Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADR351C45244422740.0
Sklu_2164.250844916680.0
CAGL0F00693g45544416360.0
Scas_663.345744515990.0
Kwal_26.706745744915720.0
YOR323C (PRO2)45644515720.0
KLLA0A03982g44744315680.0
KLLA0E20801g90687740.48
Scas_684.14152337682.8
AFR008C29062655.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADR351C
         (444 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADR351C [2092] [Homologous to ScYOR323C (PRO2) - SH] (1324789..1...   880   0.0  
Sklu_2164.2 YOR323C, Contig c2164 742-2268 reverse complement         647   0.0  
CAGL0F00693g 79324..80691 highly similar to sp|P54885 Saccharomy...   634   0.0  
Scas_663.3                                                            620   0.0  
Kwal_26.7067                                                          610   0.0  
YOR323C (PRO2) [5105] chr15 complement(921530..922900) Gamma-glu...   610   0.0  
KLLA0A03982g 354208..355551 highly similar to sp|P54885 Saccharo...   608   0.0  
KLLA0E20801g complement(1842953..1845673) some similarities with...    33   0.48 
Scas_684.14                                                            31   2.8  
AFR008C [3200] [Homologous to ScYDR068W (DOS2) - SH] (451260..45...    30   5.1  

>ADR351C [2092] [Homologous to ScYOR323C (PRO2) - SH]
           (1324789..1326147) [1359 bp, 452 aa]
          Length = 452

 Score =  880 bits (2274), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/444 (97%), Positives = 433/444 (97%)

Query: 1   MSTLAESIAKKARVAGNVLKTLSNEQRTGVLRRIHDGLLAKKEDIRKANEADLETAAQNN 60
           MSTLAESIAKKARVAGNVLKTLSNEQRTGVLRRIHDGLLAKKEDIRKANEADLETAAQNN
Sbjct: 1   MSTLAESIAKKARVAGNVLKTLSNEQRTGVLRRIHDGLLAKKEDIRKANEADLETAAQNN 60

Query: 61  LAPALVQRLNLFKGDKFEAMLQGILDVAALEDPVGKLQMVRELDEGLTLYKVTAPVGVML 120
           LAPALVQRLNLFKGDKFEAMLQGILDVAALEDPVGKLQMVRELDEGLTLYKVTAPVGVML
Sbjct: 61  LAPALVQRLNLFKGDKFEAMLQGILDVAALEDPVGKLQMVRELDEGLTLYKVTAPVGVML 120

Query: 121 IIFESRPEVIANISALCIKSGNAGILKGGKETVNTFRELAAVINLVLAESEPETGVPVHA 180
           IIFESRPEVIANISALCIKSGNAGILKGGKETVNTFRELAAVINLVLAESEPETGVPVHA
Sbjct: 121 IIFESRPEVIANISALCIKSGNAGILKGGKETVNTFRELAAVINLVLAESEPETGVPVHA 180

Query: 181 VQLVESRSEVSDLLQQDEYIDLVVPRGSNALVKQIKASTKIPVLGHADGICSIYXXXXXX 240
           VQLVESRSEVSDLLQQDEYIDLVVPRGSNALVKQIKASTKIPVLGHADGICSIY      
Sbjct: 181 VQLVESRSEVSDLLQQDEYIDLVVPRGSNALVKQIKASTKIPVLGHADGICSIYLDADAD 240

Query: 241 XXXXXRIVLDSKTNYCAACNAAESLLINPRCSGWEEVLAHLIIAGNVKLHVTSDVKEAFF 300
                RIVLDSKTNYCAACNAAESLLINPRCSGWEEVLAHLIIAGNVKLHVTSDVKEAFF
Sbjct: 241 LAKAKRIVLDSKTNYCAACNAAESLLINPRCSGWEEVLAHLIIAGNVKLHVTSDVKEAFF 300

Query: 301 AYAGDDAALKGNVVDAEEGDFSREFLSLDIAVKFIDSVQEAVIHINEHSSKHTDAIVTEC 360
           AYAGDDAALKGNVVDAEEGDFSREFLSLDIAVKFIDSVQEAVIHINEHSSKHTDAIVTEC
Sbjct: 301 AYAGDDAALKGNVVDAEEGDFSREFLSLDIAVKFIDSVQEAVIHINEHSSKHTDAIVTEC 360

Query: 361 KQTADFFLKGIDSAGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTYQYQ 420
           KQTADFFLKGIDSAGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTYQYQ
Sbjct: 361 KQTADFFLKGIDSAGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTYQYQ 420

Query: 421 VRGTGQVASDYIGAGGDRAFVHKD 444
           VRGTGQVASDYIGAGGDRAFVHKD
Sbjct: 421 VRGTGQVASDYIGAGGDRAFVHKD 444

>Sklu_2164.2 YOR323C, Contig c2164 742-2268 reverse complement
          Length = 508

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/449 (69%), Positives = 370/449 (82%), Gaps = 5/449 (1%)

Query: 1   MSTLAESIAKKARVAGNVLKTLSNEQRTGVLRRIHDGLLAKKEDIRKANEADLETAAQNN 60
           MS+ AE IA+KAR+AGN+LKTLS+EQR+ +L  IHDGL A  E I KAN+ DL+ A + N
Sbjct: 52  MSSTAEKIAQKARLAGNILKTLSDEQRSKILYIIHDGLKANAESIEKANKVDLQNAKETN 111

Query: 61  LAPALVQRLNLFKGDKFEAMLQGILDVAALEDPVGKLQMVRELDEGLTLYKVTAPVGVML 120
           L+ +L++RL+LFKGDKFE MLQGI DVA LEDPVGK++M RELDE LTLY+VTAPVGV+L
Sbjct: 112 LSDSLIKRLDLFKGDKFETMLQGIKDVAELEDPVGKIKMARELDENLTLYQVTAPVGVLL 171

Query: 121 IIFESRPEVIANISALCIKSGNAGILKGGKETVNTFRELAAVINLVLAESEPETGVPVHA 180
           +IFESRPEVIANI+AL IKSGNA ILKGGKE+VNTFRE++ +IN ++AE+E  TGVP  A
Sbjct: 172 VIFESRPEVIANITALSIKSGNAAILKGGKESVNTFREMSRIINTIIAENEKLTGVPSGA 231

Query: 181 VQLVESRSEVSDLLQQDEYIDLVVPRGSNALVKQIKASTKIPVLGHADGICSIYXXXXXX 240
           VQL+E+R +VSDLL QD YIDLVVPRGSNALV+QIK STKIPVLGHADGICSIY      
Sbjct: 232 VQLIETRQDVSDLLDQDAYIDLVVPRGSNALVRQIKCSTKIPVLGHADGICSIYLDEDAD 291

Query: 241 XXXXXRIVLDSKTNYCAACNAAESLLINPRCSGWEEVLAHLIIAGNVKLHVTSDVKEAFF 300
                RI LD+KTNY A CNA E++LINP    W EVL +L + GNV +H+T DVKEA+ 
Sbjct: 292 LEKAKRITLDAKTNYPAGCNAVETILINPALKNWWEVLENLTLEGNVIVHLTKDVKEAYV 351

Query: 301 AYAGD----DAALKGNVVDAEEG-DFSREFLSLDIAVKFIDSVQEAVIHINEHSSKHTDA 355
           +   +    D AL+  +V+A E  DF +EFLSLD AVKF+ S QEAV HIN HSSKHTDA
Sbjct: 352 SKLKENGKLDEALEQKIVEANEAEDFDKEFLSLDCAVKFVSSTQEAVQHINLHSSKHTDA 411

Query: 356 IVTECKQTADFFLKGIDSAGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV 415
           I+TE K+ A+FFLKG+DS+GVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV
Sbjct: 412 IITENKEDAEFFLKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV 471

Query: 416 TYQYQVRGTGQVASDYIGAGGDRAFVHKD 444
           +YQYQ+RGTGQVASDY+GAGG++AF+HKD
Sbjct: 472 SYQYQIRGTGQVASDYLGAGGNKAFIHKD 500

>CAGL0F00693g 79324..80691 highly similar to sp|P54885 Saccharomyces
           cerevisiae YOR323c PRO2 gamma-glutamyl phosphate
           reductase, start by similarity
          Length = 455

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/444 (69%), Positives = 361/444 (81%), Gaps = 4/444 (0%)

Query: 5   AESIAKKARVAGNVLKTLSNEQRTGVLRRIHDGLLAKKEDIRKANEADLETAAQNNLAPA 64
           AE IAK+ARVAGNVLKT+S+E R+ +L RI D L   K++I  AN+ DLE A    LA +
Sbjct: 4   AEKIAKQARVAGNVLKTISDENRSKILYRIRDALANAKDEIESANKEDLEQARAGGLADS 63

Query: 65  LVQRLNLFKGDKFEAMLQGILDVAALEDPVGKLQMVRELDEGLTLYKVTAPVGVMLIIFE 124
           LV+RL+LFKGDKF+ MLQGI DVA LEDPVGK++M RE+D GL LY+VTAPVGV+L+IFE
Sbjct: 64  LVKRLDLFKGDKFDVMLQGISDVADLEDPVGKVKMAREIDNGLMLYQVTAPVGVILVIFE 123

Query: 125 SRPEVIANISALCIKSGNAGILKGGKETVNTFRELAAVINLVLAESEPETGVPVHAVQLV 184
           SRPEVIANI+ALCIKSGNAGILKGGKE+VNTF+ +A V+N  + + + ETGVPV AVQL+
Sbjct: 124 SRPEVIANITALCIKSGNAGILKGGKESVNTFKAMAKVVNQTIEQYKDETGVPVGAVQLI 183

Query: 185 ESRSEVSDLLQQDEYIDLVVPRGSNALVKQIKASTKIPVLGHADGICSIYXXXXXXXXXX 244
           E+R +VSDLL QDEYIDLVVPRGSN+LV+QIK STKIPVLGHADGICSIY          
Sbjct: 184 ETRQDVSDLLGQDEYIDLVVPRGSNSLVRQIKDSTKIPVLGHADGICSIYVDRDADLEKA 243

Query: 245 XRIVLDSKTNYCAACNAAESLLINPRCSGWEEVLAHLIIAGNVKLHVTSDVKEAFFAYAG 304
            RIVLD+KTNY A CNA E LL+NP  S W++VL HLI  G V +H T+DVKEAF     
Sbjct: 244 KRIVLDAKTNYPAGCNAMEGLLLNPDFSQWDDVLHHLITEGGVTIHATTDVKEAFLKKLQ 303

Query: 305 DDAAL----KGNVVDAEEGDFSREFLSLDIAVKFIDSVQEAVIHINEHSSKHTDAIVTEC 360
           D   L    K  +VDA++GDF +EFLSLD AVKFI +  +A+ HINEHSSKHTDAI+TE 
Sbjct: 304 DSGKLNDDIKAKIVDAKDGDFDKEFLSLDCAVKFIPNTVDAINHINEHSSKHTDAIITES 363

Query: 361 KQTADFFLKGIDSAGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTYQYQ 420
           K+ A+ FLKGIDS+GVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTYQYQ
Sbjct: 364 KEDAEKFLKGIDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTYQYQ 423

Query: 421 VRGTGQVASDYIGAGGDRAFVHKD 444
           +RG GQVASDY+GAGG++AFVHKD
Sbjct: 424 IRGDGQVASDYLGAGGNKAFVHKD 447

>Scas_663.3
          Length = 457

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/445 (66%), Positives = 359/445 (80%), Gaps = 5/445 (1%)

Query: 5   AESIAKKARVAGNVLKTLSNEQRTGVLRRIHDGLLAKKEDIRKANEADLETAAQNNLAPA 64
           A+ IA++AR+AGN LKT+SN+ R+ +L +I D L A   DI  AN+ DL+ A + +L+ +
Sbjct: 4   AQQIAQRARMAGNSLKTISNDNRSAILYKIRDALKAGASDIEAANKLDLQNAKETHLSDS 63

Query: 65  LVQRLNLFKGDKFEAMLQGILDVAALEDPVGKLQMVRELDEGLTLYKVTAPVGVMLIIFE 124
           L++RL+LFKGDKFE MLQGI DVA LEDPVGK++M RELDEGLTLY+VTAPVGV+L+IFE
Sbjct: 64  LLKRLDLFKGDKFETMLQGIKDVADLEDPVGKIKMARELDEGLTLYQVTAPVGVLLVIFE 123

Query: 125 SRPEVIANISALCIKSGNAGILKGGKETVNTFRELAAVINLVLAESEPETGVPVHAVQLV 184
           SRPEVIANI+ALCIKSGNAGILKGGKE+VNTFRE++ +IN  + ++E ETGVPV AVQL+
Sbjct: 124 SRPEVIANITALCIKSGNAGILKGGKESVNTFREMSRIINDTIEKNEKETGVPVGAVQLI 183

Query: 185 ESRSEVSDLLQQDEYIDLVVPRGSNALVKQIKASTKIPVLGHADGICSIYXXXXXXXXXX 244
           E+R +V+DLL QDEYIDLVVPRGSNALV+ IK STKIPVLGHADGICS+Y          
Sbjct: 184 ETRQDVNDLLDQDEYIDLVVPRGSNALVRNIKNSTKIPVLGHADGICSVYIDEEADLEKA 243

Query: 245 XRIVLDSKTNYCAACNAAESLLINPRCSGWEEVLAHLIIAGNVKLHVTSDVKEAFF---- 300
            RIV D+KTNY A CNA E+LLINP C  W EVL ++   G+V LH   DVK+A+     
Sbjct: 244 KRIVFDAKTNYPAGCNAMETLLINPSCPNWWEVLENVTRKGDVTLHCMPDVKKAYLDKLT 303

Query: 301 AYAGDDAALKGNVVDAEEG-DFSREFLSLDIAVKFIDSVQEAVIHINEHSSKHTDAIVTE 359
                D  +K + VD +E  DF +EFLSLD AVKF++S +EA+ HIN HSS+HTDAIVTE
Sbjct: 304 QLGTSDDVIKTHTVDVDEKHDFDKEFLSLDCAVKFVNSTEEAIKHINVHSSRHTDAIVTE 363

Query: 360 CKQTADFFLKGIDSAGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTYQY 419
            K +A+ FLKG+DS+GVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV+YQY
Sbjct: 364 NKDSAELFLKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVSYQY 423

Query: 420 QVRGTGQVASDYIGAGGDRAFVHKD 444
           Q+RG GQ+A DY+GAGG+RAF+HKD
Sbjct: 424 QIRGNGQIAGDYLGAGGNRAFIHKD 448

>Kwal_26.7067
          Length = 457

 Score =  610 bits (1572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/449 (64%), Positives = 359/449 (79%), Gaps = 5/449 (1%)

Query: 1   MSTLAESIAKKARVAGNVLKTLSNEQRTGVLRRIHDGLLAKKEDIRKANEADLETAAQNN 60
           MS+ +E+IAK AR+ GNVLKT+SNE R+ +L +IHDGL A    I++AN+ DLE A + N
Sbjct: 1   MSSNSETIAKNARLGGNVLKTISNEARSSLLYKIHDGLKANANSIKEANKKDLEIAKEAN 60

Query: 61  LAPALVQRLNLFKGDKFEAMLQGILDVAALEDPVGKLQMVRELDEGLTLYKVTAPVGVML 120
           LA +L +RL+LFKGDKF+ ML GI DVA LEDPVGK+++ RELDE L LY+VTAPVG +L
Sbjct: 61  LADSLYRRLDLFKGDKFDTMLVGIKDVAELEDPVGKIKLARELDENLNLYQVTAPVGALL 120

Query: 121 IIFESRPEVIANISALCIKSGNAGILKGGKETVNTFRELAAVINLVLAESEPETGVPVHA 180
           +IFESRPEVIANI++L IKSGNA ILKGGKE+V+TFRE++ +IN V++E+E  +G+P   
Sbjct: 121 VIFESRPEVIANITSLAIKSGNAAILKGGKESVHTFREISRIINTVISENEASSGIPASV 180

Query: 181 VQLVESRSEVSDLLQQDEYIDLVVPRGSNALVKQIKASTKIPVLGHADGICSIYXXXXXX 240
           +QL+E+R +VSDLLQQD YIDLVVPRGSN LV++IKASTKIPVLGHADGICSIY      
Sbjct: 181 IQLIETRQDVSDLLQQDMYIDLVVPRGSNELVRKIKASTKIPVLGHADGICSIYLDEEAD 240

Query: 241 XXXXXRIVLDSKTNYCAACNAAESLLINPRCSGWEEVLAHLIIAGNVKLHVTSDVKEAFF 300
                RI +D+KT+Y A CNA E+LLINP+ S W +VL +L   G+V LHVT DVK ++F
Sbjct: 241 LQKALRITIDAKTSYPAGCNAMETLLINPKMSQWWKVLENLSKTGDVTLHVTEDVKASYF 300

Query: 301 AYAGD----DAALKGNVVDAEEG-DFSREFLSLDIAVKFIDSVQEAVIHINEHSSKHTDA 355
           A   +    D  +    VDA    DF +EFLSLD AVKF+ S ++AV HIN HSSKHTDA
Sbjct: 301 AKLAESNELDDVITKKTVDANTSEDFDKEFLSLDCAVKFVSSTEDAVSHINLHSSKHTDA 360

Query: 356 IVTECKQTADFFLKGIDSAGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV 415
           I+TE K  A++F+KG+DS+GVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV
Sbjct: 361 IITENKSNAEYFMKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV 420

Query: 416 TYQYQVRGTGQVASDYIGAGGDRAFVHKD 444
           +YQYQ+RG GQ+ASDY+G+GG RAFVHK+
Sbjct: 421 SYQYQLRGDGQIASDYVGSGGKRAFVHKN 449

>YOR323C (PRO2) [5105] chr15 complement(921530..922900)
           Gamma-glutamyl phosphate reductase (phosphoglutamate
           dehydrogenase), proline biosynthetic enzyme [1371 bp,
           456 aa]
          Length = 456

 Score =  610 bits (1572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/445 (66%), Positives = 356/445 (80%), Gaps = 5/445 (1%)

Query: 5   AESIAKKARVAGNVLKTLSNEQRTGVLRRIHDGLLAKKEDIRKANEADLETAAQNNLAPA 64
           ++ IAK AR AGN+LKT+SNE R+ +L +IHD L A    I +AN+ DL  A +  LA +
Sbjct: 4   SQQIAKNARKAGNILKTISNEGRSDILYKIHDALKANAHAIEEANKIDLAVAKETGLADS 63

Query: 65  LVQRLNLFKGDKFEAMLQGILDVAALEDPVGKLQMVRELDEGLTLYKVTAPVGVMLIIFE 124
           L++RL+LFKGDKFE MLQGI DVA LEDPVGK++M RELD+GLTLY+VTAPVGV+L+IFE
Sbjct: 64  LLKRLDLFKGDKFEVMLQGIKDVAELEDPVGKVKMARELDDGLTLYQVTAPVGVLLVIFE 123

Query: 125 SRPEVIANISALCIKSGNAGILKGGKETVNTFRELAAVINLVLAESEPETGVPVHAVQLV 184
           SRPEVIANI+AL IKSGNA ILKGGKE+VNTFRE+A ++N  +A+ + ETGVPV +VQL+
Sbjct: 124 SRPEVIANITALSIKSGNAAILKGGKESVNTFREMAKIVNDTIAQFQSETGVPVGSVQLI 183

Query: 185 ESRSEVSDLLQQDEYIDLVVPRGSNALVKQIKASTKIPVLGHADGICSIYXXXXXXXXXX 244
           E+R +VSDLL QDEYIDLVVPRGSNALV++IK +TKIPVLGHADGICSIY          
Sbjct: 184 ETRQDVSDLLDQDEYIDLVVPRGSNALVRKIKDTTKIPVLGHADGICSIYLDEDADLIKA 243

Query: 245 XRIVLDSKTNYCAACNAAESLLINPRCSGWEEVLAHLIIAGNVKLHVTSDVKEAFFAYAG 304
            RI LD+KTNY A CNA E+LLINP+ S W EVL +L + G V +H T D+K A+F    
Sbjct: 244 KRISLDAKTNYPAGCNAMETLLINPKFSKWWEVLENLTLEGGVTIHATKDLKTAYFDKLN 303

Query: 305 D----DAALKGNVVDA-EEGDFSREFLSLDIAVKFIDSVQEAVIHINEHSSKHTDAIVTE 359
           +      A++   VDA EE DF +EFLSLD+A KF+ S + A+ HIN HSS+HTDAIVTE
Sbjct: 304 ELGKLTEAIQCKTVDADEEQDFDKEFLSLDLAAKFVTSTESAIQHINTHSSRHTDAIVTE 363

Query: 360 CKQTADFFLKGIDSAGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTYQY 419
            K  A+ F+KG+DS+GVYWNASTRFADGFRYGFG EVGISTSKIHARGPVGLDGLV+YQY
Sbjct: 364 NKANAEKFMKGVDSSGVYWNASTRFADGFRYGFGAEVGISTSKIHARGPVGLDGLVSYQY 423

Query: 420 QVRGTGQVASDYIGAGGDRAFVHKD 444
           Q+RG GQVASDY+GAGG++AFVHKD
Sbjct: 424 QIRGDGQVASDYLGAGGNKAFVHKD 448

>KLLA0A03982g 354208..355551 highly similar to sp|P54885
           Saccharomyces cerevisiae YOR323c PRO2 gamma-glutamyl
           phosphate reductase singleton, start by similarity
          Length = 447

 Score =  608 bits (1568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/443 (65%), Positives = 359/443 (81%), Gaps = 6/443 (1%)

Query: 3   TLAESIAKKARVAGNVLKTLSNEQRTGVLRRIHDGLLAKKEDIRKANEADLETAAQNNLA 62
           +++ESIAK AR AGN+LKTLS+E+R+ +L +IHDGL A    I  AN+ DLE A   NL+
Sbjct: 2   SVSESIAKTARAAGNILKTLSDEERSSILYKIHDGLKANAASIEAANKLDLEQAKSTNLS 61

Query: 63  PALVQRLNLFKGDKFEAMLQGILDVAALEDPVGKLQMVRELDEGLTLYKVTAPVGVMLII 122
            +LV+RL+LFKGDKFE MLQGI+DVA L+DPVGK+   RE+DE LTLY++TAPVGV+L+I
Sbjct: 62  DSLVKRLDLFKGDKFETMLQGIVDVANLQDPVGKVNFAREIDENLTLYQITAPVGVLLVI 121

Query: 123 FESRPEVIANISALCIKSGNAGILKGGKETVNTFRELAAVINLVLAESEPETGVPVHAVQ 182
           FESRPEVIANI+AL IKSGNA ILKGGKE++NTF+E++ ++N V+ ++E  T VPV AVQ
Sbjct: 122 FESRPEVIANITALSIKSGNAAILKGGKESLNTFKEMSRIVNDVVEQNEKTTHVPVGAVQ 181

Query: 183 LVESRSEVSDLLQQDEYIDLVVPRGSNALVKQIKASTKIPVLGHADGICSIYXXXXXXXX 242
           L+E+R +VSDLLQQDEYIDLV+PRGSNALV+QIK+STKIPVLGHADGICSIY        
Sbjct: 182 LIETREDVSDLLQQDEYIDLVIPRGSNALVRQIKSSTKIPVLGHADGICSIYVDESADIG 241

Query: 243 XXXRIVLDSKTNYCAACNAAESLLINPRCSGWEEVLAHLIIAGNVKLHVTSDVKEAFFAY 302
              RI++D+KTNY A CNA E+LLINP+   W EVL  LI  G V LHV+ +VK+ +   
Sbjct: 242 KAKRILVDAKTNYPAGCNAVETLLINPKLQHWWEVLNSLIENG-VTLHVSKEVKKQY--- 297

Query: 303 AGDDAALKGNVVDAEEG-DFSREFLSLDIAVKFIDSVQEAVIHINEHSSKHTDAIVTECK 361
             +  +   ++VD +E  DF +EFLSLDIAV F++S + AV+HIN HSSKHTDAIVTE  
Sbjct: 298 -KEHNSTSDHIVDLDESKDFDKEFLSLDIAVAFVESTEAAVLHINTHSSKHTDAIVTENS 356

Query: 362 QTADFFLKGIDSAGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTYQYQV 421
           + A++FLK +DS+ VYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTYQYQ+
Sbjct: 357 ENAEYFLKAVDSSSVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTYQYQL 416

Query: 422 RGTGQVASDYIGAGGDRAFVHKD 444
           RG GQ+ASDY+GAGG +AFVHKD
Sbjct: 417 RGNGQIASDYLGAGGKKAFVHKD 439

>KLLA0E20801g complement(1842953..1845673) some similarities with
           sp|P40068 Saccharomyces cerevisiae YER109c PHD5 required
           for diploid filamentous growth singleton, hypothetical
           start
          Length = 906

 Score = 33.1 bits (74), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 39/87 (44%), Gaps = 12/87 (13%)

Query: 140 SGNAGILKGGKETVNTFRELAAVINLVLAESEPETGVPVHAVQLVESRSEVSDLLQQ--- 196
           +GN GI+     T N+    A  IN+V     P +G      Q     S+ S L QQ   
Sbjct: 435 NGNEGIINNEHMTPNSSSSYA--INMVAPTQIPSSG------QGQAPYSKPSSLSQQFGS 486

Query: 197 -DEYIDLVVPRGSNALVKQIKASTKIP 222
              YI++ +P  + A+  Q  + T+IP
Sbjct: 487 IPTYINMNIPNSAPAMPSQRNSQTQIP 513

>Scas_684.14
          Length = 1523

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 4/37 (10%)

Query: 257  AACNAAESLLINPRCSG----WEEVLAHLIIAGNVKL 289
            +AC A   +L+ PR SG    W+++   L+  G+VK+
Sbjct: 1263 SACRALTDMLLAPRSSGLLTEWQQIRGSLLATGDVKI 1299

>AFR008C [3200] [Homologous to ScYDR068W (DOS2) - SH]
           (451260..452132) [873 bp, 290 aa]
          Length = 290

 Score = 29.6 bits (65), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 9/62 (14%)

Query: 148 GGKETVNTFRELAAVINLVLAESEPETGVPVHAVQLVESRSEVSDLLQQDE----YIDLV 203
            G  T     +LA   NL LA  +P     V  + + E   E++DLL+QDE     ++ +
Sbjct: 139 AGSRTAAQLWQLATDQNLYLAYKDP-----VPEINIEERTEEIADLLKQDEALRKLMNTI 193

Query: 204 VP 205
           VP
Sbjct: 194 VP 195

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,549,717
Number of extensions: 501228
Number of successful extensions: 1399
Number of sequences better than 10.0: 18
Number of HSP's gapped: 1419
Number of HSP's successfully gapped: 18
Length of query: 444
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 339
Effective length of database: 12,961,219
Effective search space: 4393853241
Effective search space used: 4393853241
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)