Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADR353C2752705657e-72
Scas_586.439543609.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADR353C
         (270 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADR353C [2094] [Homologous to NOHBY] (1327148..1327975) [828 bp,...   222   7e-72
Scas_586.4                                                             28   9.7  

>ADR353C [2094] [Homologous to NOHBY] (1327148..1327975) [828 bp,
           275 aa]
          Length = 275

 Score =  222 bits (565), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 139/270 (51%), Positives = 139/270 (51%)

Query: 1   MEHXXXXXXXXXXXXXXXXXFSDCLFECXXXXXXXXXXXXSVSVPAARTQRLVEQFLQPA 60
           MEH                 FSDCLFEC            SVSVPAARTQRLVEQFLQPA
Sbjct: 1   MEHGRKRRGARSGVGAAAGRFSDCLFECATAPGAAPNTAASVSVPAARTQRLVEQFLQPA 60

Query: 61  GEQRVTAAQGRAALGSSVGSVESAATVAEVLALDVXXXXXXXXXXXXXXXXXXXXXXXEX 120
           GEQRVTAAQGRAALGSSVGSVESAATVAEVLALDV                       E 
Sbjct: 61  GEQRVTAAQGRAALGSSVGSVESAATVAEVLALDVGAAGRSGTSAPSGSGPAAGHGRPEV 120

Query: 121 XXXXXXXXXXXTRGLLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQQEVVEAPSDAVRA 180
                      TRGLLP                             QQEVVEAPSDAVRA
Sbjct: 121 LALDARARAAVTRGLLPRADALAAVEAALGKLGAEAAREAGAVRRLQQEVVEAPSDAVRA 180

Query: 181 AEREAFSARLESAFRPALVTLQTLETRLAHGRSXXXXXXXXXXXXXXXXVLEKRAADMRR 240
           AEREAFSARLESAFRPALVTLQTLETRLAHGRS                VLEKRAADMRR
Sbjct: 181 AEREAFSARLESAFRPALVTLQTLETRLAHGRSAAAALETRLRRLEHAAVLEKRAADMRR 240

Query: 241 GEXXXXXXXXXXXXXXXXXXXXXXVLAIWL 270
           GE                      VLAIWL
Sbjct: 241 GERLAARLANQRAAMCDMAALAFAVLAIWL 270

>Scas_586.4
          Length = 395

 Score = 27.7 bits (60), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 11/43 (25%), Positives = 28/43 (65%)

Query: 48  RTQRLVEQFLQPAGEQRVTAAQGRAALGSSVGSVESAATVAEV 90
           + + L ++FL+ AG++++T  +G  ++G    S+ +A ++A +
Sbjct: 338 KKEGLDDKFLEEAGKRKLTGLKGHRSVGGFRASIYNALSLATI 380

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.128    0.348 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,696,127
Number of extensions: 49875
Number of successful extensions: 117
Number of sequences better than 10.0: 3
Number of HSP's gapped: 115
Number of HSP's successfully gapped: 3
Length of query: 270
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 170
Effective length of database: 13,134,309
Effective search space: 2232832530
Effective search space used: 2232832530
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)