLKRNEQLLSKSNEQQREIETMIKEIREDKSTLLSEKEAAISKIQEL 928

Query: 909  SLVRRRFAK-------------RKLETLKQE----AKSVSHLKEVSYKLENKVIE---LT 948
             LVR++  +             RKL +L+ E     + +S   EV  KLEN+ +E   + 
Sbjct: 929  ELVRQKLEEKNNEKDASIAELTRKLSSLESEKGDITRQISMDTEVLKKLENEKMEKERVI 988

Query: 949  ESLAAKVKE---------------NKDLNSRIKELQLSLNESANIRELLKTKQEEYRKSI 993
            E L+  +KE               NKDL+ +++ L+ + N +    + L  +  E R+ +
Sbjct: 989  EKLSHDIKERDHIIDELKQKEHISNKDLDIKLQTLEKNCNVALTKLKSLLNENAELREEV 1048

Query: 994  DQQKDTHAAAYEEVTGRLTLAMKEVDDARQEIDQLKSKQEDLKLEVKAKIEELSKVRQDL 1053
             + K  HA   ++V+ +            +EI++LK++        + +I E+ K R  L
Sbjct: 1049 GKNKKLHANTIQQVSSK-----------EKEIERLKAR----FASNQGEINEILKQRDSL 1093

Query: 1054 SDSRTQNSDLSNEVSSLK-------EEIARLHNAI 1081
                 +N  LS E+S +K       E  A++ N I
Sbjct: 1094 ---MAENDKLSKELSEMKMALRKANENYAQMKNQI 1125

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 58/247 (23%), Positives = 112/247 (45%), Gaps = 27/247 (10%)

Query: 923  LKQEAKSVSHLKEVSYKLENKVIELTESLAAKVKENKDLNSRIKELQLSLNESANIRELL 982
            LKQ    +  +  V  KL++   +  +++  +  E  DL+ +++E  L L    ++ +LL
Sbjct: 1461 LKQAEDDIKGMATVIEKLKSSNKQKDKTIWDRETEKNDLDMQLQETLLELKRVQDMNQLL 1520

Query: 983  KTKQEEYRKSIDQQKDTHAAAYEEVTGRLTLAMKEVD----DARQEIDQLKSKQEDLKLE 1038
            +T    +++ ++   D   + Y     RL  A+ E      + ++EI  LK K E LK +
Sbjct: 1521 QTDVHHFKERLNTSSD--VSRYTNEIERLKEALDESSKYSGEFKKEISTLKYKLETLKND 1578

Query: 1039 VKAKIEELSKVRQ-------DLSDSRTQNS----DLSNEVSSLKEEIARLHNAIRNAPAT 1087
             +AKIE L K  +        L + R +N     DL+ ++  ++  + +L++        
Sbjct: 1579 SEAKIEHLLKQSEHYETIVGQLGEERDENQEIIKDLNQKLIDMESNLKKLNDDYEALSQQ 1638

Query: 1088 GTLSPTRSKRISSYSGLDNIGSPKQWNV-----VSLNNGLME-EETRSIMSQLSQINDEL 1141
                   S R+ S  G     S +Q+N      V +N+ L   EET  + ++ ++ N++L
Sbjct: 1639 RDTLLQESDRLRSELG----NSTEQFNATVKHNVDVNDKLRNLEETLRLQTEQNERNEQL 1694

Query: 1142 YKLLNDD 1148
             K +  D
Sbjct: 1695 VKSIQMD 1701

>KLLA0B12562g complement(1095953..1099735) similar to sp|Q04439
           Saccharomyces cerevisiae YMR109w MYO5 myosin I, start by
           similarity
          Length = 1260

 Score =  441 bits (1135), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 273/750 (36%), Positives = 409/750 (54%), Gaps = 55/750 (7%)

Query: 71  ATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLYSQDMIQAYAG 130
              DLT LS +++ A+   +K R+    IYTY G VLI+ NPF R   +Y+  ++++Y G
Sbjct: 35  GVSDLTLLSSISDDAINQNLKKRFENGTIYTYIGHVLISVNPF-RDLGIYTDAVLESYKG 93

Query: 131 RRRGELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAGKTVSAKYIMRYFATVEQSNLV 190
           + R E+ PH+FAIAE  Y  +K   +NQ +++SGESGAGKT +AK IM+Y A        
Sbjct: 94  KNRLEVPPHVFAIAEAMYYNLKAYNENQCVIISGESGAGKTEAAKRIMQYIA-------- 145

Query: 191 GSGGSMHHIEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDISIIGAR 250
            +  S H   + + +  +LATNP++E+FG AKT RN+NSSR GKYLEI F++       +
Sbjct: 146 -AASSTHEASIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNEQFEPCAGQ 204

Query: 251 IRTYLLERSRLVFQPPSERNYHIFYQLLAGLPEETKKELKLGGVEEYHYMNQGGASEIQG 310
           I  YLLE+ R+V Q  +ERN+HIFYQ   G  +  ++   +   ++Y Y +  G + +  
Sbjct: 205 ITNYLLEKQRVVGQIRNERNFHIFYQFTKGASDTYRQNFGVLQPDQYIYTSASGCTSVDT 264

Query: 311 VDDREEYAITTKALSLVDITERTQTALFKVLAALLHIGNIDVKKTRNDASVSATDPSL-E 369
           +DD  +Y  T KA+ ++ +++  Q  +F++L+A+L IGN+   +  N+ +    D S+ +
Sbjct: 265 IDDLHDYQETIKAMQVIGLSQEEQDQIFRMLSAILWIGNVTFVEN-NEGNAEVRDTSVTD 323

Query: 370 IACELLGIDAYNFAKWITKKQITT-----RSEKIVSNLNYGQAVVARDSVAKFIYSALFD 424
               L+ +D+    K + ++ + T     R       LN  QA   RD++AK IY+ LFD
Sbjct: 324 FVAYLMQVDSGLLIKCLVERVMETGHGSRRGSVYHVPLNVVQATAVRDALAKAIYNNLFD 383

Query: 425 WLVENINNVL-CNPAVINEIASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV 483
           W+V+ +N  L   P  +      IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q  
Sbjct: 384 WIVDRVNVSLKAFPGAVKS----IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLT 439

Query: 484 FKLEQEEYVKEEIQWSFIEFNDNQPCIDLIENKL--GILSLLDEESRLPAGSDETWTQKL 541
            K EQEEY KE+IQW+ I++ DN+   DLIE+K   GI + LD+             Q  
Sbjct: 440 LKSEQEEYNKEQIQWTPIKYFDNKVVCDLIESKRPPGIFATLDDSVATAHADSNAADQAF 499

Query: 542 YQTLDKPPTNTVFSKPRFGQTKFVVSHYAHDVAYDVEGFIEKNRDTVSDGHLEVLKGSTN 601
            Q L+   TN  F       +KFV+ HYA DV YD+ G  +KN+D +     E+++ +TN
Sbjct: 500 AQRLNLFSTNAHFD---LRSSKFVIKHYAGDVTYDISGMTDKNKDQLVKDLAELVQTTTN 556

Query: 602 ETLLAIL-ETIDRNAAKLAEKLESQKKPGPTTRTVNRKPTLGSLFKQSLVELMSTINSTN 660
             L  I  +TID+++ +                   R PT G+   +S  EL+ T++   
Sbjct: 557 PFLSTIFPDTIDKSSKR-------------------RPPTAGNKIIKSANELVETLSKAQ 597

Query: 661 VHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPTRWTYDEFALRYHILV 720
             YIR IKPN+ K    +D+  VL Q++  G+ E +RI  AGF  R T+++F  R+++L 
Sbjct: 598 PSYIRTIKPNQTKSPRDYDDQQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERFYLLS 657

Query: 721 PSTNWTKIFATGTTEEEINQLCKNILDTTVTDKEKYQLGNTKIFFKAGMLAF-LEKKRTD 779
           P  ++   +   T + +     K IL        +YQLG TK+F K     F LE  R  
Sbjct: 658 PKCSYAGDY---TWQGDTLGAVKQILQDASIPTTEYQLGVTKVFIKTPETLFALEHMRDR 714

Query: 780 KLNSSSTMIQKKIKGIYYRRRYLEITNAIK 809
              + +  IQ+  +    RR    I +AIK
Sbjct: 715 YWYNMAARIQRAWRRFIQRR----IDSAIK 740

>YMR109W (MYO5) [4066] chr13 (486586..490245) Myosin type I, may
           play a role in cell growth or polarity that is partially
           redundant with Myo3p, appears to stimulate actin patch
           formation, has an SH3 domain [3660 bp, 1219 aa]
          Length = 1219

 Score =  433 bits (1113), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 272/752 (36%), Positives = 405/752 (53%), Gaps = 53/752 (7%)

Query: 71  ATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLYSQDMIQAYAG 130
              DLT LS +++ A+   +K R+    IYTY G VLI+ NPF R   +Y+  ++  Y G
Sbjct: 37  GVSDLTLLSKISDEAINENLKKRFLNATIYTYIGHVLISVNPF-RDLGIYTDAVMNEYKG 95

Query: 131 RRRGELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAGKTVSAKYIMRYFATVEQSNLV 190
           + R E+ PH+FAIAE  Y  MK+  +NQ +++SGESGAGKT +AK IM+Y A        
Sbjct: 96  KNRLEVPPHVFAIAESMYYNMKSYNENQCVIISGESGAGKTEAAKRIMQYIA-------- 147

Query: 191 GSGGSMHHIEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDISIIGAR 250
            +  S H   + + +  +LATNP++E+FG AKT RN+NSSR GKYLEI F+         
Sbjct: 148 -AASSTHTESIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNNQFEPCAGN 206

Query: 251 IRTYLLERSRLVFQPPSERNYHIFYQLLAGLPEETKKELKLGGVEEYHYMNQGGASEIQG 310
           I  YLLE+ R+V Q  +ERN+HIFYQ   G  +  ++   +   E+Y Y    G    + 
Sbjct: 207 ITNYLLEKQRVVSQIKNERNFHIFYQFTKGASDAYRQTFGVQKPEQYVYTAAAGCISAET 266

Query: 311 VDDREEYAITTKALSLVDITERTQTALFKVLAALLHIGNID-VKKTRNDASVSATDPSLE 369
           +DD ++Y  T KA+ ++ + +  Q  +F++LAA+L IGN+  ++    +A V  T  + +
Sbjct: 267 IDDLQDYQETLKAMRVIGLGQEEQDQIFRMLAAILWIGNVSFIENEEGNAQVRDTSVT-D 325

Query: 370 IACELLGIDAYNFAKWITKKQITT-----RSEKIVSNLNYGQAVVARDSVAKFIYSALFD 424
               LL ID+    K + ++ + T     R       LN  QA   RD++AK IY+ LFD
Sbjct: 326 FVAYLLQIDSQLLIKSLVERIMETNHGMKRGSVYHVPLNIVQADAVRDALAKAIYNNLFD 385

Query: 425 WLVENINNVLCNPAVINEIASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVF 484
           W+V  +N  L            IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   
Sbjct: 386 WIVSRVNKSL---QAFPGAEKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTL 442

Query: 485 KLEQEEYVKEEIQWSFIEFNDNQPCIDLIENKL--GILSLLDEESRLPAGSDETWTQKLY 542
           K EQE Y +E+IQW+ I++ DN+   DLIE +   GI + +++             Q   
Sbjct: 443 KSEQETYEREKIQWTPIKYFDNKVVCDLIEARRPPGIFAAMNDSVATAHADSNAADQAFA 502

Query: 543 QTLDKPPTNTVFSKPRFGQTKFVVSHYAHDVAYDVEGFIEKNRDTVSDGHLEVLKGSTNE 602
           Q L+   TN  F        KFV+ HYA DV YD++G  +KN+D +    +E++ G+T  
Sbjct: 503 QRLNLFTTNPHFD---LRSNKFVIKHYAGDVTYDIDGITDKNKDQLQKDLVELI-GTTTN 558

Query: 603 TLLAIL--ETIDRNAAKLAEKLESQKKPGPTTRTVNRKPTLGSLFKQSLVELMSTINSTN 660
           T LA +  +T+DR         ES+++P          PT G    +S  +L+ T++   
Sbjct: 559 TFLATIFPDTVDR---------ESKRRP----------PTAGDKIIKSANDLVETLSKAQ 599

Query: 661 VHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPTRWTYDEFALRYHILV 720
             YIR IKPNE K    +D+  VL Q++  G+ E +RI  AGF  R  +++F  R+++L 
Sbjct: 600 PSYIRTIKPNETKSPNDYDDRQVLHQIKYLGLQENVRIRRAGFAYRQVFEKFVERFYLLS 659

Query: 721 PSTNWTKIFATGTTEEEINQLCKNILDTTVTDKEKYQLGNTKIFFKAGMLAF-LEKKRTD 779
           P  ++   +   T + +     K IL  +   +++YQLG T +F K     F LE  R  
Sbjct: 660 PHCSYAGDY---TWQGDTLDAVKYILQDSSIPQQEYQLGVTSVFIKTPETLFALEHMRDR 716

Query: 780 KLNSSSTMIQKKIKGIYYRRRYLEITNAIKRT 811
             ++ +  IQ+  +    RR  ++    I+RT
Sbjct: 717 YWHNMAARIQRAWRRFLQRR--IDAATKIQRT 746

>Kwal_26.7587
          Length = 1250

 Score =  431 bits (1109), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 270/761 (35%), Positives = 411/761 (54%), Gaps = 57/761 (7%)

Query: 71  ATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLYSQDMIQAYAG 130
              DLT LS +++ A+   +K R+    IYTY G VLI+ NPF R   +Y+  ++++Y G
Sbjct: 37  GVSDLTLLSKISDEAINENLKKRFQNGTIYTYIGHVLISVNPF-RDLGIYTDSVLRSYVG 95

Query: 131 RRRGELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAGKTVSAKYIMRYFATVEQSNLV 190
           + R E+ PH+FAIAE  Y  MK   +NQ +++SGESGAGKT +AK IM+Y A   ++   
Sbjct: 96  KNRLEVAPHVFAIAESMYYNMKAYNENQCVIISGESGAGKTEAAKRIMQYIAAASET--- 152

Query: 191 GSGGSMHHIEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDISIIGAR 250
                 H   + + +  +LATNP++E+FG AKT RN+NSSR GKYLEI F+         
Sbjct: 153 ------HSDSIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNAQFEPCAGN 206

Query: 251 IRTYLLERSRLVFQPPSERNYHIFYQLLAGLPEETKKELKLGGVEEYHYMNQGGASEIQG 310
           I  YLLE+ R+V Q   ERN+HIFYQ   G  +  ++   +   E+Y Y +  G + +  
Sbjct: 207 ITNYLLEKQRVVGQLKDERNFHIFYQFTKGASDNYRQIYGVQKPEQYLYTSASGCTSVDT 266

Query: 311 VDDREEYAITTKALSLVDITERTQTALFKVLAALLHIGNIDVKKTRNDASVSATDPSL-E 369
           +DD  ++  T  A+S++ IT+  Q  +F+ LAA+L IGNI   +   + +    D S+ +
Sbjct: 267 IDDLSDFQETLNAMSVIGITQHEQDEVFRFLAAILWIGNISFTENE-EGNAQVRDTSVTD 325

Query: 370 IACELLGIDAYNFAKWITKKQITT-----RSEKIVSNLNYGQAVVARDSVAKFIYSALFD 424
               LL +D+    + + ++ + T     R       LN  QA   +D++AK IY+ LFD
Sbjct: 326 FVAYLLQVDSNLLVQALVERVMETNHGMKRGSIYHVPLNVVQATAVKDALAKAIYNNLFD 385

Query: 425 WLVENINNVLCNPAVINEIASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVF 484
           W V+ +N  L      N+    IG+LDIYGFE F+ NSFEQ CINY NEKLQQ F Q   
Sbjct: 386 WTVDRVNLSLQALPGANKS---IGILDIYGFEIFDYNSFEQICINYVNEKLQQIFIQLTL 442

Query: 485 KLEQEEYVKEEIQWSFIEFNDNQPCIDLIENKL--GILSLLDEESRLPAGSDETWTQKLY 542
           K EQEEY +E+I+W+ I++ DN+   DLIE +   GI++ +++         +   Q   
Sbjct: 443 KSEQEEYAREQIEWTPIKYFDNRVVCDLIEARRPPGIIAAMNDSVATAHADSDAADQAFA 502

Query: 543 QTLDKPPTNTVFSKPRF--GQTKFVVSHYAHDVAYDVEGFIEKNRDTVSDGHLEVLKGST 600
           Q L     N   S P F    +KF++ HYA DV YD+ G  +KN+D +    +E++K S+
Sbjct: 503 QRL-----NLFSSNPHFELRSSKFIIKHYAGDVTYDIFGMTDKNKDQLQKDLVELVKTSS 557

Query: 601 NETLLAILET-IDRNAAKLAEKLESQKKPGPTTRTVNRKPTLGSLFKQSLVELMSTINST 659
           NE L ++  T +D+N+ +                   R P+ G    +S  EL+ T++  
Sbjct: 558 NEFLCSLFPTVVDKNSKR-------------------RPPSAGDKIIKSANELVETLSKA 598

Query: 660 NVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPTRWTYDEFALRYHIL 719
              YIR IKPN+ K    +D+  VL Q++  G+ E +RI  AGF  R  +D+F  R+++L
Sbjct: 599 QPSYIRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQVFDKFVERFYLL 658

Query: 720 VPSTNWTKIFA-TGTTEEEINQLCKNILDTTVTDKEKYQLGNTKIFFKAGMLAF-LEKKR 777
            P  ++   +   G T E +  + K   D ++   E YQLG +K+F K     F LE  R
Sbjct: 659 SPQCSYAGDYTWQGDTLEAVKLILK---DASIPPTE-YQLGVSKVFIKTPESLFALETMR 714

Query: 778 TDKLNSSSTMIQKKIKGIYYRRRYLEITNAIKRTHSVAKGN 818
               ++ +  IQ+  +    RR  ++  + I+R     KG 
Sbjct: 715 DKYWHNMAARIQRAWRRFLLRR--IDAASRIQRAIREKKGG 753

>CAGL0K07590g 748352..752110 highly similar to sp|P36006
           Saccharomyces cerevisiae YKL129c or sp|Q04439
           Saccharomyces cerevisiae YMR109w myosin like proteins,
           start by similarity
          Length = 1252

 Score =  430 bits (1106), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 293/819 (35%), Positives = 416/819 (50%), Gaps = 85/819 (10%)

Query: 71  ATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLYSQDMIQAYAG 130
              DLT LS +++ ++   +K R+    IYTY G VLI+ NPF R   +Y+ D +++Y G
Sbjct: 37  GVSDLTLLSKISDESINDNLKKRFEHGIIYTYIGYVLISVNPF-RDLGIYTDDTMKSYQG 95

Query: 131 RRRGELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAGKTVSAKYIMRYFATVEQSNLV 190
           + R E  PH+FAIAE  Y  +K+  +NQ +++SGESGAGKT +AK IM+Y A        
Sbjct: 96  KNRLEAPPHVFAIAENMYYNLKSYNENQCVIISGESGAGKTEAAKRIMQYIAAT------ 149

Query: 191 GSGGSMHHIEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDISIIGAR 250
               S H   +S+ +  +LATNP++E+FG AKT RN+NSSR GKYLEI FD         
Sbjct: 150 ---SSTHSESISKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFDAHFQPCAGH 206

Query: 251 IRTYLLERSRLVFQPPSERNYHIFYQLLAGLPEETKKELKLGGVEEYHYMNQGGASEIQG 310
           I  YLLE+ R+V Q  +ERN+HIFYQ   G PEE ++   +   E+Y Y +    + ++ 
Sbjct: 207 ITNYLLEKQRVVGQIKNERNFHIFYQFTKGAPEEYRQLFGVQQPEQYIYTSASQCTAVEN 266

Query: 311 VDDREEYAITTKALSLVDITERTQTALFKVLAALLHIGNIDV-------KKTRNDASVSA 363
           +DD EE+  T  A+  + +T+  Q  +F+ LAA+L IGNI          + R+ +  + 
Sbjct: 267 MDDVEEFNETLNAMRTIGLTKSEQDQIFRALAAILWIGNISFVENEAGNAEIRDKSVTTF 326

Query: 364 TDPSLEIACELLGIDAYNFAKWITKKQITTRSEKIVSNLNYGQAVVARDSVAKFIYSALF 423
               LE+  ELL I A    + I       R     S LN  QA   RD++AK IY+ LF
Sbjct: 327 VAYLLEVQEELL-IKAL-IERIIETTHGAKRGSTYHSPLNIIQATAVRDALAKAIYNNLF 384

Query: 424 DWLVENINNVLCNPAVINEIASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV 483
           +W+VE +NN L            IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q  
Sbjct: 385 EWIVERVNNSL---QAFPGADKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLT 441

Query: 484 FKLEQEEYVKEEIQWSFIEFNDNQPCIDLIENKL--GILSLLDEESRLPAGSDETWTQKL 541
            K EQ+ Y KE+I W+ IE+ DN+   DLIE K   GI + +++         +   Q  
Sbjct: 442 LKSEQDTYKKEQIHWTPIEYFDNKIVCDLIEAKRPPGIFAAMNDAIATAHADSDAADQAF 501

Query: 542 YQTLDKPPTNTVFSKPRFGQTKFVVSHYAHDVAYDVEGFIEKNRDTVSDGHLEVLKGSTN 601
            Q L+   TN  F      Q KFVV HYA DV YD+ G  +KN+D +    +E+L  ++N
Sbjct: 502 AQRLNLFTTNPHF---ELRQNKFVVKHYAGDVTYDIFGITDKNKDQLQKDLVELLSTTSN 558

Query: 602 ETLLAILETIDRNAAKLAEKLESQKKPGPTTRTVNRKPTLGSLFKQSLVELMSTINSTNV 661
             +  I                      P T +  R PT G    +S  EL+ T++    
Sbjct: 559 SFVREIFPD------------------QPQTDSRRRPPTSGDKIIKSANELVETLSKAQP 600

Query: 662 HYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPTRWTYDEFALRYHILVP 721
            YIR IKPN+ K +  +D+  VL Q++  G+ E +RI  AGF  R  +++F  R+++L P
Sbjct: 601 SYIRTIKPNDTKSSTIYDDQRVLHQIKYLGLKENVRIRRAGFAHRQVFEKFVERFYLLSP 660

Query: 722 STNWTKIFA-TGTTEEEINQLCKNILDTTVTDKEKYQLGNTKIFFKAGMLAF-LEKKRTD 779
             ++   +   G T + +    K IL        +Y++G T+IF K     F LE  R  
Sbjct: 661 QCSYAGDYVWDGETLDAV----KLILQDASIPTTEYEIGVTQIFIKHPETLFALENMRDK 716

Query: 780 KLNSSSTMIQKKIKGIYYRRRYLEITNAIKRTHSVAKGNLLRARIDLEFKTWAAITIQSL 839
              + +  IQ+        RRYL+                   RID      AAI IQ+ 
Sbjct: 717 YWYNMAARIQRAW------RRYLQ------------------KRID------AAIRIQNA 746

Query: 840 YRG----SLIRRDTIHLLDSIIRTQSLLRRSLARKELRA 874
            RG    S  R D +      +      RR+++   LR 
Sbjct: 747 IRGKSGVSTFRNDELRNAGDKVYGGKKERRNMSLLGLRG 785

>Scas_721.119
          Length = 1232

 Score =  426 bits (1096), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 268/732 (36%), Positives = 393/732 (53%), Gaps = 55/732 (7%)

Query: 71  ATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLYSQDMIQAYAG 130
              DLT LS +++  +   +K R+    IYTY G VLI+ NPF R   +Y+  ++++Y G
Sbjct: 37  GVSDLTLLSKISDETINDNLKKRFMNGTIYTYIGHVLISVNPF-RDLGIYTDAIVESYKG 95

Query: 131 RRRGELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAGKTVSAKYIMRYFATVEQSNLV 190
           + R E+ PH+FAIAE  Y  MK+  +NQ +++SGESGAGKT +AK IM+Y A        
Sbjct: 96  KNRLEVPPHVFAIAESMYYNMKSYNENQCVIISGESGAGKTEAAKRIMQYIA-------- 147

Query: 191 GSGGSMHHIEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDISIIGAR 250
            S  + H   + + +  +LATNP++E+FG AKT RN+NSSR GKYLEI F+         
Sbjct: 148 -SASTTHSESIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNSQFEPCAGN 206

Query: 251 IRTYLLERSRLVFQPPSERNYHIFYQLLAGLPEETKKELKLGGVEEYHYMNQGGASEIQG 310
           I  YLLE+ R+V Q  +ERN+HIFYQ   G  +  ++   +   E+Y Y +  G + +  
Sbjct: 207 ITNYLLEKQRVVSQIKNERNFHIFYQFTKGASDAYRQTFGVQKPEQYIYTSASGCTSVDT 266

Query: 311 VDDREEYAITTKALSLVDITERTQTALFKVLAALLHIGNID-VKKTRNDASVSATDPSLE 369
           +DD  +Y  T KA+ ++ + +  Q  +F++LAA+L IGN+  V+    +A V  T  + +
Sbjct: 267 IDDVNDYRETLKAMEVIGLHQEEQDQIFRMLAAVLWIGNVSFVENEEGNAQVRDTSVT-D 325

Query: 370 IACELLGIDAYNFAKWITKKQITT-----RSEKIVSNLNYGQAVVARDSVAKFIYSALFD 424
               LL IDA    K + ++ + T     R       LN  QA   RD++AK IY+ LF+
Sbjct: 326 FVAYLLQIDAPLLIKSLVERVMETNHGMRRGSVYHVPLNIVQATAVRDALAKAIYNNLFE 385

Query: 425 WLVENINNVL-CNPAVINEIASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV 483
           W+V  +N  L   P         IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q  
Sbjct: 386 WIVGRVNVSLQAYPGADRS----IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLT 441

Query: 484 FKLEQEEYVKEEIQWSFIEFNDNQPCIDLIENK--LGILSLLDEESRLPAGSDETWTQKL 541
            K EQE Y +E+I+W+ I++ DN+   DLIE K   GI + +++             Q  
Sbjct: 442 LKSEQETYKREKIKWTPIKYFDNKVVCDLIEAKRPPGIFAAMNDSVATAHADSNAADQAF 501

Query: 542 YQTLDKPPTNTVFSKPRF--GQTKFVVSHYAHDVAYDVEGFIEKNRDTVSDGHLEVLKGS 599
            Q L     N   S P F     KFV+ HYA DV YDV G  +KN+D +    +E++  +
Sbjct: 502 AQRL-----NMFSSNPHFELRSNKFVIKHYAGDVTYDVNGITDKNKDQLQKDLVELIATT 556

Query: 600 TNETLLAILET-IDRNAAKLAEKLESQKKPGPTTRTVNRKPTLGSLFKQSLVELMSTINS 658
           TN  L  I    +D+         ES+++P          PT G    +S  EL+ T++ 
Sbjct: 557 TNPFLSGIFPVEVDK---------ESKRRP----------PTAGDKIIKSANELVETLSK 597

Query: 659 TNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPTRWTYDEFALRYHI 718
               YIR IKPN+ K    +D+  VL Q++  G+ E +RI  AGF  R T+++F  R+++
Sbjct: 598 AQPSYIRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERFYL 657

Query: 719 LVPSTNWTKIFATGTTEEEINQLCKNILDTTVTDKEKYQLGNTKIFFKAGMLAF-LEKKR 777
           L P  ++   +   T + E     ++IL+       +YQLG T +F K     F LE  R
Sbjct: 658 LSPHCSYAGDY---TWQGETLDAVQHILNDASIPASEYQLGTTSVFIKTPETLFALEHMR 714

Query: 778 TDKLNSSSTMIQ 789
               ++ +  IQ
Sbjct: 715 DRYWHNMAARIQ 726

>CAGL0K03487g 322030..325683 highly similar to sp|Q04439
           Saccharomyces cerevisiae YMR109w myosin-like protein,
           start by similarity
          Length = 1217

 Score =  417 bits (1072), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 260/752 (34%), Positives = 404/752 (53%), Gaps = 53/752 (7%)

Query: 71  ATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLYSQDMIQAYAG 130
              DLT L+ +++ ++   +K R+    IYTY G VLI+ NPF R   +Y+  ++++Y G
Sbjct: 38  GVSDLTLLTSISDESINDNLKKRFLNGTIYTYIGHVLISVNPF-RDLGIYTDAIMKSYQG 96

Query: 131 RRRGELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAGKTVSAKYIMRYFATVEQSNLV 190
           + R E+ PH++AI+E  Y  +K   +NQ +++SGESGAGKT +AK IM Y A        
Sbjct: 97  KNRLEVPPHVYAISEAMYYNLKAYNENQCVIISGESGAGKTEAAKKIMEYIAATS----- 151

Query: 191 GSGGSMHHIEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDISIIGAR 250
               S H   + + +  +LATNP++E+FG AKT RN+NSSR GKYLEI F+         
Sbjct: 152 ----STHSESIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNSQFEPCAGN 207

Query: 251 IRTYLLERSRLVFQPPSERNYHIFYQLLAGLPEETKKELKLGGVEEYHYMNQGGASEIQG 310
           I  YLLE+ R+V Q  +ERN+HIFYQ   G  +  ++   +   E+Y Y +    + +  
Sbjct: 208 ITNYLLEKQRVVGQITNERNFHIFYQFTKGASDNYRQTFGVQLPEQYVYTSASKCTSVDT 267

Query: 311 VDDREEYAITTKALSLVDITERTQTALFKVLAALLHIGNID-VKKTRNDASVSATDPSLE 369
           +DD +++  T KA+ ++ + +  Q  +F++LAA+L IGNI  ++    +A V  T  + +
Sbjct: 268 IDDVKDFEATIKAMQVIGLAQEEQDQIFRMLAAILWIGNISFIENEEGNAQVRDTSVT-D 326

Query: 370 IACELLGIDAYNFAKWITKKQITT-----RSEKIVSNLNYGQAVVARDSVAKFIYSALFD 424
               LL +D+ +  K + ++ + T     R       LN  QA   RD++AK IY+ LF+
Sbjct: 327 FVAYLLQVDSQSLIKALVERIVETNHGSRRGSVYHVPLNIVQATAVRDALAKAIYNNLFE 386

Query: 425 WLVENINNVL-CNPAVINEIASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV 483
           W+V+ +N  L   P         IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q  
Sbjct: 387 WIVDRVNKSLHAYPGADKS----IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLT 442

Query: 484 FKLEQEEYVKEEIQWSFIEFNDNQPCIDLIENKL--GILSLLDEESRLPAGSDETWTQKL 541
            K EQ+ Y +E+IQW+ I++ DN+   DLIE K   GI + +++             Q  
Sbjct: 443 LKSEQDTYAREKIQWTPIKYFDNKVVCDLIEAKRPPGIFAAMNDSVATAHADSSAADQAF 502

Query: 542 YQTLDKPPTNTVFSKPRFGQTKFVVSHYAHDVAYDVEGFIEKNRDTVSDGHLEVLKGSTN 601
            Q L    +N  F +    Q KFV+ HYA DV YDV G  +KN+D +    +E++  +TN
Sbjct: 503 AQRLSLFSSNPHFEQ---RQNKFVIKHYAGDVTYDVLGMTDKNKDQLQKDLVELVGTTTN 559

Query: 602 ETLLAILET-IDRNAAKLAEKLESQKKPGPTTRTVNRKPTLGSLFKQSLVELMSTINSTN 660
             L  +    +D++  +                   R PT G    +S  EL+ T++   
Sbjct: 560 AFLTTLFPNQVDKDNKR-------------------RPPTAGDKIIKSANELVETLSKAQ 600

Query: 661 VHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPTRWTYDEFALRYHILV 720
             YIR IKPN+ K    +D+  VL Q++  G+ E +RI  AGF  R  +++F  R+++L 
Sbjct: 601 PSYIRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQGFEKFVERFYLLS 660

Query: 721 PSTNWTKIFATGTTEEEINQLCKNILDTTVTDKEKYQLGNTKIFFKAGMLAF-LEKKRTD 779
           P  ++   +   T   +I +  + IL   +  +++YQLG T++F K     F LE  R  
Sbjct: 661 PRCSYAGDY---TWTGDILEAVRLILQDALIPEKEYQLGVTQVFIKTPETLFALENMRDK 717

Query: 780 KLNSSSTMIQKKIKGIYYRRRYLEITNAIKRT 811
             ++ +  IQ+  +   Y +R ++    I+RT
Sbjct: 718 FWHNMAARIQRAWR--RYLQRRIDAAVKIQRT 747

>AEL306C [2199] [Homologous to ScYMR109W (MYO5) - SH; ScYKL129C
           (MYO3) - SH] (65141..69019) [3879 bp, 1292 aa]
          Length = 1292

 Score =  418 bits (1075), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 266/742 (35%), Positives = 401/742 (54%), Gaps = 55/742 (7%)

Query: 71  ATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLYSQDMIQAYAG 130
              DLT LS +++  +   +K R+   +IYTY G VLI+ NPF R   +Y+  +++ Y G
Sbjct: 36  GVSDLTLLSKISDEHINENLKRRFENGSIYTYIGHVLISVNPF-RDLGIYTDQVLETYKG 94

Query: 131 RRRGELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAGKTVSAKYIMRYFATVEQSNLV 190
           R R E+ PH+FAIAE  Y  +K   +NQ +++SGESGAGKT +AK IM+Y A    S+  
Sbjct: 95  RNRLEVPPHVFAIAEAMYYNLKAYNENQCVIISGESGAGKTEAAKRIMQYIAAASSSHEA 154

Query: 191 GSGGSMHHIEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDISIIGAR 250
             G           +  +LATNP++E+FG AKT RN+NSSR GKYLEI F+        +
Sbjct: 155 SIG---------RIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNAQFEPCAGQ 205

Query: 251 IRTYLLERSRLVFQPPSERNYHIFYQLLAGLPEETKKELKLGGVEEYHYMNQGGASEIQG 310
           I  YLLE+ R+V Q  +ERN+HIFYQ   G  +  +K   +   E+Y Y +  G + +  
Sbjct: 206 ITNYLLEKQRVVGQIKNERNFHIFYQFSKGASDRYRKTYGVQLPEQYVYTSASGCTSVDT 265

Query: 311 VDDREEYAITTKALSLVDITERTQTALFKVLAALLHIGNIDVKKTRNDASVSATDPSL-E 369
           +DD  +Y  T +A++++ +++  Q  +F++L+A+L IGN+   +  ++ +    D S+ +
Sbjct: 266 IDDLNDYEATLEAMNVIGLSQAEQDEIFRLLSAILWIGNVTFMED-DEGNAKIADTSITD 324

Query: 370 IACELLGIDAYNFAKWITKKQITT-----RSEKIVSNLNYGQAVVARDSVAKFIYSALFD 424
               LL +DA    K + ++ I T     R       LN  QA   RD++AK IY+ LF+
Sbjct: 325 FVAYLLQVDAGLLVKSLVERTIETTHGMRRGSIYNVPLNIVQATAVRDALAKAIYNNLFE 384

Query: 425 WLVENINNVLCNPAVINEIASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVF 484
           W+V+ +N  L     +      IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   
Sbjct: 385 WIVDRVNVSL---QALPGAEKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTL 441

Query: 485 KLEQEEYVKEEIQWSFIEFNDNQPCIDLIENKL--GILSLLDEESRLPAGSDETWTQKLY 542
           K EQEEY KE+IQW+ I++ DN+   +LIE K   GI + L++             Q   
Sbjct: 442 KSEQEEYAKEQIQWTPIKYFDNKVVCELIEAKRPPGIFAALNDSVATAHADSNAADQAFA 501

Query: 543 QTLDKPPTNTVFSKPRF--GQTKFVVSHYAHDVAYDVEGFIEKNRDTVSDGHLEVLKGST 600
           Q L     N   S P F    +KFV+ HYA DV YD+ G  +KN+D +    +E+L  ++
Sbjct: 502 QRL-----NLFTSNPHFELRSSKFVIKHYAGDVTYDIGGMTDKNKDQLQRDLVELLNSTS 556

Query: 601 NETLLAIL-ETIDRNAAKLAEKLESQKKPGPTTRTVNRKPTLGSLFKQSLVELMSTINST 659
           N  L  I  +T D+++ ++                     T G    +S  EL+ T++  
Sbjct: 557 NTFLATIFPDTGDKDSKRIPS-------------------TAGDKIIRSANELVDTLSKA 597

Query: 660 NVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPTRWTYDEFALRYHIL 719
              YIR IKPN+ K    +D+  VL Q++  G+ E +RI  A +  R  +D+F  R+++L
Sbjct: 598 QPSYIRTIKPNQTKSPLDYDDRQVLHQVKYLGLQENVRIRRACYAYRHIFDKFVERFYLL 657

Query: 720 VPSTNWTKIFA-TGTTEEEINQLCKNILDTTVTDKEKYQLGNTKIFFKAGMLAF-LEKKR 777
            P  ++   +   G T + +N + +   DT++   E YQLG TK+F K     F LE  R
Sbjct: 658 SPQCSYAGDYTWQGNTLDAVNLILR---DTSIPVTE-YQLGVTKVFIKTPETLFALENMR 713

Query: 778 TDKLNSSSTMIQKKIKGIYYRR 799
               ++ ++ IQ+  +    RR
Sbjct: 714 DKYWHNMASRIQRAWRRFLQRR 735

>YKL129C (MYO3) [3137] chr11 complement(196350..200165) Myosin type
           I, may play a role in cell growth or polarity that is
           partially redundant with Myo5p, has an SH3 domain [3816
           bp, 1271 aa]
          Length = 1271

 Score =  416 bits (1068), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 269/755 (35%), Positives = 403/755 (53%), Gaps = 54/755 (7%)

Query: 74  DLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLYSQDMIQAYAGRRR 133
           DLT LS +++ ++   +K R+    IYTY G VLI+ NPF R   +Y+  ++++Y G+ R
Sbjct: 40  DLTLLSKISDESINENLKKRFKNGIIYTYIGHVLISVNPF-RDLGIYTNAVLESYKGKNR 98

Query: 134 GELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAGKTVSAKYIMRYFATVEQSNLVGSG 193
            E+ PH+FAIAE  Y  +K+  +NQ +++SGESGAGKT +AK IM+Y A    S      
Sbjct: 99  LEVPPHVFAIAESMYYNLKSYNENQCVIISGESGAGKTEAAKRIMQYIAAASNS------ 152

Query: 194 GSMHHIEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDISIIGARIRT 253
              H   + + +  +LATNP++E+FG AKT RN+NSSR GKYLEI F+         I  
Sbjct: 153 ---HSESIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNSQFEPCAGNITN 209

Query: 254 YLLERSRLVFQPPSERNYHIFYQLLAGLPEETKKELKLGGVEEYHYMNQGGASEIQGVDD 313
           YLLE+ R+V Q  +ERN+HIFYQ   G  +  K+   +   E+Y Y    G +    +  
Sbjct: 210 YLLEKQRVVGQIKNERNFHIFYQFTKGASDTYKQMFGVQMPEQYIYTAAAGCTSADQL-M 268

Query: 314 REEYAITTKALSLVDITERTQTALFKVLAALLHIGNID-VKKTRNDASVSATDPSLEIAC 372
           R++Y  T +A+  + + +  Q  +F++LAA+L IGNI  ++    +A V  T  + +   
Sbjct: 269 RKDYEGTLEAMRTIGLVQEEQDQIFRMLAAILWIGNISFIENEEGNAQVGDTSVT-DFVA 327

Query: 373 ELLGIDAYNFAKWITKKQITT-----RSEKIVSNLNYGQAVVARDSVAKFIYSALFDWLV 427
            LL +DA    K + ++ + T     R       LN  QA   RD++AK IY+ LFDW+V
Sbjct: 328 YLLQVDASLLVKCLVERIMQTSHGMKRGSVYHVPLNPVQATAVRDALAKAIYNNLFDWIV 387

Query: 428 ENINNVLCNPAVINEIASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLE 487
           + +N  L            IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K E
Sbjct: 388 DRVNVSL---QAFPGADKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKAE 444

Query: 488 QEEYVKEEIQWSFIEFNDNQPCIDLIE--NKLGILSLLDEESRLPAGSDETWTQKLYQTL 545
           QE Y +E+I+W+ I++ DN+   DLIE  N  GIL+ +++             Q   Q L
Sbjct: 445 QETYEREKIKWTPIKYFDNKVVCDLIEAKNPPGILAAMNDSIATAHADSNAADQAFAQRL 504

Query: 546 DKPPTNTVFSKPRFGQTKFVVSHYAHDVAYDVEGFIEKNRDTVSDGHLEVLKGSTNETLL 605
           +   +N  F        KFV+ HYA DV YD+ G  +KN+D +    +E++  +TN  L 
Sbjct: 505 NLFNSNPYF---ELRANKFVIKHYAGDVTYDINGITDKNKDQLQKDLIELIGTTTNTFLS 561

Query: 606 AIL-ETIDRNAAKLAEKLESQKKPGPTTRTVNRKPTLGSLFKQSLVELMSTINSTNVHYI 664
            I  + +D+++ +                   R PT G    +S  EL+ T++     YI
Sbjct: 562 TIFPDDVDKDSKR-------------------RPPTAGDKIIKSANELVETLSKAEPSYI 602

Query: 665 RCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPTRWTYDEFALRYHILVPSTN 724
           R IKPN+ K    +D+  VL Q++  G+ E +RI  AGF  R T+++F  R+++L P  +
Sbjct: 603 RTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERFYLLSPDCS 662

Query: 725 WTKIFA-TGTTEEEINQLCKNILDTTVTDKEKYQLGNTKIFFKAGMLAF-LEKKRTDKLN 782
           +   +   G T E +  + +   D  + +KE +QLG T +F K     F LE  R     
Sbjct: 663 YAGDYTWDGDTLEAVKLILR---DAMIPEKE-FQLGVTSVFIKTPESLFALEDMRDKYWY 718

Query: 783 SSSTMIQKKIKGIYYRRRYLEITNAIKRTHSVAKG 817
           + +  IQ+  +    RR  ++    I+RT    KG
Sbjct: 719 NMAARIQRAWRRFLQRR--IDAAIKIQRTIREKKG 751

>CAGL0J08657g complement(855068..856741) similar to tr|Q12511
           Saccharomyces cerevisiae YOR090c PTC5, hypothetical
           start
          Length = 557

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 59/139 (42%), Gaps = 8/139 (5%)

Query: 561 QTKFVVSHYAHDVAYDV---EGFIEKNRDTVSDGHLEVLKGSTNETLLAILETIDRNAAK 617
             K + S Y H++ +DV   +GF++ + D V     ++LK  TN+ +LA L  I  + A 
Sbjct: 213 HNKALTSDYTHNMNFDVALEKGFVQLDNDIVYHSLGKLLKEPTNDNMLAALPAISGSCAL 272

Query: 618 LA--EKLESQKK---PGPTTRTVNRKPTLGSLFKQSLVELMSTINSTNVHYIRCIKPNEE 672
           LA     ES  K    G +   +    + G  + +SL    +  N   V  IR   P E+
Sbjct: 273 LAVYNSYESTVKVAVTGDSRALIGGLDSNGEWYVKSLSTDQTGDNLEEVQRIRSEHPGED 332

Query: 673 KEAWKFDNLMVLSQLRACG 691
                   L  L   RA G
Sbjct: 333 NVVRNGRVLGSLQPSRAFG 351

>ABR111C [703] [Homologous to ScYPR090W - SH; ScYPR089W - SH]
            (591654..594023) [2370 bp, 789 aa]
          Length = 789

 Score = 35.0 bits (79), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 13/72 (18%), Positives = 38/72 (52%)

Query: 1339 ILTFFNTIYWSMKAYHVETEVYREVIMSLLRYVDAICFNDLIMKRNFLSWKRGLQLNYNV 1398
            I+  F  + + ++++ V   +  + + + + +     FN ++  + +LS  + +Q+  N+
Sbjct: 452  IVQIFGALAYVLESHQVHPLLSMQCLSTSIEWFSTSIFNIMVSSKKYLSRAQAMQIRLNL 511

Query: 1399 TRLEEWCKVHHI 1410
            + +E+W K H +
Sbjct: 512  STIEDWVKNHDM 523

>CAGL0D05258g 500858..504370 similar to sp|P38989 Saccharomyces
            cerevisiae YFR031c SMC2 chromosome segregation protein,
            start by similarity
          Length = 1170

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 62/251 (24%), Positives = 110/251 (43%), Gaps = 30/251 (11%)

Query: 940  LENKVIELTESLAAKVKENKDLNSRIKELQ-----LSLNESANIRELLKTKQE--EYRKS 992
            +EN+V  L +S   K+ EN  L + I++L+      S N+ A ++EL     E  E  K 
Sbjct: 750  IENEVKTLEDSTKQKMLENSSLEAEIEKLRKDMVDFSKNKGAKLKELKAEVHELNEQIKD 809

Query: 993  IDQQKDTHAAAYEEVTGRLTLAMKEVDDARQEIDQL-----KSKQEDLKLE--VKAKIEE 1045
            ++ + +     YE++         E+D   + +D       K  +E++K+   +K   EE
Sbjct: 810  LESESEKLNDTYEKIKVETEQIANEIDTDTKSLDSTVQDIEKKLEEEIKINKMLKTSEEE 869

Query: 1046 LSKVRQDLSDSRTQNSDLSNEVSSLKEEIARLHNAIRNAP-ATGTLSPTRSKRISSYSG- 1103
            L  V+ DL+  R + S++ +E+  L+  I +   +          L    SK  +S  G 
Sbjct: 870  LMSVQNDLNVERKRISNIDDELEELERTIKQKEESKNTYELELKQLHHDLSKYKNSTDGI 929

Query: 1104 ---LDNIGSPKQW--------NVVSLNNGLMEEETRSIMSQLSQINDELYKLLNDDRPLT 1152
               L++I    +W        ++   N G+   E R  M QL +  DEL + +N   P  
Sbjct: 930  EKALNDIQEEHEWVTDEMLVRSICEQNAGVNVNEYRHRMEQLQKNFDELRRKVN---PNI 986

Query: 1153 SEIVEGLLKSG 1163
              ++E + K G
Sbjct: 987  MNMIESVEKKG 997

>KLLA0E15598g 1388626..1391343 weakly similar to sp|P38853
            Saccharomyces cerevisiae YHR158c KEL1 involved in cell
            fusion and morphology, start by similarity
          Length = 905

 Score = 35.0 bits (79), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 80/161 (49%), Gaps = 18/161 (11%)

Query: 934  KEVSYKLENKVIELTESLAAKVKE----NKDLNSRIKELQLSLNESANIRELLKTKQEEY 989
            KE    LE+K I L+E   +  KE     + +N  IK+   SL+    + + ++ KQ+ +
Sbjct: 695  KEKYVDLESKYIVLSEKYESLTKELDSKKQFINENIKKCSESLD---TLLDGMRQKQKAH 751

Query: 990  RKSIDQQKDTHAAAYEEVTGRLTLAMKEVDDARQEIDQLKSKQEDLKLEVKAKIEELSKV 1049
               + + K+T      +++  + L  KE+  +R   DQL ++   LK E  +K EEL+K+
Sbjct: 752  ETVVTRHKETMTGLDRKLS-EVILQNKELTTSR---DQLFTEYSKLKDEHASKHEELTKM 807

Query: 1050 RQD-------LSDSRTQNSDLSNEVSSLKEEIARLHNAIRN 1083
             ++       + +S      L NE+  L++E +RL + + N
Sbjct: 808  EREYRSVIDSVHNSGNAMEKLQNEIIKLRQENSRLKSDLEN 848

>Kwal_33.14659
          Length = 1678

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 44/91 (48%), Gaps = 2/91 (2%)

Query: 1320 SSAFLPKIFSSSSSYKMDDILTFFNTIYWSMKAYHVETEVYREVIMSLLRYVDAICFN-- 1377
            +S  L  I  SS+S +  ++  FF T    ++A   E EV  E +  +    D I  +  
Sbjct: 1037 ASRILHAILFSSTSSEASNVGLFFKTFLEKLEALRKENEVSNENLKRIFNIHDMITEDII 1096

Query: 1378 DLIMKRNFLSWKRGLQLNYNVTRLEEWCKVH 1408
            DLI ++N++S + G++   N+  +    + H
Sbjct: 1097 DLISEKNYMSIRNGIEFMKNLCAVFPVVEFH 1127

>KLLA0E19030g 1684751..1687216 weakly similar to sp|P53148
            Saccharomyces cerevisiae YGL093w SPC105 spindle pole body
            protein singleton, start by similarity
          Length = 821

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 63/138 (45%), Gaps = 23/138 (16%)

Query: 932  HLKEVSYKLENKVIELTESLAAKVKENKDLNSRIKELQLSLNESANIRELLKTKQEEYRK 991
            HLK +   LE       E++A  V EN  +   + E+       ++I+++L  + +  R 
Sbjct: 492  HLKGIKTVLE-------ENIAILVDENAQIMKYMNEINDVKIRVSDIKQVLMKELDVLR- 543

Query: 992  SIDQQKDTHAAAYEEVT---------GRLTLAMKEVDDARQ---EIDQLKSKQEDLKLEV 1039
               Q  D  +   E +T         G L   M +V D  Q   + DQL  K +D KLE+
Sbjct: 544  ---QHNDVFSNKKENITTLLKVNKLKGDLRENMLKVSDLNQLTTKKDQLTQKIQDAKLEM 600

Query: 1040 KAKIEELSKVRQDLSDSR 1057
                EE++++RQDL  S+
Sbjct: 601  SKVNEEIAQLRQDLKQSK 618

>CAGL0D02750g 288647..289021 no similarity, hypothetical start
          Length = 124

 Score = 31.2 bits (69), Expect = 2.4,   Method: Composition-based stats.
 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 430 INNVLCNPAVINEIASFIGVLDIYGFEHFEKNSFEQFCINY 470
           I N   N   +  ++SF+ + D+ GFE++  N + QF I+Y
Sbjct: 62  ITNQFQNNYAVGTLSSFV-IFDVNGFEYYVINVYRQFTIHY 101

>CAGL0G01760g 158546..161113 similar to sp|Q06096 Saccharomyces
            cerevisiae YPR105c, hypothetical start
          Length = 855

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 62/132 (46%), Gaps = 11/132 (8%)

Query: 1036 KLEVKAKIEELSKVRQDLSDSRTQNSDLSNEVSSLKEEIARLHNAIRNAPATGTLSPTRS 1095
            +L    +I +L   R DL+ S TQ  +  + V+    E  ++HN I++      L     
Sbjct: 59   QLRHNKQIRKLELQRTDLTVSLTQFHEALSNVNKTNAEAKQIHNDIKSVELERVLLK--- 115

Query: 1096 KRISSYSGLDNIGSPKQWNVVSLNNGLMEEETRSIMSQLSQINDELYKLLNDDRPLTSEI 1155
                +   + NI + K  N +SL N +++EE   + ++  Q   E+  + N D  + SE 
Sbjct: 116  ---QTLEFVTNIRTLK--NNISLCNAVIDEENYQVAARAIQ---EIRNMPNRDGIINSEF 167

Query: 1156 VEGLLKSGKIPQ 1167
             + ++ S KIP+
Sbjct: 168  AKRVIPSSKIPE 179

>CAGL0H09174g complement(898883..901978) some similarities with
           sp|P24004 Saccharomyces cerevisiae YKL197c PAS1,
           hypothetical start
          Length = 1031

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 160 IVVSGESGAGKTVSAKYIMRYFATVEQSNLV 190
            +V GESG GKT+  KY+ R  AT  Q N++
Sbjct: 422 FLVEGESGMGKTMLFKYLQRRLATQNQLNVM 452

>KLLA0E05225g 467253..472520 similar to sp|P25386 Saccharomyces
            cerevisiae YDL058w USO1 intracellular protein transport
            protein, start by similarity
          Length = 1755

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 88/170 (51%), Gaps = 11/170 (6%)

Query: 920  LETLKQEAK----SVSHLKEVSYKLENKVIELTESLAAKVKENKDLNSRIKELQLSLNES 975
            +E L+Q+A+    S+   + +S K + + ++L + LA + KENKDL +++ +L     E 
Sbjct: 1387 IEALEQQAEESKSSLDTERSLSSKEQQQRLQLEKILANEQKENKDLENKLADLDQLFKEH 1446

Query: 976  ANIRELLKTKQEEYRKSIDQQKDTHAAAYEEVTGRLTLAMKEVDDARQEIDQ---LKSKQ 1032
             N  E      ++Y+    QQ + ++   EE+    +    ++  A ++I +   L S+ 
Sbjct: 1447 ENTLESQTKISQDYK----QQLEKNSQVIEELKSAESALKDKLIAAEEKIKESEILTSQL 1502

Query: 1033 EDLKLEVKAKIEELSKVRQDLSDSRTQNSDLSNEVSSLKEEIARLHNAIR 1082
            ++      A +EE +K+++ +SD   +N     E+  L++E+++   +++
Sbjct: 1503 DEAVTSTSALLEEQTKLKKSISDLEAKNIKDCGEMEILRKELSKCQESLK 1552

>Kwal_23.4010
          Length = 874

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 70/140 (50%), Gaps = 36/140 (25%)

Query: 978  IRELLKTKQEEYRKSIDQQKDTHAAAYEEVTGRLTLAM-KEVDDA-------RQEIDQLK 1029
            +++LL+ +Q+  R+ + QQKD H     E  G+L   + K+V++        +QE+ QL 
Sbjct: 736  LKDLLEQEQQVEREHL-QQKDKHLQNQMEY-GKLQATLEKDVEEHSLKLVKLQQELTQLI 793

Query: 1030 SKQEDLKLEVKAKIEELSKVRQDLSDSRTQ-------------------NSDLSNEVSSL 1070
            +K++ + ++ +   +E+S+  +D+ + ++Q                    +D   +V  L
Sbjct: 794  AKRDKMNVKQQKLRKEVSQCTEDMENFKSQFLSQRQRDREYREELRIVEANDYELKVKGL 853

Query: 1071 KEEIARL-------HNAIRN 1083
            +++I+RL       HN IRN
Sbjct: 854  EQDISRLEGENEAMHNMIRN 873

>Scas_610.17
          Length = 1305

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 88/188 (46%), Gaps = 17/188 (9%)

Query: 894  RTSYITNRRSTIVVQSLVRRRFAKRKLETLKQEAKSVSHLKEVSY-KLENKVIELTESLA 952
            R ++  N + T V++S +    + ++ ETLKQ+      + E +Y  +E+K+ ELT  L 
Sbjct: 590  RKTHDDNMKQTEVLESQLLE--SNKQTETLKQQLG----VTEANYHAIESKLNELTTELT 643

Query: 953  AKVKENKDLNSRIKELQLSLNESANIRELLKTKQEEYRKSIDQQK---DTHAAAYEEVTG 1009
               + N +L  +I  L        ++   L+T+  E ++++ QQ+   D ++   E    
Sbjct: 644  TAQESNTNLKDQIANLN-------SMTATLQTQLNEKQQNVRQQRSMVDVNSKQLEVGQI 696

Query: 1010 RLTLAMKEVDDARQEIDQLKSKQEDLKLEVKAKIEELSKVRQDLSDSRTQNSDLSNEVSS 1069
             L     E+D   +++    +KQ +L    K   E+ S++     D   +N DL+     
Sbjct: 697  NLKSMQTEIDGLDEKLQVYLTKQNELNEYQKTVEEQHSQLESKYKDLALRNDDLTEREKQ 756

Query: 1070 LKEEIARL 1077
            L+E  A++
Sbjct: 757  LEERNAQI 764

>CAGL0M01496g complement(171045..173900) similar to tr|Q04175
            Saccharomyces cerevisiae YDR395w SXM1, start by
            similarity
          Length = 951

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 55/129 (42%), Gaps = 32/129 (24%)

Query: 1111 KQWNVVSLNNGLMEEETRSIMSQLSQ--------------INDELYKLLNDDRP--LTSE 1154
            + WN      GL +EE  S+  QL Q              + + +  +LN D    LT+ 
Sbjct: 69   RSWNTTKYTEGLTKEEQASVKEQLVQTLIKFSESSHLRPHLTESIRGILNADNSWDLTAT 128

Query: 1155 IVEGLLKSGKIPQPGFAANLTRKEVLYPARVLIIILSDMWRLGLTEQSE---RFLAEVLS 1211
            + E LL SGK            +E LYP  +L+  ++ + R  +++  E    F+ E+  
Sbjct: 129  VKE-LLTSGK------------QEYLYPGLLLVFEVAIVHRWDMSDNREVIDNFIIEIFP 175

Query: 1212 TIQTLVTNL 1220
             ++ + + L
Sbjct: 176  IVENITSQL 184

>CAGL0C00583g 62224..63396 weakly similar to sp|P38272 Saccharomyces
            cerevisiae YBR130c SHE3 required for mother cell-specific
            expression of HO, hypothetical start
          Length = 390

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 77/174 (44%), Gaps = 36/174 (20%)

Query: 932  HLKEVSYKLENKVIELTES----LAAK------VKENKDLNSRIKELQLSLNE------S 975
            H +E++  LE+K  EL E     LA K        EN  L S  KEL  SL         
Sbjct: 146  HNREINTALEDKTAELKECDNNLLAIKKEYEQITTENSKLASDYKELSKSLGSLRGQYAK 205

Query: 976  ANIRE-LLKTKQEEYRKSIDQQKDTHAAAYEEVTGRLTLAMKEV----DDARQEIDQ--- 1027
            + IR+ +L++ QEEY+++ + +        E V   L +   ++     D +Q++D    
Sbjct: 206  SKIRKNILQSLQEEYKQACNDE-------IEAVRNNLDMVESKIGHYNSDEKQKLDDILD 258

Query: 1028 ----LKSKQEDLKLEVKAKIEELSKVRQDLSDSRTQNSDLSNEVSSLKEEIARL 1077
                L+ +    KLE +  IEEL     DLS ++     ++   SS K E+  L
Sbjct: 259  AHSVLEKEVTSRKLENETAIEELETKWNDLS-TKVHLESITEHYSSFKSELTEL 311

>AGL106C [4206] [Homologous to ScYLR238W - SH; ScYDR200C - SH]
           (504816..506186) [1371 bp, 456 aa]
          Length = 456

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 53/103 (51%), Gaps = 14/103 (13%)

Query: 399 VSNLNYGQAVVARDSVAKFIYSALFDWLVENINN-VLCNPAVINEIASFIGVLDIYGFEH 457
           V+NL+  +AV+  ++    I S +F      INN +  +P +IN I + I  L +   E+
Sbjct: 241 VNNLDLEEAVLGSETE---ILSGIF------INNSIGTSPNLINVIKTLITELTLEQTEY 291

Query: 458 FEKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIQWSF 500
            +  S E F IN+ N   Q+  N+   ++EQ +    ++Q++ 
Sbjct: 292 LKLKSIENFLINFTNN--QEYLNK--LRIEQNDAKLVQLQFNL 330

>ADL307W [1434] [Homologous to ScYPR049C (CVT9) - SH]
            complement(155324..158542) [3219 bp, 1072 aa]
          Length = 1072

 Score = 31.2 bits (69), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 75/162 (46%), Gaps = 40/162 (24%)

Query: 949  ESLAAKVKENKDLNSRIKELQLSL----NESANIRELLKTKQEE----------YRKSI- 993
            +S+ +     K+L S++ ELQ  L    NE+  +++ LKT + +          Y++++ 
Sbjct: 613  DSIMSGKSNEKELQSQLVELQKQLEEAKNEAKRVQQQLKTTKTQLLNGEDERTAYKETLS 672

Query: 994  -------------DQQKDTHAAAYEEVTGRLTLAMKEVDDARQEIDQLKSKQEDLKLEVK 1040
                         ++QK     A ++   +L ++M++V+D  ++++  KSK  D      
Sbjct: 673  ILNAELSKLILNQEEQKQELVIAAKDFQEKLDVSMRQVNDLLKQVNFWKSKCGD------ 726

Query: 1041 AKIEELSKVRQD-LSDSRTQNSDLSNEVSSLKEEIARLHNAI 1081
                 L K++QD L++  T+ +D +N  +  +  I  L   +
Sbjct: 727  -----LDKIKQDLLANMATKETDFNNRCTDYERNIVELQRQL 763

>Scas_532.1*
          Length = 487

 Score = 30.8 bits (68), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 34/55 (61%)

Query: 1030 SKQEDLKLEVKAKIEELSKVRQDLSDSRTQNSDLSNEVSSLKEEIARLHNAIRNA 1084
            ++Q+D+ +E++ +IE+L K  Q+L + + +  +  + V  L+EE  +L N + N 
Sbjct: 112  AQQKDIVIELRKEIEDLQKTNQELHNGKEKLQEEVSIVHQLREEKMKLQNELNNV 166

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.132    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 48,991,282
Number of extensions: 2218754
Number of successful extensions: 11457
Number of sequences better than 10.0: 508
Number of HSP's gapped: 11153
Number of HSP's successfully gapped: 848
Length of query: 1529
Length of database: 16,596,109
Length adjustment: 115
Effective length of query: 1414
Effective length of database: 12,615,039
Effective search space: 17837665146
Effective search space used: 17837665146
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)