Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADR352C25425011801e-166
YAL027W2612633574e-41
Scas_592.152542573173e-35
CAGL0G06292g2532622571e-26
KLLA0A03960g2252182421e-24
Kwal_26.70662042051745e-15
KLLA0E10637g70946690.77
Scas_679.2881552661.8
Scas_648.1470746644.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADR352C
         (250 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADR352C [2093] [Homologous to ScYAL027W - SH] (1326273..1327037)...   459   e-166
YAL027W (YAL027W) [41] chr1 (94690..95475) Protein of unknown fu...   142   4e-41
Scas_592.15                                                           126   3e-35
CAGL0G06292g complement(602454..603215) similar to sp|P39735 Sac...   103   1e-26
KLLA0A03960g 353119..353796 weakly similar to sp|P39735 Saccharo...    98   1e-24
Kwal_26.7066                                                           72   5e-15
KLLA0E10637g 938243..940372 highly similar to sp|P00931 Saccharo...    31   0.77 
Scas_679.28                                                            30   1.8  
Scas_648.14                                                            29   4.0  

>ADR352C [2093] [Homologous to ScYAL027W - SH] (1326273..1327037)
           [765 bp, 254 aa]
          Length = 254

 Score =  459 bits (1180), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 230/250 (92%), Positives = 230/250 (92%)

Query: 1   MSPTHALLQLQPGYVMPVRVFINRREVLNNAASCSLFEAPILSNSAIVRLKSPSVRVHLS 60
           MSPTHALLQLQPGYVMPVRVFINRREVLNNAASCSLFEAPILSNSAIVRLKSPSVRVHLS
Sbjct: 1   MSPTHALLQLQPGYVMPVRVFINRREVLNNAASCSLFEAPILSNSAIVRLKSPSVRVHLS 60

Query: 61  EDDKQSLLAELRDDLLYIIYELGSPGAEETLRKFKIGGLADFRDIVRAAEQGDRPEQPIP 120
           EDDKQSLLAELRDDLLYIIYELGSPGAEETLRKFKIGGLADFRDIVRAAEQGDRPEQPIP
Sbjct: 61  EDDKQSLLAELRDDLLYIIYELGSPGAEETLRKFKIGGLADFRDIVRAAEQGDRPEQPIP 120

Query: 121 GLDLHTMTFERLDKQRFPLHFEHNWVVNIILNDIRKLAVWRRLLLCDXXXXXXXXXXXXX 180
           GLDLHTMTFERLDKQRFPLHFEHNWVVNIILNDIRKLAVWRRLLLCD             
Sbjct: 121 GLDLHTMTFERLDKQRFPLHFEHNWVVNIILNDIRKLAVWRRLLLCDIAPIGVPAAAAPA 180

Query: 181 XXXXXXXYVLLRERRGRVSPQGMLQEDAPEGVPREGDLNVEQKPVLDYRYKSVTNLGPGI 240
                  YVLLRERRGRVSPQGMLQEDAPEGVPREGDLNVEQKPVLDYRYKSVTNLGPGI
Sbjct: 181 PMPAGAPYVLLRERRGRVSPQGMLQEDAPEGVPREGDLNVEQKPVLDYRYKSVTNLGPGI 240

Query: 241 EIHVLQRPRR 250
           EIHVLQRPRR
Sbjct: 241 EIHVLQRPRR 250

>YAL027W (YAL027W) [41] chr1 (94690..95475) Protein of unknown
           function [786 bp, 261 aa]
          Length = 261

 Score =  142 bits (357), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 86/263 (32%), Positives = 145/263 (55%), Gaps = 28/263 (10%)

Query: 1   MSPTHALLQLQPGYVMPVRVFINRREVL------NNAASCSLFEAPILSNSAIVRLKSPS 54
           M+P+ A +++    V+P+R+F+NR+++L      +N ++ ++FEAP+LSN++I+ LKSP+
Sbjct: 1   MAPSIATVKIARDMVLPLRIFVNRKQILQTNDKTSNKSNATIFEAPLLSNNSIICLKSPN 60

Query: 55  VRVHLSEDDKQSLLAELRDDLLYIIYELGSPG-AEETLRKFKIGGLADFR-DIVRAAEQG 112
            R++LS+ DK++L  E+++DLL I+YEL SP      L K ++G   DF+ +++     G
Sbjct: 61  TRIYLSQQDKKNLCDEIKEDLLLIVYELASPEIISSVLSKIRVGHSTDFQINVLPKLFAG 120

Query: 113 DRPEQPIPGLDLHTMTFERLDKQRFPLHFEHNWVVNIILNDIRKLAVWRRLLLCDXXXXX 172
              +  +     H  +  RL K ++ LH++H W ++I +N I+K+A  R  L+       
Sbjct: 121 ADTDNAVTS---HIQSVTRLAKFKYKLHYKHKWELDIFINSIKKIANLRHYLMFQTLTLN 177

Query: 173 XXXXXXXXXXXXXXXYVLLRERRGRVSPQ--GMLQEDAPE---GVPREGDLNVEQKPVLD 227
                             L  R+    PQ   +L E+        P E D+    KPV++
Sbjct: 178 GFSLNAGPKT--------LLARKIEKQPQVPNLLIENGDADALDTPVEEDI----KPVIE 225

Query: 228 YRYKSVTNLGPGIEIHVLQRPRR 250
           + YK V NLG  I++HVL RPRR
Sbjct: 226 FMYKPVINLGEIIDVHVLHRPRR 248

>Scas_592.15
          Length = 254

 Score =  126 bits (317), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 83/257 (32%), Positives = 139/257 (54%), Gaps = 13/257 (5%)

Query: 1   MSPTHALLQLQPGYVMPVRVFINRREVL-NNAASCSLFEAPILSNSAIVRLKSPSVRVHL 59
           M+ + A +++    ++ +RVFINR+++L NN+     F+AP+LSN++I+ LKSP VR+ +
Sbjct: 1   MASSIATVRISKNAIVSLRVFINRKKLLRNNSREGQTFQAPLLSNNSIICLKSPLVRILI 60

Query: 60  SEDDKQSLLAELRDDLLYIIYELGSPGAEET-LRKFKIGGLADFR-DIVRAAEQGDRPEQ 117
           S  D + L  E+RD ++ I+Y+L SP   ET L K +IG  ADF  +I+      +   +
Sbjct: 61  SNQDMERLTNEIRDTIILIVYDLSSPEVMETVLGKLRIGSSADFETEILPKLMDENTLSK 120

Query: 118 PIPGLDLHTMTFERLDKQRFPLHFEHNWVVNIILNDIRKLAVWRRLLLCDXXXXXXXXXX 177
            +  + L T+T  R+ K ++ L F+ NW ++I +N+++KL   R  LL            
Sbjct: 121 DLVNVPLQTVT--RVAKFKYKLRFKGNWELDIFINNMKKLIKIRHFLLF----TDGHMSA 174

Query: 178 XXXXXXXXXXYVLLRERRGRVSPQGM----LQEDAPEGVPREGDLNVEQKPVLDYRYKSV 233
                      +LL E++  +  +G     L+ D  E +    D   + KP +  +Y  +
Sbjct: 175 ARTLELPPNRRILLTEQKTSLESEGSPMIPLEVDGDEMIETTQDAVEDVKPDIKLKYNPI 234

Query: 234 TNLGPGIEIHVLQRPRR 250
            NLG  + IH+LQRPRR
Sbjct: 235 INLGECLSIHILQRPRR 251

>CAGL0G06292g complement(602454..603215) similar to sp|P39735
           Saccharomyces cerevisiae YAL027w, start by similarity
          Length = 253

 Score =  103 bits (257), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 71/262 (27%), Positives = 127/262 (48%), Gaps = 34/262 (12%)

Query: 6   ALLQLQPGYVMPVRVFINRREVLNNAASCSLFEAPILSNSAIVRLKSPSVRVHLSEDDKQ 65
           A +++    ++PVRV INRR++L+ A   S  +AP+LSN+ IV LKSP  +++LS  D +
Sbjct: 6   AYIKVAKDSILPVRVHINRRQILSTATEESKVQAPLLSNNTIVCLKSPLTKIYLSNTDLK 65

Query: 66  SLLAELRDDLLYIIYELGSPGAEETL-RKFKIGGLADF-RDIVRA---AEQGDRPEQPIP 120
           +L+ E+ DD++ I+YEL SP  ++ +  K ++G + DF  D ++    + QG   E  + 
Sbjct: 66  NLVTEMEDDIILILYELSSPAMKQNIFSKIRVGQVYDFDEDTLKKFPQSIQGSLKESNLT 125

Query: 121 GLDLHTMTFERLDKQRFPLHFEHNWVVNIILNDIRKLAVWRRLLL------------CDX 168
            L       +R+ K ++ L +  NW V+I +++I KL   R  L+            C  
Sbjct: 126 SL-------KRVGKMKYKLTYRKNWDVDIFISNINKLETIRTYLIFKDQYPQWNEYPCLQ 178

Query: 169 XXXXXXXXXXXXXXXXXXXYVLLRERRGRVSPQGMLQEDAPEGVPREGDLNVEQKPVLDY 228
                               ++L+E            ED P            +KP + +
Sbjct: 179 KQQSLLVMGQKLSESTNQDPIILQEEEELNLNYEQSAEDQPNN----------EKPEIAF 228

Query: 229 RYKSVTNLGPGIEIHVLQRPRR 250
            Y+   +L   +++++L+RP+R
Sbjct: 229 TYEPQLSLIQCLDLYILKRPKR 250

>KLLA0A03960g 353119..353796 weakly similar to sp|P39735
           Saccharomyces cerevisiae YAL027w hypothetical protein
           singleton, hypothetical start
          Length = 225

 Score = 97.8 bits (242), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 70/218 (32%), Positives = 102/218 (46%), Gaps = 34/218 (15%)

Query: 67  LLAELRDDLLYIIYELGSPGAEE-TLRKFKIGGLADFRDIVRAAEQGDRPE-------QP 118
           LL E+RD LL+++YEL SP  EE  L K KI    DF D++   ++G   E        P
Sbjct: 4   LLNEIRDSLLFMLYELCSPILEEKVLNKLKIDTFMDFADVLEILKKGSSLETRSTDVYNP 63

Query: 119 IPGLDLHTMTFERLDKQRFPLHFEHNWVVNIILNDIRKLAVWRRL--LLCDXXXXXXXXX 176
           I G+D+H  + ER  K+ + LHF HNW ++I++ +I KL  WR+L  LL           
Sbjct: 64  IDGIDVHITSIERTGKKSYKLHFSHNWRLDILIENIDKLHHWRKLLTLLDSVQSVSNTGQ 123

Query: 177 XXXXXXXXXXXYVLLRERRGRVSPQGMLQEDAP--------EG---VPREG--------- 216
                       VL+R  +   S     + + P        +G   VPR+          
Sbjct: 124 SIPLFIPFKSTNVLVRSIKPLESDTNSSKSEDPPILIEPEDDGLGQVPRDEIEMVDQDPN 183

Query: 217 ----DLNVEQKPVLDYRYKSVTNLGPGIEIHVLQRPRR 250
               D   ++KP+ DY+YK +      I+IHVL RP+R
Sbjct: 184 DIKLDTKDDKKPIFDYQYKGMRLFDKCIKIHVLGRPKR 221

>Kwal_26.7066
          Length = 204

 Score = 71.6 bits (174), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 57/205 (27%), Positives = 87/205 (42%), Gaps = 37/205 (18%)

Query: 76  LYIIYELGSPGA-EETLRKFKIGGLADFRDIV------RAAEQGDRPEQPIPGLDLHTMT 128
           + I+YEL +    EE L K K+G L + +DI+      R  +  D           H  T
Sbjct: 1   MLILYELTAKEIHEEVLGKIKVGNLVEMKDIMTRFPSFRHTKHSD-------TTSCHLTT 53

Query: 129 FERLDKQRFPLHFEHNWVVNIILNDIRKLAVWRRLLLCDXXXXXXXXXXXXXXXXXXXXY 188
            ER  K ++ LH+E+NW ++I ++DIRKLA  R  LL                       
Sbjct: 54  LERSGKHQYKLHYENNWELDIFVSDIRKLARIRSTLLQRLNFRPNSSSGLIAPIGDLSKT 113

Query: 189 VLLRERRGRV--------SPQGMLQEDAPEGVPREG---------------DLNVEQKPV 225
            +LR  R  +         P+ +L+ D  +  P  G               D++ E+KP 
Sbjct: 114 KVLRRVREEIVSKQEASSEPKLLLESDEEDVFPESGGNEKEPTSNVLPEMIDVDSEKKPK 173

Query: 226 LDYRYKSVTNLGPGIEIHVLQRPRR 250
             +    + NLG  I+IH+L+RP R
Sbjct: 174 FKFSNVQMLNLGNCIDIHILKRPAR 198

>KLLA0E10637g 938243..940372 highly similar to sp|P00931
           Saccharomyces cerevisiae YGL026c TRP5 tryptophan
           synthase singleton, start by similarity
          Length = 709

 Score = 31.2 bits (69), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 29/46 (63%), Gaps = 5/46 (10%)

Query: 46  AIVRLKSPSVRVHLSEDDKQSLLAELRDDLLYIIYELGSPGAEETL 91
           +++ L +PS     + D++ SLL+ L D  +Y++  +G+ GA E++
Sbjct: 150 SLIPLVAPS-----TTDERLSLLSHLADSFIYVVSRMGTTGARESV 190

>Scas_679.28
          Length = 815

 Score = 30.0 bits (66), Expect = 1.8,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 31 AASCSLFEAPILSNSAIVRLKSPSVRVH-LSEDDKQSLLA-ELRDDLLYIIY 80
          +A  ++   PIL +  I+ L +P  R+H ++ DD+Q + A +L  D  Y+ +
Sbjct: 26 SADGTVLATPILDDIEIISLTTPQRRLHSIANDDEQEITALKLTPDAQYLSF 77

>Scas_648.14
          Length = 707

 Score = 29.3 bits (64), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 12/46 (26%), Positives = 28/46 (60%), Gaps = 5/46 (10%)

Query: 46  AIVRLKSPSVRVHLSEDDKQSLLAELRDDLLYIIYELGSPGAEETL 91
           +++ L +PS     + DD+  LL+ + D  +Y++  +G+ GA+ ++
Sbjct: 150 SLIPLVAPS-----TTDDRLELLSHIADSFVYVVSRMGTTGAQTSV 190

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.141    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,454,426
Number of extensions: 287028
Number of successful extensions: 607
Number of sequences better than 10.0: 10
Number of HSP's gapped: 598
Number of HSP's successfully gapped: 12
Length of query: 250
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 151
Effective length of database: 13,168,927
Effective search space: 1988507977
Effective search space used: 1988507977
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 60 (27.7 bits)