Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADR350W1311128768090.0
KLLA0A04015g1343129047640.0
Kwal_26.70701315129447370.0
YAL026C (DRS2)1355129745230.0
CAGL0G06270g1328128744620.0
YER166W (DNF1)1571105816630.0
CAGL0G08085g1578109616580.0
AGR120C1547110616540.0
KLLA0C17644g1576106416450.0
YDR093W (DNF2)1612106116450.0
CAGL0L11814g1576106916350.0
Scas_505.4102542315790.0
Scas_576.81591107516210.0
Scas_636.161554109916170.0
YIL048W (NEO1)115187410331e-120
Scas_704.38116186810231e-118
Sklu_2193.1114386810211e-118
CAGL0L00715g114486310191e-118
ADL079C116687710121e-117
KLLA0C08393g114886710091e-117
Kwal_23.578911338699821e-113
KLLA0E01650g15505397657e-83
CAGL0H04477g16265667667e-83
Kwal_23.355615975197604e-82
YMR162C (DNF3)16565757426e-80
AFL191W15755326991e-74
Scas_669.316384986848e-73
Scas_89.12712694226e-46
CAGL0K12034g10878162253e-18
AFL011W12427272083e-16
KLLA0B08217g14393072041e-15
Kwal_26.920714694691994e-15
AFR567W14493301985e-15
Scas_665.3014392981977e-15
CAGL0M11308g14523581969e-15
Kwal_47.1754712403151791e-12
YOR291W14723121781e-12
YGL167C (PMR1)9505001762e-12
Kwal_23.316011008231744e-12
KLLA0A08910g12803201726e-12
CAGL0I04312g9515891701e-11
KLLA0F20658g10825811672e-11
Scas_707.48*7414651662e-11
YEL031W (SPF1)12157111672e-11
YDR038C (ENA5)10918601672e-11
YDR040C (ENA1)10918601663e-11
YDR039C (ENA2)10918601663e-11
AEL301W9574701644e-11
CAGL0L01419g12147041602e-10
Scas_583.14*8752961546e-10
CAGL0A00517g11227681556e-10
KLLA0E22352g12067281521e-09
KLLA0E14630g10825721521e-09
YGL006W (PMC1)11733271466e-09
CAGL0J01870g9464571458e-09
AGL097C10963521361e-07
AFR354C12102991332e-07
Kwal_14.14989394651261e-06
KLLA0A03157g9384761233e-06
Kwal_47.175228994531037e-04
KLLA0A09031g899453960.005
Kwal_56.23467280182910.012
AGL085C909507890.031
YPL036W (PMA2)947450870.053
CAGL0A00495g902440830.15
Scas_569.0d46860820.18
YGL008C (PMA1)918303790.46
Scas_710.41904302780.59
Scas_297.180059761.1
Kwal_27.106231142105741.8
Scas_688.1913303741.8
Scas_630.14701121732.4
KLLA0F07447g97572732.6
YGR200C (ELP2)78872705.7
KLLA0D04092g115270696.7
YIL140W (AXL2)82361697.1
Scas_665.139283688.8
CAGL0M05379g212134669.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADR350W
         (1287 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...  2627   0.0  
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...  1839   0.0  
Kwal_26.7070                                                         1829   0.0  
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...  1746   0.0  
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...  1723   0.0  
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...   645   0.0  
CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...   643   0.0  
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...   641   0.0  
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...   638   0.0  
YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...   638   0.0  
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...   634   0.0  
Scas_505.4                                                            612   0.0  
Scas_576.8                                                            629   0.0  
Scas_636.16                                                           627   0.0  
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...   402   e-120
Scas_704.38                                                           398   e-118
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement         397   e-118
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...   397   e-118
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...   394   e-117
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...   393   e-117
Kwal_23.5789                                                          382   e-113
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...   299   7e-83
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...   299   7e-83
Kwal_23.3556                                                          297   4e-82
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...   290   6e-80
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...   273   1e-74
Scas_669.3                                                            268   8e-73
Scas_89.1                                                             167   6e-46
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...    91   3e-18
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...    85   3e-16
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...    83   1e-15
Kwal_26.9207                                                           81   4e-15
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...    81   5e-15
Scas_665.30                                                            80   7e-15
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...    80   9e-15
Kwal_47.17547                                                          74   1e-12
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...    73   1e-12
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...    72   2e-12
Kwal_23.3160                                                           72   4e-12
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...    71   6e-12
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...    70   1e-11
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...    69   2e-11
Scas_707.48*                                                           69   2e-11
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...    69   2e-11
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...    69   2e-11
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...    69   3e-11
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...    69   3e-11
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...    68   4e-11
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...    66   2e-10
Scas_583.14*                                                           64   6e-10
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...    64   6e-10
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...    63   1e-09
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...    63   1e-09
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...    61   6e-09
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...    60   8e-09
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....    57   1e-07
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    56   2e-07
Kwal_14.1498                                                           53   1e-06
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....    52   3e-06
Kwal_47.17522                                                          44   7e-04
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...    42   0.005
Kwal_56.23467                                                          40   0.012
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...    39   0.031
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...    38   0.053
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...    37   0.15 
Scas_569.0d                                                            36   0.18 
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...    35   0.46 
Scas_710.41                                                            35   0.59 
Scas_297.1                                                             34   1.1  
Kwal_27.10623                                                          33   1.8  
Scas_688.1                                                             33   1.8  
Scas_630.14                                                            33   2.4  
KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...    33   2.6  
YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa sub...    32   5.7  
KLLA0D04092g complement(344666..348124) some similarities with s...    31   6.7  
YIL140W (AXL2) [2536] chr9 (85366..87837) Membrane glycoprotein ...    31   7.1  
Scas_665.1                                                             31   8.8  
CAGL0M05379g 574752..575390 highly similar to sp|P38307 Saccharo...    30   9.9  

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
            complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score = 2627 bits (6809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1264/1287 (98%), Positives = 1264/1287 (98%)

Query: 1    MSGSRDKHNEETLFDIDFLDDRYTPEPARPVNDSGSRSGPIIDSGIDDLVQMQRTGFPQE 60
            MSGSRDKHNEETLFDIDFLDDRYTPEPARPVNDSGSRSGPIIDSGIDDLVQMQRTGFPQE
Sbjct: 1    MSGSRDKHNEETLFDIDFLDDRYTPEPARPVNDSGSRSGPIIDSGIDDLVQMQRTGFPQE 60

Query: 61   VIDLDDEPPFRHDDSIENDLIENPFDDERGQQRYLASANRLSVPQPSGWQRLVGGLRDSV 120
            VIDLDDEPPFRHDDSIENDLIENPFDDERGQQRYLASANRLSVPQPSGWQRLVGGLRDSV
Sbjct: 61   VIDLDDEPPFRHDDSIENDLIENPFDDERGQQRYLASANRLSVPQPSGWQRLVGGLRDSV 120

Query: 121  GGRGTENSQYQSFEMQDYRDTHSGDRYQRSRNKFNLKALFDHYVLRKPAAADTGAGEPRV 180
            GGRGTENSQYQSFEMQDYRDTHSGDRYQRSRNKFNLKALFDHYVLRKPAAADTGAGEPRV
Sbjct: 121  GGRGTENSQYQSFEMQDYRDTHSGDRYQRSRNKFNLKALFDHYVLRKPAAADTGAGEPRV 180

Query: 181  IYINERRANGAMGYGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTP 240
            IYINERRANGAMGYGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTP
Sbjct: 181  IYINERRANGAMGYGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTP 240

Query: 241  TNRFXXXXXXXXXXXXSAIKESVEDLKRSNSDKELNHSRADVYSDEMGQFISKKWIDIAV 300
            TNRF            SAIKESVEDLKRSNSDKELNHSRADVYSDEMGQFISKKWIDIAV
Sbjct: 241  TNRFTTIGTLIVVLVVSAIKESVEDLKRSNSDKELNHSRADVYSDEMGQFISKKWIDIAV 300

Query: 301  GDIIRVRSEEAIPADLIVLSSSEPEGLCYIETANLDGETNLKIKQARPETSKILDVRELS 360
            GDIIRVRSEEAIPADLIVLSSSEPEGLCYIETANLDGETNLKIKQARPETSKILDVRELS
Sbjct: 301  GDIIRVRSEEAIPADLIVLSSSEPEGLCYIETANLDGETNLKIKQARPETSKILDVRELS 360

Query: 361  AMRGKILSEQPNTSLYTYEGTMILHNNRIPLSPDQILLRGATLRNTVWIFGIVIFTGHET 420
            AMRGKILSEQPNTSLYTYEGTMILHNNRIPLSPDQILLRGATLRNTVWIFGIVIFTGHET
Sbjct: 361  AMRGKILSEQPNTSLYTYEGTMILHNNRIPLSPDQILLRGATLRNTVWIFGIVIFTGHET 420

Query: 421  KLTRNATATPIKRTAVERVINLQIVALFGVLICLSLISSFGNLIVMYNQKENLSYLYLQG 480
            KLTRNATATPIKRTAVERVINLQIVALFGVLICLSLISSFGNLIVMYNQKENLSYLYLQG
Sbjct: 421  KLTRNATATPIKRTAVERVINLQIVALFGVLICLSLISSFGNLIVMYNQKENLSYLYLQG 480

Query: 481  TNMVALFFKNILTFWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRT 540
            TNMVALFFKNILTFWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRT
Sbjct: 481  TNMVALFFKNILTFWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRT 540

Query: 541  SSLVEELGQIEYIFSDKTGTLTQNVMEFKSCSIAGRCYIQSIPEDKDAAFDEGIEVGYRT 600
            SSLVEELGQIEYIFSDKTGTLTQNVMEFKSCSIAGRCYIQSIPEDKDAAFDEGIEVGYRT
Sbjct: 541  SSLVEELGQIEYIFSDKTGTLTQNVMEFKSCSIAGRCYIQSIPEDKDAAFDEGIEVGYRT 600

Query: 601  YDDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPDEGALVQGAAD 660
            YDDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPDEGALVQGAAD
Sbjct: 601  YDDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPDEGALVQGAAD 660

Query: 661  LGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPDNSIRLLCKGAD 720
            LGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPDNSIRLLCKGAD
Sbjct: 661  LGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPDNSIRLLCKGAD 720

Query: 721  TVILERLAATSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATTMH 780
            TVILERLAATSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATTMH
Sbjct: 721  TVILERLAATSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATTMH 780

Query: 781  NRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAIN 840
            NRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAIN
Sbjct: 781  NRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAIN 840

Query: 841  IGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLGF 900
            IGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLGF
Sbjct: 841  IGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLGF 900

Query: 901  ALEPDLEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQA 960
            ALEPDLEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQA
Sbjct: 901  ALEPDLEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQA 960

Query: 961  AHVGVGISGMEGMQAARSADFALGQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYM 1020
            AHVGVGISGMEGMQAARSADFALGQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYM
Sbjct: 961  AHVGVGISGMEGMQAARSADFALGQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYM 1020

Query: 1021 TQFWYVLYNAFSGQSIMESWTLTFYNWGGTAAPPGPPKRRDQFERSGLLNRDAQSCTVGQ 1080
            TQFWYVLYNAFSGQSIMESWTLTFYNWGGTAAPPGPPKRRDQFERSGLLNRDAQSCTVGQ
Sbjct: 1021 TQFWYVLYNAFSGQSIMESWTLTFYNWGGTAAPPGPPKRRDQFERSGLLNRDAQSCTVGQ 1080

Query: 1081 KGQFWPATIFRGSAINGNYHNWITIDGWIMDYRYGAAGAMHGETADHWVWGVAIQPTSII 1140
            KGQFWPATIFRGSAINGNYHNWITIDGWIMDYRYGAAGAMHGETADHWVWGVAIQPTSII
Sbjct: 1081 KGQFWPATIFRGSAINGNYHNWITIDGWIMDYRYGAAGAMHGETADHWVWGVAIQPTSII 1140

Query: 1141 FVLGKAALITNQWTKFTVLAIPGSLVFWLLFFPIYAYLLPGLNVSKEYYGIVSHVYGSFT 1200
            FVLGKAALITNQWTKFTVLAIPGSLVFWLLFFPIYAYLLPGLNVSKEYYGIVSHVYGSFT
Sbjct: 1141 FVLGKAALITNQWTKFTVLAIPGSLVFWLLFFPIYAYLLPGLNVSKEYYGIVSHVYGSFT 1200

Query: 1201 FWAMCYVXXXXXXXXXXXWKYYKRTYTPESYHVVQEMQKYDISDNRPRIEQFQKAIRKVR 1260
            FWAMCYV           WKYYKRTYTPESYHVVQEMQKYDISDNRPRIEQFQKAIRKVR
Sbjct: 1201 FWAMCYVLPVLALLRDLLWKYYKRTYTPESYHVVQEMQKYDISDNRPRIEQFQKAIRKVR 1260

Query: 1261 QVQRMKKQRGFAFSQSEEAGQDRIVRM 1287
            QVQRMKKQRGFAFSQSEEAGQDRIVRM
Sbjct: 1261 QVQRMKKQRGFAFSQSEEAGQDRIVRM 1287

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
            Saccharomyces cerevisiae YAL026c DRS2 P-type
            amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score = 1839 bits (4764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 908/1290 (70%), Positives = 1039/1290 (80%), Gaps = 23/1290 (1%)

Query: 1    MSGSRDKHNEETLFDIDFLDDRYTPEPARPVNDSGSRSGP--IIDSGIDDLVQMQRTGFP 58
            MSGS    + + LFD+DFLDD YTP+    + DS  R+ P  +IDSG+D     QR   P
Sbjct: 25   MSGSTKHGDSDALFDVDFLDDSYTPD----LRDSPRRNSPSAVIDSGMD---TSQRGLLP 77

Query: 59   QEVIDLDDEPPFRHDDSIENDLIENPFDDERGQQRYLASANRLSV-PQPSGWQRLVGGLR 117
            QE IDL D        +IEND IENPF+D R    +  +  R SV PQPSG+ R +  ++
Sbjct: 78   QETIDLSD--------NIEND-IENPFND-RYSASFADTNPRNSVLPQPSGFNRFMSNVK 127

Query: 118  DSVGGRGTENSQYQSFEMQDYRDTHSGDRYQRSRNKFNLKALFDHYVLRKPAAADTGAGE 177
             +VG  G    Q+QSFEM DY D  + +RY+ S  KF++K LF+ Y+LRK       + E
Sbjct: 128  SAVGMNGGHKGQFQSFEMNDY-DQSNTNRYESSTRKFDIKVLFNRYILRK-GKTSCKSDE 185

Query: 178  PRVIYINERRANGAMGYGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPN 237
            PR I +N+  AN   GY DNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPN
Sbjct: 186  PRTILLNDSSANSRFGYRDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPN 245

Query: 238  VTPTNRFXXXXXXXXXXXXSAIKESVEDLKRSNSDKELNHSRADVYSDEMGQFISKKWID 297
            VTPTNR+            SA+KESVEDLKRSN+DKELNHS  DV  +  G+F+ KKWID
Sbjct: 246  VTPTNRYTTIGTLLVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWID 305

Query: 298  IAVGDIIRVRSEEAIPADLIVLSSSEPEGLCYIETANLDGETNLKIKQARPETSKILDVR 357
            IAVGDIIRVRSEEAIPADLI+LSSSEPEGLCYIETANLDGETNLKIKQAR ET+  LD +
Sbjct: 306  IAVGDIIRVRSEEAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDEK 365

Query: 358  ELSAMRGKILSEQPNTSLYTYEGTMILHNNRIPLSPDQILLRGATLRNTVWIFGIVIFTG 417
             L  + G++ SE PN+SLYTYEGTM L+ +  PLSPDQ+LLRGATLRNT WIFG+++FTG
Sbjct: 366  ALCKLHGRVQSEHPNSSLYTYEGTMTLNGSTFPLSPDQMLLRGATLRNTAWIFGLIVFTG 425

Query: 418  HETKLTRNATATPIKRTAVERVINLQIVALFGVLICLSLISSFGNLIVMYNQKENLSYLY 477
            HETKL RNATATPIKRTAVERVIN+QI+ALFGVLI L+LISS GN+I+      +L YLY
Sbjct: 426  HETKLMRNATATPIKRTAVERVINMQILALFGVLIVLALISSTGNVIMTKRDSAHLGYLY 485

Query: 478  LQGTNMVALFFKNILTFWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTV 537
            ++GTN   LFFK+ILTFWILFSNLVPISLFVTVEMIKYYQAYMI SDLDL+HEES+ PTV
Sbjct: 486  IEGTNKAGLFFKDILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESDTPTV 545

Query: 538  VRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKSCSIAGRCYIQSIPEDKDAAFDEGIEVG 597
            VRTSSLVEELGQIEYIFSDKTGTLT+NVMEFKS SIAGRCYI++IPED+ A  ++GIE+G
Sbjct: 546  VRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDGIEIG 605

Query: 598  YRTYDDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPDEGALVQG 657
            + +++ + + +  P   +  I+ EFLTLL+ CHTVIPE Q +G+IKYQAASPDEGALVQG
Sbjct: 606  FHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAASPDEGALVQG 665

Query: 658  AADLGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPDNSIRLLCK 717
            AADLG++F IR+PNSV+I     +E++ Y+LLNICEFNSTRKRMSAIFR PD SI+L CK
Sbjct: 666  AADLGFRFDIRRPNSVSI-STPFSEQLEYQLLNICEFNSTRKRMSAIFRMPDGSIKLFCK 724

Query: 718  GADTVILERLAATSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAAT 777
            GADTVILERL +  NPYV +TLRHLEDYAAEGLRTLCIASRTIPE EYEEWSK+Y+AA+T
Sbjct: 725  GADTVILERLDSEFNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAAST 784

Query: 778  TMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQET 837
            TM +R+EELD+ AE+IE  L  LGATAIEDKLQ+GVPETIH LQ+AG+KVWVLTGDRQET
Sbjct: 785  TMKDRTEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQET 844

Query: 838  AINIGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKS 897
            AINIGMSC+LLSEDMNLLIVNE+TKE TR NL  KL AI  HQISQQDMN+LALVIDGKS
Sbjct: 845  AINIGMSCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKS 904

Query: 898  LGFALEPDLEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSM 957
            LG+ALE DLE+  L IGK+C+AVICCRVSPLQKALVVKMVKR+T SLLLAIGDGANDVSM
Sbjct: 905  LGYALEEDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSM 964

Query: 958  IQAAHVGVGISGMEGMQAARSADFALGQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIA 1017
            IQAAHVGVGISGMEGMQAARSADFA+GQF++L+KLL+VHGSWSYQRIS AILYSFYKN+A
Sbjct: 965  IQAAHVGVGISGMEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMA 1024

Query: 1018 LYMTQFWYVLYNAFSGQSIMESWTLTFYNWGGTAAPPGPPKRRDQFERSGLLNRDAQSCT 1077
            LYMTQFWYV  NAFSGQSIMESWTLTFYN   T  PP      DQF  S LL+R  Q   
Sbjct: 1025 LYMTQFWYVFANAFSGQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYPQLYK 1084

Query: 1078 VGQKGQFWPATIFRGSAINGNYHNWITIDGWIMDYRYGAAGAMHGETADHWVWGVAIQPT 1137
            +GQKGQF+  TIF G  +NG YH+ +   G ++ YRYG    M GETADHWVWGV I  T
Sbjct: 1085 LGQKGQFFSVTIFWGWVLNGFYHSAVVFIGSVLFYRYGNCLNMGGETADHWVWGVGIYTT 1144

Query: 1138 SIIFVLGKAALITNQWTKFTVLAIPGSLVFWLLFFPIYAYLLPGLNVSKEYYGIVSHVYG 1197
            SII VLGKAALIT+QWTKFT++AIPGSLV WLLFFP Y+ + P +NVSKEYYGI+ HVYG
Sbjct: 1145 SIIIVLGKAALITSQWTKFTLVAIPGSLVIWLLFFPFYSAVFPRVNVSKEYYGIIGHVYG 1204

Query: 1198 SFTFWAMCYVXXXXXXXXXXXWKYYKRTYTPESYHVVQEMQKYDISDNRPRIEQFQKAIR 1257
            S TFW MC V           WKYYKRTY+PESYHVVQEMQKY+ISD RPR+EQFQKAIR
Sbjct: 1205 SATFWLMCIVLPVFALLRDFVWKYYKRTYSPESYHVVQEMQKYNISDYRPRMEQFQKAIR 1264

Query: 1258 KVRQVQRMKKQRGFAFSQSEEAGQDRIVRM 1287
            KVRQVQRMKKQRGFAFSQSEE GQDRI+RM
Sbjct: 1265 KVRQVQRMKKQRGFAFSQSEEGGQDRIIRM 1294

>Kwal_26.7070
          Length = 1315

 Score = 1829 bits (4737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 906/1294 (70%), Positives = 1049/1294 (81%), Gaps = 11/1294 (0%)

Query: 1    MSGSRDKHNEETLFDIDFLDDRYTPEPARPVNDSGS-RSGPIIDSGIDDLVQMQRTGFPQ 59
            M  +R K N++TLFDIDFLDD ++P   R  N +       ++DS  D L  ++R   PQ
Sbjct: 1    MCAARRKSNDDTLFDIDFLDDDFSPIGQRNQNSNNPFNEAQVVDSDYDLLEDVRRGHIPQ 60

Query: 60   EVIDLD-DEPPFRHDDSIENDLIENPFDDERGQQRYLASANRLSV----PQP-SGWQRLV 113
            E ++LD         D+IEND+++NPF DER   R  +S++   V    PQ  S +QR +
Sbjct: 61   ETMNLDLHSTTLPEADNIENDIVQNPFSDER---RARSSSHNQGVVHLTPQNGSAFQRAI 117

Query: 114  GGLRDSVGGRGTENSQYQSFEMQDYRDTHSGDRYQRSRNKFNLKALFDHYVLRKPAAADT 173
              ++  +G  G+ NS YQ FEM +Y D  + DRY +SRNKF++K +F  Y+LR+   +D 
Sbjct: 118  NKIKKGLGRSGSGNS-YQGFEMHNYDDLGNDDRYAKSRNKFDIKIIFKRYILRRNDYSDD 176

Query: 174  GAGEPRVIYINERRANGAMGYGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQ 233
                PR IYIN++ AN A G+G NHISTTKYN ATF+PKFLFQEFSKYANLFFLFTS IQ
Sbjct: 177  DKSSPRQIYINDKEANRARGFGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQ 236

Query: 234  QVPNVTPTNRFXXXXXXXXXXXXSAIKESVEDLKRSNSDKELNHSRADVYSDEMGQFISK 293
            QVPNVTPTNR+            SAIKE VEDLKR+ SD ELN SRA V+S+++  F   
Sbjct: 237  QVPNVTPTNRYTTIGTLLIVLIVSAIKEIVEDLKRAQSDSELNDSRAQVFSEQLQDFTLS 296

Query: 294  KWIDIAVGDIIRVRSEEAIPADLIVLSSSEPEGLCYIETANLDGETNLKIKQARPETSKI 353
            KW++I+VGDII+V SEEAIPAD+IV++SSEPEGLCYIETANLDGETNLKIKQAR ETSK 
Sbjct: 297  KWVNISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSKF 356

Query: 354  LDVRELSAMRGKILSEQPNTSLYTYEGTMILHNNRIPLSPDQILLRGATLRNTVWIFGIV 413
            +D  +L+ MRGK+LSE PN+SLYTYEGTM L+   I LSP+Q++LRGATLRNT WI+G+V
Sbjct: 357  IDKDDLAGMRGKVLSEHPNSSLYTYEGTMNLNGKNISLSPEQMVLRGATLRNTAWIYGLV 416

Query: 414  IFTGHETKLTRNATATPIKRTAVERVINLQIVALFGVLICLSLISSFGNLIVMYNQKENL 473
            +FTGHETKL RNATATPIKRTAVERVIN+QIVALFGVLI L+LISS GN+I + +  E+L
Sbjct: 417  VFTGHETKLMRNATATPIKRTAVERVINMQIVALFGVLIVLALISSIGNVIKVTSDAEHL 476

Query: 474  SYLYLQGTNMVALFFKNILTFWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESN 533
            +YLYLQGTN V LFFK+ILT+WILFSNLVPISLFVTVEMIKYYQAYMIASDLDL+ E S+
Sbjct: 477  TYLYLQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLYDEASD 536

Query: 534  MPTVVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKSCSIAGRCYIQSIPEDKDAAFDEG 593
             PTVVRTSSLVEELGQIEYIFSDKTGTLT+NVMEFKSCSIAG+CYI++IPEDK A  ++G
Sbjct: 537  SPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPEDKAATTEDG 596

Query: 594  IEVGYRTYDDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPDEGA 653
            IE+G+R +D M E L+     D  II++FLTLL+ CHTVIPEFQE+GSIKYQAASPDEGA
Sbjct: 597  IEIGFRKFDSMKETLNDTQDPDSHIINDFLTLLATCHTVIPEFQEDGSIKYQAASPDEGA 656

Query: 654  LVQGAADLGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPDNSIR 713
            LV+GAA LGYKFIIRKPNSV++L ED+ +E  Y+LLNICEFNSTRKRMSAIFR P+  I+
Sbjct: 657  LVEGAASLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIFRLPNGEIK 716

Query: 714  LLCKGADTVILERLAATSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYD 773
            L CKGADTVILERL A  NPY+ ATLRHLEDYAAEGLRTLC+ASRT+ ESEY EW  +YD
Sbjct: 717  LFCKGADTVILERLKAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYD 776

Query: 774  AAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGD 833
            AA+TT+ +R+++LD  AE+IEK L LLGATAIEDKLQDGVPETIHTLQ AGIKVWVLTGD
Sbjct: 777  AASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGD 836

Query: 834  RQETAINIGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVI 893
            RQETA+NIGMSC+LLSEDMNLLI+NE+ KE+TR NL +KL+AI+DHQISQQDMN+LALVI
Sbjct: 837  RQETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQQDMNSLALVI 896

Query: 894  DGKSLGFALEPDLEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGAN 953
            DGKSLGFALE DLE++LLAIGK+C+AVICCRVSPLQKALVVKMVKR+T SLLLAIGDGAN
Sbjct: 897  DGKSLGFALEADLEDYLLAIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGAN 956

Query: 954  DVSMIQAAHVGVGISGMEGMQAARSADFALGQFKYLKKLLLVHGSWSYQRISQAILYSFY 1013
            DVSMIQAAHVGVGISGMEGMQAARSADFA+ QFKYLKKLLLVHGSWSYQRISQAILYSFY
Sbjct: 957  DVSMIQAAHVGVGISGMEGMQAARSADFAIAQFKYLKKLLLVHGSWSYQRISQAILYSFY 1016

Query: 1014 KNIALYMTQFWYVLYNAFSGQSIMESWTLTFYNWGGTAAPPGPPKRRDQFERSGLLNRDA 1073
            KNIALYMTQFWYV  NA+SGQSIMESWT+TFYN   T  PP      DQF  S LL+R  
Sbjct: 1017 KNIALYMTQFWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGVFDQFVSSRLLDRYP 1076

Query: 1074 QSCTVGQKGQFWPATIFRGSAINGNYHNWITIDGWIMDYRYGAAGAMHGETADHWVWGVA 1133
            Q   +GQ+GQF+   IF G  ING YH+ +T  G  + YR G     HGETADHW WGV+
Sbjct: 1077 QLYKLGQRGQFFSVRIFWGWVINGFYHSAVTFIGSTLFYRNGNVLNSHGETADHWAWGVS 1136

Query: 1134 IQPTSIIFVLGKAALITNQWTKFTVLAIPGSLVFWLLFFPIYAYLLPGLNVSKEYYGIVS 1193
            I   S+I V+GKAAL+TNQWTKFT  AIPGSLVFWL+FFPIYA +LP  NVSKEYYG+VS
Sbjct: 1137 IYTCSVIIVIGKAALVTNQWTKFTAFAIPGSLVFWLVFFPIYASILPHANVSKEYYGVVS 1196

Query: 1194 HVYGSFTFWAMCYVXXXXXXXXXXXWKYYKRTYTPESYHVVQEMQKYDISDNRPRIEQFQ 1253
            HVYGS TFW MC V           WKYYKRTYTPESYHVVQEMQKY+I D RPRIEQFQ
Sbjct: 1197 HVYGSATFWLMCIVLPTFALMRDLVWKYYKRTYTPESYHVVQEMQKYNIGDYRPRIEQFQ 1256

Query: 1254 KAIRKVRQVQRMKKQRGFAFSQSEEAGQDRIVRM 1287
            KAIR+VRQVQRMKKQRGFAFSQSE  GQD+++RM
Sbjct: 1257 KAIRRVRQVQRMKKQRGFAFSQSETGGQDKVMRM 1290

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
            Ca-ATPase (P-type) required for ribosome assembly and
            involved in late Golgi function, member of the cation
            transporting (E1-E2) P-type ATPase superfamily [4068 bp,
            1355 aa]
          Length = 1355

 Score = 1746 bits (4523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 860/1297 (66%), Positives = 1012/1297 (78%), Gaps = 30/1297 (2%)

Query: 5    RDKHNEETLFDIDFLDDRYTPEPARPVNDSGSRSGPIIDSGIDDLVQMQRTGFPQEVIDL 64
            R    ++TLFDIDFLDD          + SGSRS  + +S  +          P+E IDL
Sbjct: 11   RKPGEDDTLFDIDFLDD--------TTSHSGSRS-KVTNSHANGYYIPPSHVLPEETIDL 61

Query: 65   DDEPPFRHDDSIENDLIENPFDDERGQQRYLASANRL-----------SVPQPSGWQRLV 113
            D +     DD+IEND+ EN F       +   +ANR            +V  P  + R  
Sbjct: 62   DAD-----DDNIENDVHENLFMSNNHDDQTSWNANRFDSDAYQPQSLRAVKPPGLFARFG 116

Query: 114  GGLRDSVGGRGTENSQYQSFEMQDYR---DTHSGDRYQRSRNKFNLKALFDHYVLRKPAA 170
             GL+++   +  +  +  SFEM  Y    +    D Y  SRNKFN+K LF+ Y+LRK   
Sbjct: 117  NGLKNAFTFKRKKGPE--SFEMNHYNAVTNNELDDNYLDSRNKFNIKILFNRYILRKNVG 174

Query: 171  ADTGAGEPRVIYINERRANGAMGYGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTS 230
               G GEPRVI+IN+  AN + GY DNHISTTKYN ATFLPKFLFQEFSKYANLFFL TS
Sbjct: 175  DAEGNGEPRVIHINDSLANSSFGYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTS 234

Query: 231  IIQQVPNVTPTNRFXXXXXXXXXXXXSAIKESVEDLKRSNSDKELNHSRADVYSDEMGQF 290
             IQQVP+V+PTNR+            SA+KE +ED+KR+NSDKELN+S A+++S+    F
Sbjct: 235  AIQQVPHVSPTNRYTTIGTLLVVLIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDF 294

Query: 291  ISKKWIDIAVGDIIRVRSEEAIPADLIVLSSSEPEGLCYIETANLDGETNLKIKQARPET 350
            + K+WIDI VGDIIRV+SEE IPAD I+LSSSEPEGLCYIETANLDGETNLKIKQ+R ET
Sbjct: 295  VEKRWIDIRVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVET 354

Query: 351  SKILDVRELSAMRGKILSEQPNTSLYTYEGTMILHNNRIPLSPDQILLRGATLRNTVWIF 410
            +K +DV+ L  M GK++SEQPN+SLYTYEGTM L++ +IPLSPDQ++LRGATLRNT WIF
Sbjct: 355  AKFIDVKTLKNMNGKVVSEQPNSSLYTYEGTMTLNDRQIPLSPDQMILRGATLRNTAWIF 414

Query: 411  GIVIFTGHETKLTRNATATPIKRTAVERVINLQIVALFGVLICLSLISSFGNLIVMYNQK 470
            G+VIFTGHETKL RNATATPIKRTAVE++IN QI+ LF VLI L LISS GN+I+     
Sbjct: 415  GLVIFTGHETKLLRNATATPIKRTAVEKIINRQIIRLFTVLIVLILISSIGNVIMSTADA 474

Query: 471  ENLSYLYLQGTNMVALFFKNILTFWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHE 530
            ++LSYLYL+GTN   LFFK+ LTFWILFSNLVPISLFVTVE+IKYYQA+MI SDLDL++E
Sbjct: 475  KHLSYLYLEGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYE 534

Query: 531  ESNMPTVVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKSCSIAGRCYIQSIPEDKDAAF 590
            +++ PTVVRTSSLVEELGQIEYIFSDKTGTLT+N+MEFKSCSIAG CYI  IPEDK A  
Sbjct: 535  KTDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATV 594

Query: 591  DEGIEVGYRTYDDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPD 650
            ++GIEVGYR +DD+ + L+ P   D  II++FLTLL+ CHTVIPEFQ +GSIKYQAASPD
Sbjct: 595  EDGIEVGYRKFDDLKKKLNDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQAASPD 654

Query: 651  EGALVQGAADLGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPDN 710
            EGALVQG ADLGYKFIIRK NSVT+L E+  EE  Y+LLNICEFNSTRKRMSAIFRFPD 
Sbjct: 655  EGALVQGGADLGYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFPDG 714

Query: 711  SIRLLCKGADTVILERLAATSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSK 770
            SI+L CKGADTVILERL   +N YV AT+RHLEDYA+EGLRTLC+A R I E EYEEW+ 
Sbjct: 715  SIKLFCKGADTVILERLDDEANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNS 774

Query: 771  LYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVL 830
            +Y+ AATT+ NR+E+LD+ A +IEK L+L+GATAIEDKLQDGVPETIHTLQ+AGIK+WVL
Sbjct: 775  IYNEAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVL 834

Query: 831  TGDRQETAINIGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLA 890
            TGDRQETAINIGMSC+LLSEDMNLLI+NE+T++ T  NL++K+ A+N+HQ+S  DM +LA
Sbjct: 835  TGDRQETAINIGMSCRLLSEDMNLLIINEETRDDTERNLLEKINALNEHQLSTHDMKSLA 894

Query: 891  LVIDGKSLGFALEPDLEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGD 950
            LVIDGKSLGFALEP+LE++LL + K+C+AVICCRVSPLQKALVVKMVKR++ SLLLAI  
Sbjct: 895  LVIDGKSLGFALEPELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKSSSLLLAIAS 954

Query: 951  GANDVSMIQAAHVGVGISGMEGMQAARSADFALGQFKYLKKLLLVHGSWSYQRISQAILY 1010
            GANDVSMIQAAHVGVGISGMEGMQAARSAD ALGQFK+LKKLLLVHGSWSYQRIS AILY
Sbjct: 955  GANDVSMIQAAHVGVGISGMEGMQAARSADIALGQFKFLKKLLLVHGSWSYQRISVAILY 1014

Query: 1011 SFYKNIALYMTQFWYVLYNAFSGQSIMESWTLTFYNWGGTAAPPGPPKRRDQFERSGLLN 1070
            SFYKN ALYMTQFWYV  NAFSGQSIMESWT++FYN   T  PP      DQF  S LL 
Sbjct: 1015 SFYKNTALYMTQFWYVFANAFSGQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLLE 1074

Query: 1071 RDAQSCTVGQKGQFWPATIFRGSAINGNYHNWITIDGWIMDYRYGAAGAMHGETADHWVW 1130
            R  Q   +GQKGQF+   IF G  ING +H+ I   G I+ YRYG A  MHGE ADHW W
Sbjct: 1075 RYPQLYKLGQKGQFFSVYIFWGWIINGFFHSAIVFIGTILIYRYGFALNMHGELADHWSW 1134

Query: 1131 GVAIQPTSIIFVLGKAALITNQWTKFTVLAIPGSLVFWLLFFPIYAYLLPGLNVSKEYYG 1190
            GV +  TS+I VLGKAAL+TNQWTKFT++AIPGSL+FWL+FFPIYA + P  N+S+EYYG
Sbjct: 1135 GVTVYTTSVIIVLGKAALVTNQWTKFTLIAIPGSLLFWLIFFPIYASIFPHANISREYYG 1194

Query: 1191 IVSHVYGSFTFWAMCYVXXXXXXXXXXXWKYYKRTYTPESYHVVQEMQKYDISDNRPRIE 1250
            +V H YGS  FW    V           WKYYKR Y PE+YHV+QEMQKY+ISD+RP ++
Sbjct: 1195 VVKHTYGSGVFWLTLIVLPIFALVRDFLWKYYKRMYEPETYHVIQEMQKYNISDSRPHVQ 1254

Query: 1251 QFQKAIRKVRQVQRMKKQRGFAFSQSEEAGQDRIVRM 1287
            QFQ AIRKVRQVQRMKKQRGFAFSQ+EE GQ++IVRM
Sbjct: 1255 QFQNAIRKVRQVQRMKKQRGFAFSQAEEGGQEKIVRM 1291

>CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharomyces
            cerevisiae YAL026c DRS2, start by similarity
          Length = 1328

 Score = 1723 bits (4462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 856/1287 (66%), Positives = 1013/1287 (78%), Gaps = 40/1287 (3%)

Query: 11   ETLFDIDFLDDRYTPEPARPVNDSGSRSGPIIDSGIDDLVQMQRTGFPQEVIDLDDEPPF 70
            +TLFDIDF D                  G  I +  ++  +    GFP+E+IDLD+    
Sbjct: 15   DTLFDIDFND------------------GNKIRASENE--RTTSHGFPEEIIDLDN---- 50

Query: 71   RHDDSIENDLIENPFDDERGQ-----QRYLASANRLSVPQPSGWQRLVGGLRDSVGGRGT 125
               DSIENDL +NPF +  G+      R+    N+  + Q      +   +  S+ G  T
Sbjct: 51   ---DSIENDLHDNPFSEYGGEGDWNTNRFDRINNQPHLTQIGNKGNVFTRMGRSIKGIFT 107

Query: 126  --ENSQYQSFEMQDYRDTHSG---DRYQRSRNKFNLKALFDHYVLRKPAAADTGAGEPRV 180
               NS+ QSFEM +Y    +G   D +Q+SRNKF++K LF+ Y+LRK  +    +GEPR 
Sbjct: 108  FQSNSEPQSFEMSNYNTVSTGEMDDNFQKSRNKFDIKILFNKYLLRKNTSDGQDSGEPRE 167

Query: 181  IYINERRANGAMGYGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTP 240
            I+I++R +N   GY DNHISTTKYNAATFLPKFLFQEFSKYANLFFL TS IQQVP+V+P
Sbjct: 168  IHISDRESNNRFGYIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSP 227

Query: 241  TNRFXXXXXXXXXXXXSAIKESVEDLKRSNSDKELNHSRADVYSDEMGQFISKKWIDIAV 300
            TNR+            SAIKESVEDLKR++SD ELN+S+A++Y +  G FI K+WIDI V
Sbjct: 228  TNRYTTIGTLMVVLIVSAIKESVEDLKRASSDNELNNSKAEIYFEAEGDFIQKRWIDIKV 287

Query: 301  GDIIRVRSEEAIPADLIVLSSSEPEGLCYIETANLDGETNLKIKQARPETSKILDVRELS 360
            GDIIRV SEE IPAD+I+LSSSEPEGLCYIETANLDGETNLKIKQAR ET+KI+D REL 
Sbjct: 288  GDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDSRELR 347

Query: 361  AMRGKILSEQPNTSLYTYEGTMILHNNRIPLSPDQILLRGATLRNTVWIFGIVIFTGHET 420
             ++G I SEQPN+SLYTYEGT+ ++  +IPLSP+Q++LRGATLRNT WIFGIVIFTGHET
Sbjct: 348  NIKGVISSEQPNSSLYTYEGTLEMNGTKIPLSPEQMILRGATLRNTGWIFGIVIFTGHET 407

Query: 421  KLTRNATATPIKRTAVERVINLQIVALFGVLICLSLISSFGNLIVMYNQKENLSYLYLQG 480
            KL RNATATPIKRTAVE+VIN+QI+ALF VL+ L LISS GN+I+     ++LSYLYLQG
Sbjct: 408  KLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNVIMSTADAKHLSYLYLQG 467

Query: 481  TNMVALFFKNILTFWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRT 540
            TN   LFFK+ LTFWILFSNLVPISLFVTVE+IKYYQA+MI SDLDL++EE++ PTVV+T
Sbjct: 468  TNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEETDTPTVVKT 527

Query: 541  SSLVEELGQIEYIFSDKTGTLTQNVMEFKSCSIAGRCYIQSIPEDKDAAFDEGIEVGYRT 600
            SSLVEELGQIEYIFSDKTGTLT+N+MEFKSCSIAGRCY + IPEDK A F++GIEVGYR+
Sbjct: 528  SSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAEHIPEDKAATFEDGIEVGYRS 587

Query: 601  YDDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPDEGALVQGAAD 660
            +DD+ + L T  S D  IIDEFLTLL+ CHTVIPEFQ +GSIKYQAASPDEGALV+G A 
Sbjct: 588  FDDLKKQL-TTNSDDCKIIDEFLTLLATCHTVIPEFQADGSIKYQAASPDEGALVEGGAL 646

Query: 661  LGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPDNSIRLLCKGAD 720
            LGYKF+IRKPNSVTIL  +  EE  Y+LLNICEFNSTRKRMSAIFRFPD+SI+LLCKGAD
Sbjct: 647  LGYKFLIRKPNSVTILINE-EEEREYQLLNICEFNSTRKRMSAIFRFPDDSIKLLCKGAD 705

Query: 721  TVILERLAATSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATTMH 780
            +VILERL+ T N YV AT RHLEDYA EGLRTLC+A++ IPE EY  W+K Y  AATT+ 
Sbjct: 706  SVILERLSETGNFYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLD 765

Query: 781  NRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAIN 840
            +R+E+LD VAE IE GL L+GATAIEDKLQ+GVP+TI TLQ+AGIK+WVLTGD+QETAIN
Sbjct: 766  HRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAIN 825

Query: 841  IGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLGF 900
            IGMSC+LLSEDMNLLI++E+TKE+TR N+ +KL A+++H +S+ DMNTLALVIDG SL F
Sbjct: 826  IGMSCRLLSEDMNLLIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSF 885

Query: 901  ALEPDLEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQA 960
            ALE DLE++ LAIGKMC+AVICCRVSPLQKALVVKMVKR+T SLLLAIGDGANDVSMIQA
Sbjct: 886  ALEADLEDYFLAIGKMCKAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQA 945

Query: 961  AHVGVGISGMEGMQAARSADFALGQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYM 1020
            AHVGVGISGMEGMQAARSAD ++GQF++LKKLLLVHG+WSYQRIS AILYSFYKN ALYM
Sbjct: 946  AHVGVGISGMEGMQAARSADISVGQFRFLKKLLLVHGAWSYQRISVAILYSFYKNTALYM 1005

Query: 1021 TQFWYVLYNAFSGQSIMESWTLTFYNWGGTAAPPGPPKRRDQFERSGLLNRDAQSCTVGQ 1080
            TQFWYV  NAFSGQSIMESWT++ YN   T  PP      DQF  S LL R  Q   +GQ
Sbjct: 1006 TQFWYVFANAFSGQSIMESWTMSLYNVFFTVLPPFVIGVFDQFVNSRLLERYPQLYKLGQ 1065

Query: 1081 KGQFWPATIFRGSAINGNYHNWITIDGWIMDYRYGAAGAMHGETADHWVWGVAIQPTSII 1140
            KGQF+  +IF G  +NG YH+ +   G I+ YRYG A   HGETADHW WG+AI  +S+I
Sbjct: 1066 KGQFFSVSIFWGWIVNGFYHSAVVFVGTILFYRYGFALRKHGETADHWSWGIAIYTSSVI 1125

Query: 1141 FVLGKAALITNQWTKFTVLAIPGSLVFWLLFFPIYAYLLPGLNVSKEYYGIVSHVYGSFT 1200
             VLGKAAL+TNQWTKFT+ AIPGSL FWL+FFPIY  + P   +S+EY+G+V H YGS T
Sbjct: 1126 IVLGKAALVTNQWTKFTLFAIPGSLFFWLIFFPIYGSIFPYAKISREYFGVVEHTYGSAT 1185

Query: 1201 FWAMCYVXXXXXXXXXXXWKYYKRTYTPESYHVVQEMQKYDISDNRPRIEQFQKAIRKVR 1260
            FW    V           WKYYKR Y PESYH++QEMQKY++SD RP ++ FQ AIRKVR
Sbjct: 1186 FWLTLIVLPTFALTRDFIWKYYKRMYAPESYHLIQEMQKYNVSDYRPHVQHFQNAIRKVR 1245

Query: 1261 QVQRMKKQRGFAFSQSEEAGQDRIVRM 1287
            QVQRMKKQRGFAFSQ+EE GQ++I+RM
Sbjct: 1246 QVQRMKKQRGFAFSQAEE-GQEKIIRM 1271

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/1058 (37%), Positives = 586/1058 (55%), Gaps = 105/1058 (9%)

Query: 289  QFISKKWIDIAVGDIIRVRSEEAIPADLIVLSSSEPEGLCYIETANLDGETNLKIKQARP 348
            +F    W  + VGDI+R+ + + IPAD+I+LS+S+ +G CY+ET NLDGETNLK++Q+  
Sbjct: 392  KFAKNYWKGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLK 451

Query: 349  ETSKILDVRELSAMRGKILSEQPNTSLYTYEGTMILHN------NRIPLSPDQILLRGAT 402
             T+ I   ++++  +  I SE P+++LYTY+G M   N         P++ + +LLRG T
Sbjct: 452  CTNTIRTSKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCT 511

Query: 403  LRNTVWIFGIVIFTGHETKLTRNATATPIKRTAVERVINLQIVALFGVLICLSLISSFGN 462
            LRNT W  G+V+FTG +TK+  N+  TP K++ + R +N  +V  F +L  L  +S   N
Sbjct: 512  LRNTKWAMGVVMFTGGDTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIAN 571

Query: 463  LIVMYNQKENLSYLYLQGTNMVALFFKNILTFW---ILFSNLVPISLFVTVEMIKYYQAY 519
              V Y++K    + Y  GT   +      ++FW   IL+ +LVPISL+++VE+IK  QA 
Sbjct: 572  G-VYYDKKGRSRFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAA 630

Query: 520  MIASDLDLFHEESNMPTVVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKSCSIAG---- 575
             I  D+ L++ + + P   ++ ++ ++LGQ+EYIFSDKTGTLTQNVMEFK C+I G    
Sbjct: 631  FIYGDVLLYNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYG 690

Query: 576  RCYIQS----------------------IPEDKDAAFDE-----------GIEVGYRTYD 602
            R Y ++                      I +D+D   DE             EV + + +
Sbjct: 691  RAYTEALAGLRKRQGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKE 750

Query: 603  DMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKY--QAASPDEGALVQGAAD 660
             + +L    G       + F+  L++CH+V+ E   +   K   +A SPDE ALV  A D
Sbjct: 751  FVRDLKGASGEVQQRCCEHFMLALALCHSVLVEANPDNPKKLDLKAQSPDEAALVATARD 810

Query: 661  LGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFP------DNSIRL 714
            +G+ F+ +    + I  + I +E  +E+LNI EFNS+RKRMS I + P      +    L
Sbjct: 811  VGFSFVGKTKKGLIIEMQGIQKE--FEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALL 868

Query: 715  LCKGADTVILERLAATSNPYVAATLR----HLEDYAAEGLRTLCIASRTIPESEYEEWSK 770
            +CKGAD++I  RL+  S     A L     HLE YA EGLRTLCIA R +  SEYE+W++
Sbjct: 869  ICKGADSIIYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNE 928

Query: 771  LYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVL 830
             YD AA ++ NR +EL+ VA+ IE+ L+LLG TAIED+LQDGVP+ I  L +AGIK+WVL
Sbjct: 929  KYDIAAASLANREDELEVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVL 988

Query: 831  TGDRQETAINIGMSCKLLSEDMNLLIVN---EDTKE--STRNNLIDKL------------ 873
            TGD+ ETAINIG SC LL+ +M LL++    +D KE  S  + ++D L            
Sbjct: 989  TGDKVETAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLT 1048

Query: 874  -------RAINDHQISQQDMNTLALVIDGKSLGFAL-EPDLEEFLLAIGKMCRAVICCRV 925
                    A  DH+  + +    A+VIDG +L  AL   D+    L + K CRAV+CCRV
Sbjct: 1049 GSEEEIFEAKKDHEFPKGNY---AIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRV 1105

Query: 926  SPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFALGQ 985
            SP QKA VVK+VK     + LAIGDG+NDV+MIQ+A VG+GI+G EG QA   +D+A+GQ
Sbjct: 1106 SPSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQ 1165

Query: 986  FKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVLYNAFSGQSIMESWTLTFY 1045
            F+YL +L+LVHG WSY+R+++ I   FYKN+   +  FWY +YN F G  + E   + FY
Sbjct: 1166 FRYLARLVLVHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFY 1225

Query: 1046 NWGGTAAPPGPPKRRDQFERSGLLNRDAQSCTVGQKGQFWPATIFRGSAINGNYHNWITI 1105
            N   T+ P       DQ     +     Q   VG   + W    F    ++G Y + I  
Sbjct: 1226 NLAFTSLPVIFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSIICF 1285

Query: 1106 DGWIMDYRYGAAGAMHGETADH-WVWGVAIQPTSIIFVLGKAALITNQWTKFTVLAIPGS 1164
                + Y        +G   DH +  GV +   ++I       L   +W  F+ L I  S
Sbjct: 1286 FFPYLVYHKNMIVTSNGLGLDHRYFVGVYVTTIAVISCNTYVLLHQYRWDWFSGLFIALS 1345

Query: 1165 LVFWLLFFPIYAYLLPGLNVSKEYYGIVSHVYGSFTFWAMCYVXXXXXXXXXXXWKYYKR 1224
             +    +  I++  +     S+E++   + +YG+ +FWA+ +V           +  +++
Sbjct: 1346 CLVVFAWTGIWSSAI----ASREFFKAAARIYGAPSFWAVFFVAVLFCLLPRFTYDSFQK 1401

Query: 1225 TYTPESYHVVQEMQK----------YDISD-NRPRIEQ 1251
             + P    +V+EM +          YD +D NRP++ +
Sbjct: 1402 FFYPTDVEIVREMWQHGHFDHYPPGYDPTDPNRPKVTK 1439

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 55/116 (47%), Gaps = 8/116 (6%)

Query: 175 AGEPRVIYIN--------ERRANGAMGYGDNHISTTKYNAATFLPKFLFQEFSKYANLFF 226
           A E R +Y N        +   N  M Y  N I TTKY   TFLPK +  +F  +AN++F
Sbjct: 164 AQELRTVYYNMPLPKDMIDEEGNPIMQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYF 223

Query: 227 LFTSIIQQVPNVTPTNRFXXXXXXXXXXXXSAIKESVEDLKRSNSDKELNHSRADV 282
           L   I+        TN              +AIK+++ED +R+  D E+N+++  +
Sbjct: 224 LVLIILGAFQIFGVTNPGLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHI 279

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score =  643 bits (1658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/1096 (36%), Positives = 611/1096 (55%), Gaps = 103/1096 (9%)

Query: 268  RSNSDKELNHSRADVYSDEMGQFISKKWIDIAVGDIIRVRSEEAIPADLIVLSSSEPEGL 327
            + N D  +N +   + +D   +F    W ++ VGDI+R+ + E IPAD+I+LS+S+ +G 
Sbjct: 381  QQNEDTLINKT---LPTDMEWRFSKDYWKNVKVGDIVRIHNNEEIPADIILLSTSDSDGA 437

Query: 328  CYIETANLDGETNLKIKQARPETSKILDVRELSAMRGKILSEQPNTSLYTYEGTM---IL 384
            CY+ET NLDGETNLK++Q+   TS I    +++  R  I SE P+ +LY+Y+G      L
Sbjct: 438  CYVETKNLDGETNLKVRQSMKCTSDIRSSIDIARTRFWIESEGPHANLYSYQGNFRWNSL 497

Query: 385  HNNRI---PLSPDQILLRGATLRNTVWIFGIVIFTGHETKLTRNATATPIKRTAVERVIN 441
             +N++   P++ + +LLRG TLRNT W  G+V FTG +TK+  NA  TP K++ + + +N
Sbjct: 498  EDNQLKNEPVNINNLLLRGCTLRNTKWAMGVVAFTGDDTKIMLNAGVTPTKKSRISKELN 557

Query: 442  LQIVALFGVLICLSLISSFGNLIVMYNQKENLSYLYLQ-GTNMVALFFKNILTFW---IL 497
            L ++  F +L  L  I+   N I  Y+ K   S  +   GT          ++FW   IL
Sbjct: 558  LSVLFNFALLFVLCFIAGLYNGI--YHNKHPRSRDFFDFGTGTGGSATSGFVSFWVAVIL 615

Query: 498  FSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLVEELGQIEYIFSDK 557
            + +LVPISL+++VE+IK  QA  I  D+ +++E+ + P   ++ ++ ++LGQIEYIFSDK
Sbjct: 616  YQSLVPISLYISVEIIKTAQAIFIYLDVMMYNEKLDYPCTPKSWNISDDLGQIEYIFSDK 675

Query: 558  TGTLTQNVMEFKSCSIAG----RCYIQSIP-----EDKDAAFD-----EGI--------- 594
            TGTLTQNVMEFK C+I G    R Y +++      +  D A +     EGI         
Sbjct: 676  TGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGVDVAHESKIEKEGIKRDREEMIN 735

Query: 595  --------------EVGYRTYDDMHELLHTPGSGDGAIIDEFLTLLSICHTVI--PEFQE 638
                          EV + + + + +L    GS        F+  L++CH+V+  P  ++
Sbjct: 736  KLQNLAKNSQFYEDEVTFVSKEFVDDLTGGSGSVQQKSCQHFMLALALCHSVLTEPSKED 795

Query: 639  NGSIKYQAASPDEGALVQGAADLGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTR 698
               ++ +A SPDE ALV  A D+G+ F+ +    + +  + I +E  +++LNI EFNS+R
Sbjct: 796  PAKLEIKAQSPDEAALVTTARDMGFSFLKKTKEGMVLEVQGIEKE--FQILNILEFNSSR 853

Query: 699  KRMSAIFRFPDNSIR------LLCKGADTVILERLAATS---NPYVAATLRHLEDYAAEG 749
            KRMS I + P +         L+CKGAD+VI  RL  T       +  T  HLE YA EG
Sbjct: 854  KRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLDKTGLNEESLLEKTALHLEQYATEG 913

Query: 750  LRTLCIASRTIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKL 809
            LRTLC+A R +   EYE W+K YD AA  + +R EEL+KV++ IE+ L+LLG TAIED+L
Sbjct: 914  LRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKVSDEIERHLILLGGTAIEDRL 973

Query: 810  QDGVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLLIVNEDTKE-----S 864
            QDGVP++I  L +AGIK+WVLTGD+ ETAINIG SC LL+ DM LL++     +     +
Sbjct: 974  QDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELLVIKTTGPDVEDLGA 1033

Query: 865  TRNNLIDKL-------------------RAINDHQISQQDMNTLALVIDGKSLGFALEP- 904
            T  +++D L                   +A  +H I + +    A++IDG++L +AL   
Sbjct: 1034 TPKDIVDTLISQYLHDKFGMAGSEEELKKAKAEHDIPRGE---FAVIIDGEALKYALSTE 1090

Query: 905  DLEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVG 964
            D++   L + K C++V+CCRVSP QKA VVK+VK     + LAIGDG+NDV+MIQ+A++G
Sbjct: 1091 DMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSANIG 1150

Query: 965  VGISGMEGMQAARSADFALGQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFW 1024
            VGI+G EG QA  S+D+A+GQF+YL +LLLVHG W Y+R+++ I   FYKN+   +  FW
Sbjct: 1151 VGIAGEEGRQAVMSSDYAIGQFRYLTRLLLVHGKWCYKRLAEMIPQFFYKNMIFTLALFW 1210

Query: 1025 YVLYNAFSGQSIMESWTLTFYNWGGTAAPPGPPKRRDQFERSGLLNRDAQSCTVGQKGQF 1084
            + +YN + G  + E   LTFYN   T+ P       DQ     +     Q   VG   + 
Sbjct: 1211 FGIYNDYDGSYLFEYTYLTFYNLAFTSIPVILLGIFDQDVSDTISLVFPQLYRVGILRKE 1270

Query: 1085 WPATIFRGSAINGNYHNWITIDGWIMDYRYGAAGAMHGETADHWVWGVAIQPTSIIFVLG 1144
            W  T F    ++G Y + I      + YR       +G   DH  + V +  T+I  +  
Sbjct: 1271 WSQTKFLWYMLDGLYQSVIAFFFPYLLYRRHMIVTSNGLGLDHRYY-VGVPVTAIACISC 1329

Query: 1145 KAALITNQ--WTKFTVLAIPGSLVFWLLFFPIYAYLLPGLNVSKEYYGIVSHVYGSFTFW 1202
               ++  Q  W  F    +  S++ +  +  I++      + S E+Y   + V+G+ TFW
Sbjct: 1330 NLYILIQQKHWDVFCSFFVGVSIMIFFTWTGIWS----SASRSNEFYHGAARVFGTPTFW 1385

Query: 1203 AMCYVXXXXXXXXXXXWKYYKRTYTPESYHVVQEMQKYDISDNRPRIEQFQKAIRKVRQV 1262
            A+ +V              +KR + P+   +++EM      D+ P+  ++     +V ++
Sbjct: 1386 AVLFVGIMFCLLPRFTLDVFKRYFYPKDIDIIREMWSRGDFDSFPK--KYDPTDPEVHKI 1443

Query: 1263 QRMKKQRGFAFSQSEE 1278
              M   R F+ ++S+E
Sbjct: 1444 A-MSDIRVFSGAESKE 1458

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 73/290 (25%), Positives = 112/290 (38%), Gaps = 37/290 (12%)

Query: 27  PARPVNDSGSRSGPIIDSGIDDLVQMQRTGF-PQE---------VIDLDDEPPFRHDDSI 76
           P+R   + G      I S  DD  + Q     P E         V D   + P++ +D +
Sbjct: 2   PSRSPFEDGVGGKEPISSPFDDSNRFQDVEMVPMEEDVKDTNTTVYDEFGDGPYKEEDDM 61

Query: 77  ENDLIENPFD-DERGQQRYLASANRLSVPQPSGWQRLV--GGLRDSVGGRGTENSQYQSF 133
           ++D    P     R         NR+ +  P   +R    G  R+S  G      Q +  
Sbjct: 62  DDDYSMEPTPIVGRSDNGQFNDDNRVLMFGPDDLERRAQPGKNRESKSG-----DQIKRL 116

Query: 134 EMQDYRDTHSGDRYQRSRNKF------NLKALFDHYVLRKPAAAD-TG----AGEPRVIY 182
                R   S  RY   R+K       N++   +  +  +  A D TG    A E R IY
Sbjct: 117 RWGTQRRRKSFKRYDIGRSKTLKWAKKNIQDPLEELIGNENEATDETGMRNKADELRNIY 176

Query: 183 INERRANGAM--------GYGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQ 234
            N+      +         Y  N I TTKY   TFLPK +  +F  +AN++FL   I+  
Sbjct: 177 FNQPLPQDMLDEDNKPLANYPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILIILGA 236

Query: 235 VPNVTPTNRFXXXXXXXXXXXXSAIKESVEDLKRSNSDKELNHSRADVYS 284
                 TN              +AIK+ +ED +R+  D E+N+++  V +
Sbjct: 237 FQIFGVTNPGFSAVPLIVIIIITAIKDGIEDSRRTVLDLEVNNTKTHVLT 286

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/1106 (37%), Positives = 594/1106 (53%), Gaps = 141/1106 (12%)

Query: 289  QFISKKWIDIAVGDIIRVRSEEAIPADLIVLSSSEPEGLCYIETANLDGETNLKIKQARP 348
            +F    W DI VGDI+R+ + + IPAD+I+LS+S+ +G CY+ET NLDGETNLK++Q+  
Sbjct: 399  RFGKSHWKDIRVGDIVRIHNNDEIPADIILLSTSDADGACYVETKNLDGETNLKVRQSLK 458

Query: 349  ETSKILDVRELSAMRGKILSEQPNTSLYTYEG--------TMILHNNRIPLSPDQILLRG 400
             + +I + +++S  +  + SE P+ +LY+Y+G        T ++HN   P++ + +LLRG
Sbjct: 459  CSHRIRNSKDISRCKFWVESEGPHANLYSYQGNFKWVDSETGVMHNE--PVNINNMLLRG 516

Query: 401  ATLRNTVWIFGIVIFTGHETKLTRNATATPIKRTAVERVINLQIVALFGVLICLSLISSF 460
             +LRNT W  GIV+FTG +TK+  NA  TP KR+ + R +N  ++  F  L  L L +  
Sbjct: 517  CSLRNTKWAMGIVMFTGTDTKIMLNAGVTPTKRSRISRELNYSVILNFVFLFVLCLAAGL 576

Query: 461  GNLIVMYNQKENLSYLYLQ-GTNMVALFFKNILTFW---ILFSNLVPISLFVTVEMIKYY 516
             N I  Y +++  S  + + GT     F   IL F+   IL+ +LVPISL++++E+IK  
Sbjct: 577  VNGI--YYRRDATSRTFFEFGTVAGTPFANGILAFFVALILYQSLVPISLYISIEIIKTA 634

Query: 517  QAYMIASDLDLFHEESNMPTVVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKSCSIAG- 575
            QA  I  D+ L++ + + P   RT ++ ++LGQIEYIFSDKTGTLTQNVMEFK C+I G 
Sbjct: 635  QAAFIYGDVLLYNPKLDYPCTPRTWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGV 694

Query: 576  ---RCYIQS----------------------IPEDKDAAFDEGIEVGYRTYDDMH----- 605
               R Y ++                      I EDK    +  +++G  +  D H     
Sbjct: 695  SYGRAYTEALAGLRKRQGVDIEEEGARERAEIEEDKKQMVELLLKLGKNSQLDPHTVTFV 754

Query: 606  --ELLHTPGSGDGA----IIDEFLTLLSICHTVIPEFQENGSIKY--QAASPDEGALVQG 657
              EL+   G  +       ++ F+  L++CH+V+ E  +N   K   +A SPDE ALV+ 
Sbjct: 755  SKELVQDLGGANSQEQKEAVEHFMLSLALCHSVVVEENKNNPEKLDIKAQSPDEAALVET 814

Query: 658  AADLGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFP---DNS--- 711
            A D+G+ F+ R  N V I  + + +E  + +LN+ EFNSTRKRMS I + P   +NS   
Sbjct: 815  ARDMGFSFVGRTKNGVIIEIQGVQKE--FRILNVLEFNSTRKRMSCIVKIPAADENSKPK 872

Query: 712  IRLLCKGADTVILERLAATSN--PYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWS 769
              LLCKGAD+VI  RL  + N    +  T  HLE +A EGLRTLC+A R I   EY  W+
Sbjct: 873  ALLLCKGADSVIYSRLDRSRNDPKLLERTALHLEQFATEGLRTLCVAQREIDWDEYLNWN 932

Query: 770  KLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWV 829
            +  + AA ++ NR E L++VA+ IE+ LVLLG TAIED+LQDGVP++I  L  AGIK+WV
Sbjct: 933  ERRELAAASLDNREEALERVADAIERQLVLLGGTAIEDRLQDGVPDSISILADAGIKLWV 992

Query: 830  LTGDRQETAINIGMSCKLLSEDMNLLIVN---EDTKESTRNN------LIDKL------- 873
            LTGD+ ETAINIG SC LL  DM LL++    ED +     +      LIDK        
Sbjct: 993  LTGDKVETAINIGFSCNLLGSDMELLVIKSSGEDVEHLGEKDSDVVLALIDKYLETHFNM 1052

Query: 874  --------RAINDHQISQQDMNTLALVIDGKSLGFALE-PDLEEFLLAIGKMCRAVICCR 924
                     A  DH   Q   +   +VIDG +L  AL   D+    L + K C+AV+CCR
Sbjct: 1053 KGSPEELAAARKDHTPPQ---SAFGVVIDGDALKLALHGEDIRRKFLLLCKNCKAVLCCR 1109

Query: 925  VSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFALG 984
            VSP QKA VVK+VK     + LAIGDG+NDV+MIQAA VG+GI+G EG QA  SAD+A+G
Sbjct: 1110 VSPSQKAAVVKLVKESLDVVTLAIGDGSNDVAMIQAADVGIGIAGEEGRQAVMSADYAIG 1169

Query: 985  QFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVLYNAFSGQSIMESWTLTF 1044
            QF+YL +L+LVHG WSY+R+++ I   FYKNI   +  FW+ + + + G  + E   L F
Sbjct: 1170 QFRYLTRLVLVHGRWSYKRLAEMIPQFFYKNITFTLALFWFGICSNYDGSYLFEYTYLMF 1229

Query: 1045 YNWGGTAAPPGPPKRRDQFERSGLLNRDAQSCTVGQKGQFWPATIFRGSAINGNYHNWIT 1104
            YN   T+ P             G++++DA         Q +   I R       +  W  
Sbjct: 1230 YNLAFTSLP---------VIFLGIMDQDASDVLSVVVPQLYKVGILRTEWTQNKFW-WYC 1279

Query: 1105 IDG-----------WIMDYRYGAAGAMHGETADH-WVWGVAIQPTSIIFVLGKAALITNQ 1152
             DG           ++  YR G     +    DH + +GV +  TSI  V     ++ +Q
Sbjct: 1280 FDGVYQSIICFFFPYLCYYRTGLI-TKNAYGLDHRYTFGVFV--TSIAVVSCNLYVLIHQ 1336

Query: 1153 --WTKFTVLAI---PGSLVFWLLFFPIYAYLLPGLNVSKEYYGIVSHVYGSFTFWAMCYV 1207
              W  FT L I    G L FW   +    Y       S E+Y     +Y    FWA+ +V
Sbjct: 1337 YRWDWFTTLFIFLSCGILFFWTGVWSSATY-------SGEFYKTAVRLYAQPVFWAVLFV 1389

Query: 1208 XXXXXXXXXXXWKYYKRTYTPESYHVVQEM----------QKYDISD-NRPRIEQFQKAI 1256
                       W   ++ + P    +V+E           + YD +D NRPRI      +
Sbjct: 1390 GVIFCLLPRFTWDAVQKLFFPRDIDIVRECWWRGDFDMYPEDYDPTDPNRPRINVSHTGV 1449

Query: 1257 RKVRQVQRMKKQRGFAFSQSEEAGQD 1282
             +    +R +       +++    +D
Sbjct: 1450 DRASDDERSRTGSDLGVTRTTVISED 1475

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 52/121 (42%), Gaps = 8/121 (6%)

Query: 170 AADTGAGEPRVIYIN--------ERRANGAMGYGDNHISTTKYNAATFLPKFLFQEFSKY 221
           A  + A E R +Y N               + Y  N I TTKY   +FLPK L  +F   
Sbjct: 171 AGKSRAAEKRAVYFNMPLPPELTGENGRPVVNYPRNKIRTTKYTPLSFLPKNLAYQFKNA 230

Query: 222 ANLFFLFTSIIQQVPNVTPTNRFXXXXXXXXXXXXSAIKESVEDLKRSNSDKELNHSRAD 281
           AN++FL    +  V     TN              + +K++ ED +R+  D E+N+ R+ 
Sbjct: 231 ANIYFLLLVCLSFVSIFGVTNPALAAIPLIAIVVITGLKDAFEDSRRTILDLEVNNMRSH 290

Query: 282 V 282
           +
Sbjct: 291 I 291

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
            cerevisiae YER166w, start by similarity
          Length = 1576

 Score =  638 bits (1645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/1064 (36%), Positives = 584/1064 (54%), Gaps = 120/1064 (11%)

Query: 289  QFISKKWIDIAVGDIIRVRSEEAIPADLIVLSSSEPEGLCYIETANLDGETNLKIKQARP 348
            +F    W  ++VGDI+RV + + IPAD+I+LSSS+ +G CY+ET NLDGETNLK++Q+  
Sbjct: 437  KFAKDYWKSVSVGDIVRVHNNDEIPADIILLSSSDSDGACYVETKNLDGETNLKVRQSLK 496

Query: 349  ETSKILDVRELSAMRGKILSEQPNTSLYTYEGTMI-------LHNNRIPLSPDQILLRGA 401
             +  I + R ++  + K+ SE P+++LY+Y+G +        L  N  P++ + +LLRG 
Sbjct: 497  CSHMIRNSRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNE-PVNINNLLLRGC 555

Query: 402  TLRNTVWIFGIVIFTGHETKLTRNATATPIKRTAVERVINLQIVALFGVLICLSLISSFG 461
            TLRNT W  GIV+FTG +TK+  NA  TP K + + R +NL +   F +L  L   +   
Sbjct: 556  TLRNTKWAMGIVVFTGPDTKIMLNAGVTPTKVSRISRELNLSVFMNFALLFVLCFAAGIV 615

Query: 462  NLIVMYNQKENLSYLYLQGTNMVALFFKN-ILTFW---ILFSNLVPISLFVTVEMIKYYQ 517
            N +  Y + +N S  Y +  ++      N +++FW   IL+ ++VPISL++++E+IK  Q
Sbjct: 616  NGV--YYRTDNTSRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTAQ 673

Query: 518  AYMIASDLDLFHEESNMPTVVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKSCSIAG-- 575
            A  I  D+ L++E  + P   ++ ++ ++LGQIEYIFSDKTGTLTQNVMEFK C+I G  
Sbjct: 674  ALFIYGDVALYNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVS 733

Query: 576  --RCYIQSIP----------EDKDAAFDEGI-----------------------EVGYRT 600
              R Y +++           E++ A   EGI                        V + +
Sbjct: 734  YGRAYTEALAGLRKRQGIDVEEEGALEKEGIAQDKEIMLANLKILGENSQLRPENVTFVS 793

Query: 601  YDDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGS--IKYQAASPDEGALVQGA 658
             + + +     G       + F+  L++CHTV+ E  ++    + ++A SPDE ALV  A
Sbjct: 794  KEFVQDTAGANGETQKKCNENFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVGTA 853

Query: 659  ADLGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPDNSIR----- 713
             D+G+ F+ R  N V +  + + +E  Y LLN+ EFNSTRKRMS I + P  +       
Sbjct: 854  RDMGFSFVGRTKNGVIVDIQGVQKE--YRLLNVLEFNSTRKRMSCILKIPSENPNEEPRA 911

Query: 714  -LLCKGADTVILERLAATSN-PYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKL 771
             L+CKGAD++I  RL+  ++   +  T  HLE YA EGLRTLCIA R +   EY+EW++ 
Sbjct: 912  LLICKGADSIIYSRLSKNNDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEK 971

Query: 772  YDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLT 831
            ++ AA  + +R +E++KVA++IE+ L LLG TAIED+LQDGVP++I TL +AGIK+WVLT
Sbjct: 972  HEIAAAALVDREDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLT 1031

Query: 832  GDRQETAINIGMSCKLLSEDMNLLIVN--------------EDTKESTRNNLIDKLRAIN 877
            GD+ ETAINIG SC LL+ +M LL++               E  K      L +K +   
Sbjct: 1032 GDKVETAINIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSG 1091

Query: 878  DHQ-------ISQQDMNTLALVIDGKSLGFALEPD--LEEFLLAIGKMCRAVICCRVSPL 928
             ++       + +       ++IDG +L  AL  D    EFLL + K C+AV+CCRVSP 
Sbjct: 1092 SYEELEEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLL-LCKRCKAVLCCRVSPA 1150

Query: 929  QKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFALGQFKY 988
            QKA VVK+VK     + LAIGDG+NDV+MIQ+A +GVGI+G EG QA  S+D+A+GQF+Y
Sbjct: 1151 QKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRY 1210

Query: 989  LKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVLYNAFSGQSIMESWTLTFYNWG 1048
            L +L+LVHG WSY+R+++ I   FYKN+   ++ FWY +YN + G  + E   LT +N  
Sbjct: 1211 LTRLVLVHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLA 1270

Query: 1049 GTAAPPGPPKRRDQFERSGLLNRDA---------QSCTVGQKGQFWPATIFRGSAINGNY 1099
             T+ P             G+L++D          Q   VG     W  T F     +  Y
Sbjct: 1271 FTSLP---------VIFLGILDQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMY 1321

Query: 1100 HNWITIDGWIMDYRYGAAGAMHGETADHWVW-GVAIQPTSIIFVLGKAALITNQWTKFTV 1158
             + I      + Y        +G   DH  W GV +   +++       L   +W  F+ 
Sbjct: 1322 QSVICFFLPYLCYYKTGIVTQNGFGLDHRYWVGVFVATIAVVSCNTYVLLHQYRWDWFSS 1381

Query: 1159 LAIPGSLVFWLLFFPIYAYLLPGLNVSKEYYGIVSHVYGSFTFWAMCYVXXXXXXXXXXX 1218
            L I  S +    +  I++        S E+Y   +H+YG   FWA+ +            
Sbjct: 1382 LFIALSCLCIFAWTGIWS----SFTSSGEFYKSAAHIYGQPVFWAIMFAGILFCLLPRFA 1437

Query: 1219 WKYYKRTYTPESYHVVQEMQK----------YDISD-NRPRIEQ 1251
               + RTY P+   +++E  K          YD +D +RP+++ 
Sbjct: 1438 ADTFLRTYMPKDIDIIRECWKRGDFDHYPEGYDPTDPDRPKVKN 1481

 Score = 44.3 bits (103), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 48/110 (43%), Gaps = 8/110 (7%)

Query: 177 EPRVIYIN--------ERRANGAMGYGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLF 228
           E R IY N        +   N  + Y  N I TTKY   TF PK +  +F   AN++FL 
Sbjct: 215 ETRTIYYNLPLPEDILDEDGNSTIYYPRNKIRTTKYTPLTFFPKNIAFQFKNVANVYFLV 274

Query: 229 TSIIQQVPNVTPTNRFXXXXXXXXXXXXSAIKESVEDLKRSNSDKELNHS 278
             I+         N              ++ K+++ED +R+  D E+N++
Sbjct: 275 LIIMGFFQIFGVANPGLATVPLIVIVVLTSFKDAIEDSRRTILDMEVNNA 324

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score =  638 bits (1645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/1061 (37%), Positives = 586/1061 (55%), Gaps = 109/1061 (10%)

Query: 289  QFISKKWIDIAVGDIIRVRSEEAIPADLIVLSSSEPEGLCYIETANLDGETNLKIKQARP 348
            +F    W ++ VGDI+RV + + IPAD+I+LS+S+ +G CY+ET NLDGETNLK++Q+  
Sbjct: 437  RFAKDYWKNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLK 496

Query: 349  ETSKILDVRELSAMRGKILSEQPNTSLYTYEGTMI---LHNNRI---PLSPDQILLRGAT 402
             +  I   R+++  +  + SE P+ +LY+Y+G        N  I   P++ + +LLRG T
Sbjct: 497  CSKIIKSSRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCT 556

Query: 403  LRNTVWIFGIVIFTGHETKLTRNATATPIKRTAVERVINLQIVALFGVLICLSLISSFGN 462
            LRNT W  G+VIFTG +TK+  NA  TP K++ + R +N  ++  F +L  L   +   N
Sbjct: 557  LRNTKWAMGMVIFTGDDTKIMINAGVTPTKKSRISRELNFSVILNFVLLFILCFTAGIVN 616

Query: 463  LIVMYNQKENLSYLYLQGTNMVALFFKNILTFW---ILFSNLVPISLFVTVEMIKYYQAY 519
              V Y QK      +  GT   +      ++FW   IL+ +LVPISL+++VE+IK  QA 
Sbjct: 617  G-VYYKQKPRSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAI 675

Query: 520  MIASDLDLFHEESNMPTVVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKSCSIAG---- 575
             I +D+ L++ + + P   ++ ++ ++LGQIEYIFSDKTGTLTQNVMEFK C+I G    
Sbjct: 676  FIYTDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYG 735

Query: 576  RCYIQS----------------------IPEDKDAAFDE-----------GIEVGYRTYD 602
            R Y ++                      I +D++   DE             ++ + + +
Sbjct: 736  RAYTEALAGLRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFVSKE 795

Query: 603  DMHELLHTPGSGDGAIIDEFLTLLSICHTVI--PEFQENGSIKYQAASPDEGALVQGAAD 660
             + +L  + G       + FL  L++CH+V+  P   +   +  +A SPDE ALV  A  
Sbjct: 796  IVEDLKGSSGDHQQKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQ 855

Query: 661  LGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPDNSIR------L 714
            LGY F+    + + +  + + +E  +++LN+ EFNS+RKRMS I + P ++ +      L
Sbjct: 856  LGYSFVGSSKSGLIVEIQGVQKE--FQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALL 913

Query: 715  LCKGADTVILERLAATSN--PYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLY 772
            +CKGAD+VI  RL  T N    +  T  HLE+YA EGLRTLC+A R +  SEYE W K Y
Sbjct: 914  ICKGADSVIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTY 973

Query: 773  DAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTG 832
            D AA ++ NR EELDKV ++IE+ L+LLG TAIED+LQDGVP++I  L +AGIK+WVLTG
Sbjct: 974  DVAAASVTNREEELDKVTDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTG 1033

Query: 833  DRQETAINIGMSCKLLSEDMNLLIVN---EDTKE------STRNNLIDK-LR-------- 874
            D+ ETAINIG SC +L+ DM LL+V    ED +E         NNL+ K LR        
Sbjct: 1034 DKVETAINIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGS 1093

Query: 875  ------AINDHQISQQDMNTLALVIDGKSLGFALE-PDLEEFLLAIGKMCRAVICCRVSP 927
                  A  +H + Q +    A++IDG +L  AL   ++    L + K C+AV+CCRVSP
Sbjct: 1094 EEELKEAKREHGLPQGN---FAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSP 1150

Query: 928  LQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFALGQFK 987
             QKA VVK+VK+    + LAIGDG+NDV+MIQ+A VGVGI+G EG QA   +D+A+GQF+
Sbjct: 1151 AQKAAVVKLVKKTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFR 1210

Query: 988  YLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVLYNAFSGQSIMESWTLTFYNW 1047
            Y+ +L+LVHG W Y+R+++ I   FYKN+   ++ FWY +YN F G  + E   LTFYN 
Sbjct: 1211 YVTRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNL 1270

Query: 1048 GGTAAPPGPPKRRDQFERSGLLNRDAQSCTVGQKGQFWPATIFRGSAINGNYHNWITIDG 1107
              T+ P       DQ     +     Q   VG   + W  T F    ++G Y + I    
Sbjct: 1271 AFTSVPVILLAVLDQDVSDTVSMLVPQLYRVGILRKEWNQTKFLWYMLDGVYQSVICFFF 1330

Query: 1108 WIMDYRYGAAGAMHGETADH----WVWGVAIQPTSIIFVLGKAALITNQWTKFTVLAIPG 1163
              + Y        +G   DH     V+  AI  TS  F +    +   +W  F  L I  
Sbjct: 1331 PYLAYHKNMVVTENGLGLDHRYFVGVFVTAIAVTSCNFYV---FMEQYRWDWFCGLFICL 1387

Query: 1164 SLVFWLLFFPIYAYLLPGLNVSKEYYGIVSHVYGSFTFWAMCYVXXXXXXXXXXXWKYYK 1223
            SL  +  +  I+       + S E+Y   + V+    +WA+ +V               +
Sbjct: 1388 SLAVFYGWTGIWT----SSSSSNEFYKGAARVFAQPAYWAVLFVGVLFCLLPRFTIDCIR 1443

Query: 1224 RTYTPESYHVVQEM----------QKYDISD-NRPRIEQFQ 1253
            + + P+   +V+EM          Q YD +D +RPRI + +
Sbjct: 1444 KIFYPKDIEIVREMWLRGDFDLYPQGYDPTDPSRPRINEIR 1484

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 45/91 (49%)

Query: 194 YGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRFXXXXXXXXX 253
           Y  N I TTKY   TF PK +  +F  +AN++FL   I+        TN           
Sbjct: 229 YPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGAFQIFGVTNPGFASVPLIVI 288

Query: 254 XXXSAIKESVEDLKRSNSDKELNHSRADVYS 284
              +AIK+ +ED +R+  D E+N++R  + S
Sbjct: 289 VIITAIKDGIEDSRRTVLDLEVNNTRTHILS 319

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
            Saccharomyces cerevisiae YER166w or sp|Q12675
            Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score =  634 bits (1635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/1069 (37%), Positives = 578/1069 (54%), Gaps = 107/1069 (10%)

Query: 289  QFISKKWIDIAVGDIIRVRSEEAIPADLIVLSSSEPEGLCYIETANLDGETNLKIKQARP 348
            +F    W  + VGDI+R+ + + IPAD+I+LS+S+ +G CY+ET NLDGETNLK++QA  
Sbjct: 388  RFARDYWKSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALK 447

Query: 349  ETSKILDVRELSAMRGKILSEQPNTSLYTYEGTMILH---NNRI---PLSPDQILLRGAT 402
             + KI   R+++  R  I SE P+ +LY+Y+G +      NN +   P++ + +LLRG T
Sbjct: 448  CSYKIKTSRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCT 507

Query: 403  LRNTVWIFGIVIFTGHETKLTRNATATPIKRTAVERVINLQIVALFGVLICLSLISSFGN 462
            LRNT W  GIV+FTG +TK+  NA  TP K++ + R +N  ++  F VL  L  IS   N
Sbjct: 508  LRNTKWAMGIVVFTGDDTKIMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLAN 567

Query: 463  LIVMYNQKENLSYLYLQGTNMVALFFKNILTFW---ILFSNLVPISLFVTVEMIKYYQAY 519
             I  Y++       +  GT          ++FW   IL+ +LVPISL+++VE+IK  QA 
Sbjct: 568  GID-YDKHPRSRDFFEFGTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAA 626

Query: 520  MIASDLDLFHEESNMPTVVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKSCSIAG---- 575
             I  D+ L++ + + P   ++ ++ ++LGQIEYIFSDKTGTLTQNVMEFK C+I G    
Sbjct: 627  FIYGDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYG 686

Query: 576  RCYIQS----------------------IPEDKDAAFDE-----------GIEVGYRTYD 602
            R Y ++                      I +D+D   ++             E+ + + +
Sbjct: 687  RAYTEALAGLRKRQGIDVEAEGRREKEEIAKDRDVMINDLRNLSNNTQFFPDEITFISKE 746

Query: 603  DMHELLHTPGSGDGAIIDEFLTLLSICHTVI--PEFQENGSIKYQAASPDEGALVQGAAD 660
             + +     G       + F+  L++CH+V+  P       ++ +A SPDE ALV  A D
Sbjct: 747  IVQDFKGRNGDIQKKCCEHFMLALALCHSVLTEPSPTNPNKLEMKAQSPDEAALVTTARD 806

Query: 661  LGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPDNSIR------L 714
            LG+ F+ +    + +  + I +E  +E+LNI EFNS RKRMS I + P  +        L
Sbjct: 807  LGFCFMGKTKTGMVVEIQGIQKE--FEILNILEFNSARKRMSCIIKIPGATPNDEPRALL 864

Query: 715  LCKGADTVILERLAATSN----PYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSK 770
            +CKGAD+VI  RL+  +       +  T  HLE YA EGLRTLC+A R +  SEY EW+ 
Sbjct: 865  ICKGADSVIYSRLSTKAGENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNA 924

Query: 771  LYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVL 830
             YD AA ++ NR E+L+ V++ IE+ L+LLG TAIED+LQDGVPE+I  L +AGIK+WVL
Sbjct: 925  RYDIAAASLTNREEQLEIVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVL 984

Query: 831  TGDRQETAINIGMSCKLLSEDMNLLIVN----------EDTKESTRNNLIDK-LR----- 874
            TGD+ ETAINIG SC LL+ DM LL+V           ED  E   N+LI K LR     
Sbjct: 985  TGDKVETAINIGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVV-NSLISKYLREKFGL 1043

Query: 875  ---------AINDHQISQQDMNTLALVIDGKSLGFALE-PDLEEFLLAIGKMCRAVICCR 924
                     A  DH   + D    A+VIDG +L  AL   D++   L + K C+AV+CCR
Sbjct: 1044 SGSEMELDNAKGDHSFPKGD---FAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCR 1100

Query: 925  VSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFALG 984
            VSP QKA VVK+VK     + LAIGDG+NDV+MIQ+A VG+GI+G EG QA   +D+A+G
Sbjct: 1101 VSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIG 1160

Query: 985  QFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVLYNAFSGQSIMESWTLTF 1044
            QF+YL +LLLVHG WSY+R+S+ I   FYKN+   +  FWY +YN F G  + E   L F
Sbjct: 1161 QFRYLTRLLLVHGRWSYKRLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMF 1220

Query: 1045 YNWGGTAAPPGPPKRRDQFERSGLLNRDAQSCTVGQKGQFWPATIFRGSAINGNYHNWIT 1104
            YN   T+ P       DQ     +     Q   VG     W  T F     +G Y + I 
Sbjct: 1221 YNLAFTSIPVILLGILDQDVNDTISLVVPQLYRVGILRLEWNQTKFLWYMFDGLYQSVIC 1280

Query: 1105 IDGWIMDYRYGAAGAMHGETADHWVWGVAIQPTSIIFVLGKAALITN-QWTKFTVLAIPG 1163
                 + Y+       +G   +H  +   I  T  +F      LI   +W  F+   I  
Sbjct: 1281 FFFPYLLYKRNGVVTKNGMGLEHRYYVGIIVTTIAVFACNLYILIHQYRWDWFSGFFIFL 1340

Query: 1164 SLVFWLLFFPIYAYLLPGLNVSKEYYGIVSHVYGSFTFWAMCYVXXXXXXXXXXXWKYYK 1223
            S +  + +  I+      L++ K        +Y S +FWA+ ++           W  Y 
Sbjct: 1341 SCIVVIGWTGIWTSSFTSLDLWKA----GERIYDSPSFWAVFFIGVFFCLLPRFTWDCYT 1396

Query: 1224 RTYTPESYHVVQEMQK----------YDISD-NRPRIEQFQKAIRKVRQ 1261
            + + P    +++EM K          YD +D NRP+I +  K   ++ Q
Sbjct: 1397 QFFNPSDVQIIREMWKRGDYDHYPVGYDPTDPNRPKISKGAKFGERLGQ 1445

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 66/151 (43%), Gaps = 11/151 (7%)

Query: 153 KFNLKALFDHYVLRKPAAADTG---AGEPRVIYIN--------ERRANGAMGYGDNHIST 201
           K N+K  FD +   +    D     A + R +Y N        +   N  M Y  N I T
Sbjct: 132 KKNIKNPFDDFSRDEEEENDRSTNRADQLRTVYHNLPLPEEMLDEEGNPIMEYPRNKIRT 191

Query: 202 TKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRFXXXXXXXXXXXXSAIKE 261
           TKY   +F PK L  +F  +AN++FL   I+        TN              +AIK+
Sbjct: 192 TKYTPLSFFPKNLLFQFQNFANVYFLVLIILGAFQIFGVTNPGLSAVPLIVIVIITAIKD 251

Query: 262 SVEDLKRSNSDKELNHSRADVYSDEMGQFIS 292
            +ED +R+  D E+N++R  +    + + +S
Sbjct: 252 GIEDSRRTILDLEVNNTRTHILEGVVNENVS 282

>Scas_505.4
          Length = 1025

 Score =  612 bits (1579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/423 (67%), Positives = 338/423 (79%)

Query: 865  TRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLGFALEPDLEEFLLAIGKMCRAVICCR 924
            TR N+ DK+ A+ +H++SQ +MNTLALVIDGKSL +ALE DLE++LLA+GK+C+AV+CCR
Sbjct: 534  TRKNMRDKIMALKEHKLSQHEMNTLALVIDGKSLSYALESDLEDYLLALGKICKAVVCCR 593

Query: 925  VSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFALG 984
            VSPLQKALVVKMVKR+T SLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSAD A+G
Sbjct: 594  VSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVG 653

Query: 985  QFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVLYNAFSGQSIMESWTLTF 1044
            QF++LKKLLLVHGSWSYQRIS AILYSFYKN ALYMTQFW+V  NAFSGQSIMESWT+++
Sbjct: 654  QFRFLKKLLLVHGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSY 713

Query: 1045 YNWGGTAAPPGPPKRRDQFERSGLLNRDAQSCTVGQKGQFWPATIFRGSAINGNYHNWIT 1104
            YN   T  PP      DQF  S LL R  Q   +GQ+G+F+   IF G  +NG YH+ + 
Sbjct: 714  YNVFFTVFPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVV 773

Query: 1105 IDGWIMDYRYGAAGAMHGETADHWVWGVAIQPTSIIFVLGKAALITNQWTKFTVLAIPGS 1164
              G ++ YRYG A  MHGE ADHW WG+A+  +SI+ VLGKAAL+TNQWTKFT+ AIPGS
Sbjct: 774  YIGTMLFYRYGMALNMHGEVADHWSWGIAVYTSSILIVLGKAALVTNQWTKFTLFAIPGS 833

Query: 1165 LVFWLLFFPIYAYLLPGLNVSKEYYGIVSHVYGSFTFWAMCYVXXXXXXXXXXXWKYYKR 1224
             +FW++FFPIYA + P  N+S+EY+G+V H YGS TFW    V           WKYY+R
Sbjct: 834  FIFWMIFFPIYASVFPYANISREYFGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYRR 893

Query: 1225 TYTPESYHVVQEMQKYDISDNRPRIEQFQKAIRKVRQVQRMKKQRGFAFSQSEEAGQDRI 1284
             Y PESYH+VQEMQK++ISDNRP ++ FQ  IRKVRQVQRMKKQRGFAFSQSEE GQD+I
Sbjct: 894  MYEPESYHLVQEMQKFNISDNRPHVQHFQNEIRKVRQVQRMKKQRGFAFSQSEEGGQDKI 953

Query: 1285 VRM 1287
            +RM
Sbjct: 954  IRM 956

 Score =  521 bits (1342), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 282/491 (57%), Positives = 347/491 (70%), Gaps = 37/491 (7%)

Query: 4   SRD-KHNEETLFDIDFLDDRYTPEPARPVNDSGSRSGPIIDSGIDDLVQ-MQRTGFPQEV 61
           S+D K  ++TLFDID L+D   P        S S    II +  D   + +    FP+E 
Sbjct: 50  SKDAKVADDTLFDIDILNDSAEP--------SNSTQPHIIANNRDAEARVIPPHTFPEET 101

Query: 62  IDLDDEPPFRHDDSIENDLIENPFDDERGQQRYLASANRLSV----PQ--PSGWQRLVGG 115
           IDLD+      DD+IEND+ +NPF DE          NR       PQ  P+G +   G 
Sbjct: 102 IDLDN------DDNIENDIYDNPFQDEESTT---WDTNRFETNNYQPQLYPTGQRN--GF 150

Query: 116 LRDSVGGR------GTENSQYQSFEMQDYRDTHSGD---RYQRSRNKFNLKALFDHYVLR 166
             +S           T+ S   S+EM  Y    + +   RY  SRN+FN+K LF+ Y+LR
Sbjct: 151 FANSFNKVKNIFVFNTKPSDSGSYEMNRYNAVTNNELDGRYADSRNRFNIKILFNRYILR 210

Query: 167 KPAAADTGAGEPRVIYINERRANGAMGYGDNHISTTKYNAATFLPKFLFQEFSKYANLFF 226
           K   A +  G PR IY+N+R AN A  YGDNHISTTKYN ATFLPKFLFQEFSKYANLFF
Sbjct: 211 KNVGA-SDDGTPREIYLNDRTANHAFNYGDNHISTTKYNIATFLPKFLFQEFSKYANLFF 269

Query: 227 LFTSIIQQVPNVTPTNRFXXXXXXXXXXXXSAIKESVEDLKRSNSDKELNHSRADVYSDE 286
           L T+ IQQVP+V+PTNR+            SA KES+ED+KR+NSDKELN+S+ ++YS+E
Sbjct: 270 LCTAAIQQVPHVSPTNRYTTVGTLMVVLIVSAFKESIEDIKRANSDKELNNSKTEIYSEE 329

Query: 287 MGQFISKKWIDIAVGDIIRVRSEEAIPADLIVLSSSEPEGLCYIETANLDGETNLKIKQA 346
            G FI ++WIDI  GD+IRV+SEEAIPADLIV+SSSEPEGLCYIETANLDGETNLKIKQA
Sbjct: 330 NGDFIERRWIDIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQA 389

Query: 347 RPETSKILDVRELSAMRGKILSEQPNTSLYTYEGTMILHNNRIPLSPDQILLRGATLRNT 406
           RPET++++D R+L+  +GK++SEQPN+SLYTYEGT+  +N +IPLSP+Q++LRGATLRNT
Sbjct: 390 RPETAEMMDSRKLNNFKGKVISEQPNSSLYTYEGTLEFNNRKIPLSPEQMILRGATLRNT 449

Query: 407 VWIFGIVIFTGHETKLTRNATATPIKRTAVERVINLQIVALFGVLICLSLISSFGNLIVM 466
            W+FG+VIFTGHETKL RNATATPIKRTAVERVINLQIVALFGVLI L LISS GN I+ 
Sbjct: 450 SWMFGLVIFTGHETKLMRNATATPIKRTAVERVINLQIVALFGVLIVLVLISSLGNAIIS 509

Query: 467 YNQKENLSYLY 477
             Q+++LSYLY
Sbjct: 510 STQEKHLSYLY 520

>Scas_576.8
          Length = 1591

 Score =  629 bits (1621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/1075 (36%), Positives = 592/1075 (55%), Gaps = 133/1075 (12%)

Query: 289  QFISKKWIDIAVGDIIRVRSEEAIPADLIVLSSSEPEGLCYIETANLDGETNLKIKQARP 348
            +F    W ++ VGDI+R+ + + IPAD+I+LS+S+ +G CY+ET NLDGETNLK++++  
Sbjct: 408  KFSKDYWKNVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYLETKNLDGETNLKVRESLK 467

Query: 349  ETSKILDVRELSAMRGKILSEQPNTSLYTYEGTMILHNNRI------PLSPDQILLRGAT 402
             +  I + R+++  +  + SE P+ +LY+Y+G +   +++       P++ + +LLRG T
Sbjct: 468  CSHSIRNSRDIARTKFWVESEGPHANLYSYQGNVKWVDSKDGDLKNEPVTINNLLLRGCT 527

Query: 403  LRNTVWIFGIVIFTGHETKLTRNATATPIKRTAVERVINLQIVALFGVLICLSLISSFGN 462
            LRNT W  G+V+FTG +TK+  N+ ATP K++ + R +NL +   F  L  +  IS+  N
Sbjct: 528  LRNTKWAMGMVVFTGDDTKIMLNSGATPTKKSRISRELNLSVSLNFLFLFIICFISAIIN 587

Query: 463  LIVMYNQKENLSYLYLQGTNMVALFFKNILTFW---ILFSNLVPISLFVTVEMIKYYQAY 519
              V Y++       +  GT   +      ++FW   IL+ +LVPISL+++VE+IK  QA 
Sbjct: 588  G-VDYDKHPRSRDFFEFGTVAGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAA 646

Query: 520  MIASDLDLFHEESNMPTVVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKSCSIAG---- 575
             I  D+ L++ + + P   ++ ++ +++GQIEYIFSDKTGTLTQNVMEFK C+I G    
Sbjct: 647  FIYGDVLLYNAKLDYPCTPKSWNISDDMGQIEYIFSDKTGTLTQNVMEFKKCTINGISYG 706

Query: 576  RCYIQS----------------------IPEDKDAAFDEGIEVGYRT--YDD-------- 603
            R Y ++                      I +D+D   +    + + +  Y D        
Sbjct: 707  RAYTEALAGLRKRQGIDVEEEGRREKEEIAKDRDTMINTLRNLSHNSQFYPDDITFISKE 766

Query: 604  -MHELLHTPGSGDGAIIDEFLTLLSICHTVI--PEFQENGSIKYQAASPDEGALVQGAAD 660
             +++L    G       + F+  L++CH+V+  P   ++  +  +A SPDE ALV  A D
Sbjct: 767  FVNDLKGASGDMQQKCCEHFMLALALCHSVLVEPNKHDSKKLDVKAQSPDEAALVCTARD 826

Query: 661  LGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFP----DNSIR--L 714
            +G+ FI +    + I  + + +E  +++LN  EFNSTRKRMS I + P    D+  R  L
Sbjct: 827  VGFSFIGKTKTGLIIEVQGVQKE--FQILNTLEFNSTRKRMSCIVKIPGANPDDEPRALL 884

Query: 715  LCKGADTVILERLA----ATSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSK 770
            +CKGAD++I  RL     A S   +  T  HLE YA EGLRTLCIA R +   EY EW+K
Sbjct: 885  ICKGADSIIYSRLGTKNGANSENLLEKTALHLEQYATEGLRTLCIAQRELSWPEYLEWNK 944

Query: 771  LYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVL 830
             YD AA ++ NR E+L+ V++ IE+ L LLG TAIED+LQDGVPE+I  L QAGIK+WVL
Sbjct: 945  RYDIAAASVTNREEQLEAVSDEIERELTLLGGTAIEDRLQDGVPESISILAQAGIKLWVL 1004

Query: 831  TGDRQETAINIGMSCKLLSEDMNLLIVN---EDTKESTRN------NLIDK-LR------ 874
            TGD+ ETAINIG SC LL+ DM LL+V    +D +E   +      +LI K LR      
Sbjct: 1005 TGDKVETAINIGFSCNLLNNDMELLVVKTNGDDVQEFGNDPAEIAESLITKYLREKFGLT 1064

Query: 875  --------AINDHQISQQDMNTLALVIDGKSLGFAL--EPDLEEFLLAIGKMCRAVICCR 924
                    A  +H   + D    A+VIDG++L  AL  E    +FLL + K C+AV+CCR
Sbjct: 1065 GSEMELADAKKNHDFPRGD---FAVVIDGEALKLALNGESIRRKFLL-LCKNCKAVLCCR 1120

Query: 925  VSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFALG 984
            VSP QKA VVK+V      + LAIGDG+NDV+MIQ+A VGVGI+G EG QA   +D+A+G
Sbjct: 1121 VSPAQKAAVVKLVMTSLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIG 1180

Query: 985  QFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVLYNAFSGQSIMESWTLTF 1044
            QF+YL +L+LVHG WSY+R+++ I   FYKN+   +  FWY +YN F G  + E   L F
Sbjct: 1181 QFRYLTRLVLVHGRWSYRRLAEMIPAFFYKNVIFTLALFWYGIYNNFDGSYLFEYTFLMF 1240

Query: 1045 YNWGGTAAPPGPPKRRD------------QFERSGLLNRDAQSCTVGQKGQFWPATIFRG 1092
            YN   T+ P       D            Q  RSG+L  D            W  T F  
Sbjct: 1241 YNLAFTSLPVIFMGIMDQDVSDTVSLVMPQLYRSGILRLD------------WNQTKFLW 1288

Query: 1093 SAINGNYHNWITIDGWIMDYRYGAAGAMHGETADHWVWGVAIQPTSIIFVLGKAALITNQ 1152
              ++G Y + I        Y      + +G   DH  + V +  TS+  V     ++ +Q
Sbjct: 1289 YMLDGLYQSCICFFFPYCLYHKNQIVSNNGLGLDHRFY-VGVMVTSLAVVSCNIYMLLHQ 1347

Query: 1153 --WTKFTVLAIPGSLVFWLLFFPIYAYLLPGLNVSKEYYGIVSHVYGSFTFWAMCYVXXX 1210
              W  F+ L I  S +    +  +++  L     SKE++   S +YG+ +FW + +V   
Sbjct: 1348 YRWDWFSCLFIGLSCIILFFWTGVWSSSL----TSKEFFKAASRIYGAPSFWGVFFVGIV 1403

Query: 1211 XXXXXXXXWKYYKRTYTPESYHVVQEMQK----------YDISD-NRPRIEQFQK 1254
                       +++ + P    +V+EM +          YD +D NRP++ +  K
Sbjct: 1404 YCLLPRFTLDCFRKFFYPTDVEIVREMWQRGDFSHYPPGYDPTDPNRPKVAKSGK 1458

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 52/116 (44%), Gaps = 8/116 (6%)

Query: 175 AGEPRVIYIN--------ERRANGAMGYGDNHISTTKYNAATFLPKFLFQEFSKYANLFF 226
           A E R +Y N        +        Y  N I TTKY+   F PK +  +F  +AN++F
Sbjct: 174 ASELRTVYYNMPLPKEMVDEDGKPITDYPRNKIRTTKYSPLNFFPKNIMFQFQNFANVYF 233

Query: 227 LFTSIIQQVPNVTPTNRFXXXXXXXXXXXXSAIKESVEDLKRSNSDKELNHSRADV 282
           L   I+        TN              +AIK+++ED +R+  D E+N++R  +
Sbjct: 234 LVLIILGAFQIFGVTNPGLAAVPLIVIVIITAIKDAIEDSRRTLLDMEVNNTRTHI 289

>Scas_636.16
          Length = 1554

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/1099 (36%), Positives = 590/1099 (53%), Gaps = 136/1099 (12%)

Query: 266  LKRSNSDKELNHSRADVYSDEM-----GQFISKKWIDIAVGDIIRVRSEEAIPADLIVLS 320
            L++SN D    +    V    +      +F +  W ++ VGDI+R+ + + IPAD+I+LS
Sbjct: 343  LEQSNIDSTFENGEISVLDPSLPPMANSKFANDFWKNVRVGDIVRIHNNDEIPADVILLS 402

Query: 321  SSEPEGLCYIETANLDGETNLKIKQARPETSKILDVRELSAMRGKILSEQPNTSLYTYEG 380
            +S+ +G CY+ET NLDGE+NLK++Q+   T+ I + R++   +  + SE P+ +LY Y+G
Sbjct: 403  TSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRNSRDICRTKFWVESEGPHANLYVYQG 462

Query: 381  TMI--------LHNNRIPLSPDQILLRGATLRNTVWIFGIVIFTGHETKLTRNATATPIK 432
             +          HN   P++ + +LLRG TLRNT W  GIV+FTG +TK   NA  TP K
Sbjct: 463  NLKWIDSLDGQTHNE--PITINNMLLRGCTLRNTKWAMGIVVFTGDDTKTMINAGVTPTK 520

Query: 433  RTAVERVINLQIVALFGVLICLSLISSFGNLIVMYNQKENLSYLYLQGTNMVALFFKNIL 492
            ++ + R +N  ++  F  L  L LI+   N    Y +K      +  GT          +
Sbjct: 521  KSRISRELNFSVLINFVFLFILCLIAGVANG-AYYRKKPRSRDFFEFGTIAGNPTTNGFV 579

Query: 493  TFW---ILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLVEELGQ 549
            +FW   IL+ +LVPISL+++VE+IK  QA  I  D+ L++E  + P   ++ S+ ++LGQ
Sbjct: 580  SFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVLLYNERLDYPCTPKSWSISDDLGQ 639

Query: 550  IEYIFSDKTGTLTQNVMEFKSCSIAG----RCYI---------QSIPEDKDAAFD-EGI- 594
            IEYIFSDKTGTLTQNVMEFK C+I G    R Y          Q I  +K+   + EGI 
Sbjct: 640  IEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDTEKEGRIEREGIA 699

Query: 595  ----------------------EVGYRTYDDMHELLHTPGSGDGAIIDEFLTLLSICHTV 632
                                  E+ + + +   +LL   G         F+  L++CH+V
Sbjct: 700  QDREIMIDDLRKISNNSQFYPEELTFVSKEFSQDLLGNNGEVQQKRCQHFMLALALCHSV 759

Query: 633  I--PEFQENGSIKYQAASPDEGALVQGAADLGYKFIIRKPNSVTILREDITEEVVYELLN 690
            +  P+  +   ++  A SPDE ALV  A D+G+ FI +    + +  + I +E  +++LN
Sbjct: 760  LVEPDKNDPNKLELTAQSPDETALVTTARDMGFSFIGKTKQGLLVEVQGIQKE--FQILN 817

Query: 691  ICEFNSTRKRMSAIFRFPDNSIR------LLCKGADTVILERLAA----TSNPYVAATLR 740
            I EFNS+RKRMS I + P  + +      L+CKGAD+VI  RL+          +  T  
Sbjct: 818  ILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPGYNDETLLEKTAL 877

Query: 741  HLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLL 800
            HLE YA EGLRTLC+  R I  SEY+EW++ Y+ AA ++  R EELD VA++IE+ LVLL
Sbjct: 878  HLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHVADLIERDLVLL 937

Query: 801  GATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLLIVN-- 858
            G TAIED+LQDGVP++I  L +AGIK+WVLTGD+ ETAINIG SC LL+ DM LL++   
Sbjct: 938  GGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDMELLVIKTT 997

Query: 859  -EDTKE------STRNNLIDKL---------------RAINDHQISQQDMNTLALVIDGK 896
             ED KE         N L+ K                 A  DH   Q +    A++IDG+
Sbjct: 998  GEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEELAAAKKDHSPPQGE---FAIIIDGE 1054

Query: 897  SLGFALEPD-LEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDV 955
            +L  AL  D ++   L + K C+AV+CCRVSP QKA VVK+VK     + LAIGDG+NDV
Sbjct: 1055 ALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKDTLDVMTLAIGDGSNDV 1114

Query: 956  SMIQAAHVGVGISGMEGMQAARSADFALGQFKYLKKLLLVHGSWSYQRISQAILYSFYKN 1015
            +MIQ+A VGVGI+G EG QA   +D+A+GQF+Y+ +L+LVHG W Y+R+++ I   FYKN
Sbjct: 1115 AMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRLAEMIPQFFYKN 1174

Query: 1016 IALYMTQFWYVLYNAFSGQSIMESWTLTFYNWGGTAAPPGPPKRRDQFERSGLLNRDAQS 1075
            +   +  FWY ++N F G  + E   LTFYN   T+ P             G+L++D  S
Sbjct: 1175 VIFTLALFWYGVHNDFDGSYLFEYTYLTFYNLAFTSLP---------VIFLGILDQDV-S 1224

Query: 1076 CTV----------GQKGQFWPATIFRGSAINGNYHNWITIDGWIMDYRYGAAGAMHGETA 1125
             TV          G   Q W  T F     +G Y + I      + YR       +G   
Sbjct: 1225 ATVSMIVPQLYRSGILRQEWNQTKFLWYMFDGIYQSVICYFFPYLIYRKTNIITQNGLGL 1284

Query: 1126 DHWVWGVAIQPTSIIFVLGKAALITNQ--WTKFTVLAIPGSLVFWLLFFPIYAYLLPGLN 1183
            DH  + V I  T I        ++  Q  W  FT      S + +  +  I++  +    
Sbjct: 1285 DHRYY-VGIPVTGIAVTSCNFYVLMEQYRWDWFTTFFAFLSTIVYFGWTGIWSSSI---- 1339

Query: 1184 VSKEYYGIVSHVYGSFTFWAMCYVXXXXXXXXXXXWKYYKRTYTPESYHVVQEM------ 1237
             S E++   S +YG+ +FWA+ +V           +  + +   P    +++EM      
Sbjct: 1340 ASYEFWKGASRMYGTPSFWAVYFVGFLFCILPRFTYDVFMKYLYPSDVEIIREMWQHGDF 1399

Query: 1238 ----QKYDISD-NRPRIEQ 1251
                  YD +D N+P++E+
Sbjct: 1400 ARYPDDYDPTDPNKPKVEK 1418

 Score = 54.7 bits (130), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 47/91 (51%)

Query: 192 MGYGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRFXXXXXXX 251
           M Y  N I TTKY   TF PK +  +F+ +AN++FL   I+        TN         
Sbjct: 166 MEYPRNKIRTTKYTPLTFFPKNVMLQFNNFANIYFLIMIILGAFQIFGVTNPGLAAVPLI 225

Query: 252 XXXXXSAIKESVEDLKRSNSDKELNHSRADV 282
                +AIK+++ED +R+  D E+N++R  +
Sbjct: 226 VIIILTAIKDAIEDSRRTLLDMEVNNTRTHI 256

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-like
            ATPases family in the superfamily of P-type ATPases,
            overproduction confers neomycin resistance [3456 bp, 1151
            aa]
          Length = 1151

 Score =  402 bits (1033), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 289/874 (33%), Positives = 458/874 (52%), Gaps = 72/874 (8%)

Query: 194  YGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRFXXXXXXXXX 253
            Y  N +S  KYNA TF+P  L+++F  + NL+FL  ++ Q VP +               
Sbjct: 170  YVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYIVPLAFV 229

Query: 254  XXXSAIKESVEDLKRSNSDKELNHSRADVYSDEMGQFISKKWIDIAVGDIIRVRSEEAIP 313
               +  KE+++D++R   D+E N+    V +    + I  K  D+ VGD+I+V   + IP
Sbjct: 230  LTVTMAKEAIDDIQRRRRDRESNNELYHVIT--RNRSIPSK--DLKVGDLIKVHKGDRIP 285

Query: 314  ADLIVLSSSEPEGLCYIETANLDGETNLKIKQARPETSKILDVRELSAMRGKILSEQPNT 373
            ADL++L SSEP G  +I+T  LDGET+ K++ A P T  + +   ++  R  I +  P  
Sbjct: 286  ADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSENDLIN--RISITASAPEK 343

Query: 374  SLYTYEGTMILHNNRI-PLSPDQILLRGATLRNTVWIFGIVIFTGHETKLTRNATATPIK 432
            S++ + G +   ++   PLS D  L     L ++ +    V++TG +T+   N T   +K
Sbjct: 344  SIHKFLGKVTYKDSTSNPLSVDNTLWANTVLASSGFCIACVVYTGRDTRQAMNTTTAKVK 403

Query: 433  RTAVERVINLQIVALFGVLICLSLISSFGNLIVMYNQKENLSYLYLQGTNMVALFFKNIL 492
               +E  IN     L   +  LS+      L+V +    N  +            + +IL
Sbjct: 404  TGLLELEINSISKILCACVFALSI------LLVAFAGFHNDDW------------YIDIL 445

Query: 493  TFWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLVEELGQIEY 552
             + ILFS ++P+SL V +++ K   A+ I       H+++   T+VRTS++ E+LG+IEY
Sbjct: 446  RYLILFSTIIPVSLRVNLDLAKSVYAHQIE------HDKTIPETIVRTSTIPEDLGRIEY 499

Query: 553  IFSDKTGTLTQNVMEFKSCSIAGRCY-----------IQSIPEDKDAAFDEGIEVGYRTY 601
            + SDKTGTLTQN M+ K   +    Y           +QS+   K+ + +        T 
Sbjct: 500  LLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVQSLVSSKNDSLNNSKVALSTTR 559

Query: 602  DDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPDEGALVQGAADL 661
             DM             + D  LTL +ICH V P F E+  + YQAASPDE A+V+    +
Sbjct: 560  KDM----------SFRVRDMILTL-AICHNVTPTF-EDDELTYQAASPDEIAIVKFTESV 607

Query: 662  GYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPD-NSIRLLCKGAD 720
            G     R  +S+++L E   + + YE+L +  FNS  KRM  I R    +    + KGAD
Sbjct: 608  GLSLFKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVRDEQLDEYWFMQKGAD 667

Query: 721  TVILERLAATSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATTMH 780
            TV+ +     SN ++     ++   A EGLRTL I  + + +  YE++ K Y+ A+ +M 
Sbjct: 668  TVMSK--IVESNDWLEEETGNM---AREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSML 722

Query: 781  NRSEELDKV-AEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAI 839
            NR +++ +V  + +E  L LLG T +EDKLQ  V  +I  L+ AGIK+W+LTGD+ ETA 
Sbjct: 723  NRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETAR 782

Query: 840  NIGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLG 899
             + +S KL+S    +  + + T+     N ++ L+ IN +           L+IDG+SLG
Sbjct: 783  CVSISAKLISRGQYVHTITKVTRPEGAFNQLEYLK-INRNA---------CLLIDGESLG 832

Query: 900  FALEPDLEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQ 959
              L+   +EF   +  +   VI CR +P QKA V  ++++ T   +  IGDG NDVSMIQ
Sbjct: 833  MFLKHYEQEFFDVVVHL-PTVIACRCTPQQKADVALVIRKMTGKRVCCIGDGGNDVSMIQ 891

Query: 960  AAHVGVGISGMEGMQAARSADFALGQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALY 1019
             A VGVGI G EG QA+ +ADF++ QF +L +LLL HG  SY+R ++   +  ++ + + 
Sbjct: 892  CADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIA 951

Query: 1020 MTQFWYVLYNAFSGQSIMESWTLTFYNWGGTAAP 1053
            + Q  Y + + F   ++ + W +  Y    T AP
Sbjct: 952  ICQAVYSICSLFEPIALYQGWLMVGYATCYTMAP 985

>Scas_704.38
          Length = 1161

 Score =  398 bits (1023), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 272/868 (31%), Positives = 445/868 (51%), Gaps = 60/868 (6%)

Query: 194  YGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRFXXXXXXXXX 253
            Y  N IS  KYNA TF+P  L+++F  + NL+FL  ++ Q +P +               
Sbjct: 180  YPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSYVVPLAFV 239

Query: 254  XXXSAIKESVEDLKRSNSDKELNHSRADVYSDEMGQFISKKWIDIAVGDIIRVRSEEAIP 313
               +  KE+++D++R   D E N     V +    + +  K  D+ VGD+I++   + +P
Sbjct: 240  LTVTMSKEAMDDIQRRRRDNESNSELYHVLNQ--SKLVPSK--DLKVGDLIKISKGDRLP 295

Query: 314  ADLIVLSSSEPEGLCYIETANLDGETNLKIKQARPETSKILDVRELSAMRGKILSEQPNT 373
            ADL++L SSEP G  +I+T  LDGET+ K++ A   T  + +   ++ +   I +  P  
Sbjct: 296  ADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNLTEPDLMNKV--SITASAPEK 353

Query: 374  SLYTYEGTMILHNNRI-PLSPDQILLRGATLRNTVWIFGIVIFTGHETKLTRNATATPIK 432
            +++ + G +   +    PLS D  L     L +T +  G V++TG +T+   N T   +K
Sbjct: 354  AIHNFLGKVTYKDTSSNPLSIDNTLWANTVLASTGFCIGCVVYTGRDTRQAMNTTTATVK 413

Query: 433  RTAVERVIN----LQIVALFGVLICLSLISSFGNLIVMYNQKENLSYLYLQGTNMVALFF 488
               +E  IN    +   ++F + I L + + F N                      + ++
Sbjct: 414  TGLLELEINSISKILCASVFALSIILVVFAGFHN----------------------SDWY 451

Query: 489  KNILTFWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLVEELG 548
             +++ + ILFS ++P+SL V +++ K   A+ I       H+++   T+VRTS++ E+LG
Sbjct: 452  LDVMRYLILFSTIIPVSLRVNLDLAKSVYAHQIE------HDDTIPETIVRTSTIPEDLG 505

Query: 549  QIEYIFSDKTGTLTQNVMEFKSCSIAGRCYIQSIPEDKDAAFDEGIEVGYRTYDDMHELL 608
            +IEY+ SDKTGTLTQN M+ K   +    Y     +      D  +            + 
Sbjct: 506  RIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVDALVNSSNSANPSGKSVP 565

Query: 609  HTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPDEGALVQGAADLGYKFIIR 668
             T      A + + +  L+ICH V P F E+  + YQAASPDE A+V+    +G     R
Sbjct: 566  STSRKDLSARVRDMVVTLAICHNVTPTF-EDDELTYQAASPDEIAIVKFTESVGLSLFKR 624

Query: 669  KPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPD-NSIRLLCKGADTVILERL 727
              +S+++L       + YE+L +  FNS  KRM  I      +    + KGADTV + R+
Sbjct: 625  DRHSISLLHGHSGSILTYEILQVFPFNSDSKRMGIIVHDEQKDEYWFMQKGADTV-MARI 683

Query: 728  AATSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATTMHNRSEELD 787
               ++     T     + A EGLRTL +  + +  + Y+++ K YD A+ +M NR ++++
Sbjct: 684  VENNDWLEEET----GNMAREGLRTLVVGRKKLSRNIYDQFKKDYDDASLSMVNRDQQMN 739

Query: 788  KV-AEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCK 846
             V  + +E  L LLG T +EDKLQ+ V  +I  L+ AGIK+W+LTGD+ ETA  + +S K
Sbjct: 740  AVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAK 799

Query: 847  LLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLGFALEPDL 906
            L+S    + I+ + TK     N ++ L+ +N             L+IDG+SLG  L    
Sbjct: 800  LISRGQYVHIITKLTKPEGALNQLEYLK-VNKGA---------CLLIDGESLGMFLRYYK 849

Query: 907  EEFLLAIGKMCR-AVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGV 965
             EF   +  +C   V+ CR +P QKA V  +++  T   +  IGDG NDVSMIQ A VGV
Sbjct: 850  REFFDVV--ICLPTVVACRCTPQQKADVALVIREFTGKRVCCIGDGGNDVSMIQCADVGV 907

Query: 966  GISGMEGMQAARSADFALGQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWY 1025
            GI G EG QA+ +ADF++ +F +L +LLL HG  SY+R ++   +  ++ + + + Q  Y
Sbjct: 908  GIVGKEGKQASLAADFSITEFCHLTELLLWHGRNSYKRSAKLAQFIMHRGLVIAICQAVY 967

Query: 1026 VLYNAFSGQSIMESWTLTFYNWGGTAAP 1053
             + + F    + + + +  Y    T AP
Sbjct: 968  SICSKFEPIGLYQGFLMVGYATCYTMAP 995

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score =  397 bits (1021), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 285/868 (32%), Positives = 445/868 (51%), Gaps = 64/868 (7%)

Query: 194  YGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRFXXXXXXXXX 253
            Y  N IS  KYN  TF+P  L+++F  + NL+FL  ++ Q +P +               
Sbjct: 166  YPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFV 225

Query: 254  XXXSAIKESVEDLKRSNSDKELNHSRADVYSDEMGQFISKKWIDIAVGDIIRVRSEEAIP 313
               +  KE+++D++R   DKE N+   +V +    Q +  K  D+ VGD+I++     IP
Sbjct: 226  LMVTMSKEAMDDIQRRQRDKESNNELYEVLNK--AQLVPSK--DLKVGDLIKIHKGTRIP 281

Query: 314  ADLIVLSSSEPEGLCYIETANLDGETNLKIKQARPETSKILDVRELSAMRGKILSEQPNT 373
            ADL++L SSEP G  +I+T  LDGET+ K++ A   T  +     L+ +   I +  P  
Sbjct: 282  ADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACSLTQNLSTDDLLNKI--SITASSPEK 339

Query: 374  SLYTYEGTMILHNNRI-PLSPDQILLRGATLRNTVWIFGIVIFTGHETKLTRNATATPIK 432
            S++ + G +   ++    LS D  +     L +     G V++TG +T+   N T + +K
Sbjct: 340  SIHRFLGKLTYKDSSSNALSVDNTMWANTVLASVGSCIGCVVYTGTDTRQAMNTTMSSVK 399

Query: 433  RTAVERVIN----LQIVALFGVLICLSLISSFGNLIVMYNQKENLSYLYLQGTNMVALFF 488
               +E  IN    +    +F + I L   + FGN       K+               ++
Sbjct: 400  TGLLELEINSLSKILCACVFVLSIVLVAFAGFGN-------KD---------------WY 437

Query: 489  KNILTFWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLVEELG 548
             +I+ + ILFS ++P+SL V +++ K   A  I       H+ +   T+VRTS++ E+LG
Sbjct: 438  VDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIE------HDATIPDTIVRTSTIPEDLG 491

Query: 549  QIEYIFSDKTGTLTQNVMEFKSCSIAGRCYIQSIPEDKDAAFDEGIE-VGYRTYDDMHEL 607
            +IEY+ SDKTGTLTQN M+ K   +    Y     +  D   D   E V   T   M + 
Sbjct: 492  RIEYLLSDKTGTLTQNDMQLKKLHLGTVSYTM---DTMDIVTDYVQELVSSSTTTPMPQ- 547

Query: 608  LHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPDEGALVQGAADLGYKFII 667
              T        + + +  L+ICH V P F E+G + YQAASPDE A+V+    +G     
Sbjct: 548  -STAKKDLPNRVRDLVVTLAICHNVTPTF-EDGELTYQAASPDEIAIVKFTESVGLSLFK 605

Query: 668  RKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAI-FRFPDNSIRLLCKGADTVILER 726
            R  +SV++  +       Y++L +  FNS  KRM  I +         + KGADTV + R
Sbjct: 606  RDRHSVSLFHQHSATNFEYDILQVFPFNSDTKRMGIIVYDKVKGEHWFMQKGADTV-MAR 664

Query: 727  LAATSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATTMHNRSEEL 786
            +   SN ++   + ++   A EGLRTL I  + +    YE++ K Y  A+ +M NR E +
Sbjct: 665  IVQ-SNDWLDEEVGNM---AREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETM 720

Query: 787  DKV-AEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAINIGMSC 845
              V  + +E  L LLG T +EDKLQ+ V  +I  L+ AG+K+W+LTGD+ ETA  + +S 
Sbjct: 721  SSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISA 780

Query: 846  KLLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLGFALEPD 905
            KL+S    +  V + ++     N ++ L+ IN             L+IDG+SLG  L   
Sbjct: 781  KLISRGQYVHTVTKLSRPEGALNALEYLK-INKSS---------CLLIDGESLGMFLTYY 830

Query: 906  LEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGV 965
             +EF   +  +  AVI CR +P QKA V  +++  T   +  IGDG NDVSMIQ A VGV
Sbjct: 831  KQEFFDIVVDL-PAVIACRCTPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGV 889

Query: 966  GISGMEGMQAARSADFALGQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWY 1025
            GI G EG QA+ +ADF++ QF +L KLLL HG  SY+R ++   +  ++ + + + Q  Y
Sbjct: 890  GIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIHRGLIISVCQAVY 949

Query: 1026 VLYNAFSGQSIMESWTLTFYNWGGTAAP 1053
             + + F   ++ + W +  Y    T AP
Sbjct: 950  SVCSKFEPIALYQGWLMVGYATCYTMAP 977

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, hypothetical start
          Length = 1144

 Score =  397 bits (1019), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 280/863 (32%), Positives = 453/863 (52%), Gaps = 51/863 (5%)

Query: 194  YGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRFXXXXXXXXX 253
            +  N +S  KYNA TFLP  L+++F  + NL+FL  ++ Q +P +               
Sbjct: 164  FPSNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYVVPLAFV 223

Query: 254  XXXSAIKESVEDLKRSNSDKELNHSRADVYSDEMGQFISKKWIDIAVGDIIRVRSEEAIP 313
               +  KE+ +D++R   D+E N    +V    +G+       D+ VGD+I++     +P
Sbjct: 224  LTVTMAKEASDDIQRRRRDRESNMELYEV----LGRPRPVASKDLKVGDLIKISKGARVP 279

Query: 314  ADLIVLSSSEPEGLCYIETANLDGETNLKIKQARPETSKILDVRELSAMRGKILSEQPNT 373
            ADLI+L SSEP G  +I+T  LDGET+ K++ A   T  + +   L  +   I +  P  
Sbjct: 280  ADLILLQSSEPSGEAFIKTDQLDGETDWKLRIACTLTQNLNEDDLLEKI--TITASAPEK 337

Query: 374  SLYTYEGTMILHN-NRIPLSPDQILLRGATLRNTVWIFGIVIFTGHETKLTRNATATPIK 432
            S++++ G +   + N   L+ D  L     L ++ +  G VI+TG +T+   N T+  +K
Sbjct: 338  SIHSFLGRVTYKDTNTSGLTIDNTLWANTVLASSGFCIGCVIYTGRDTRQAMNTTSAKVK 397

Query: 433  RTAVERVINLQIVALFGVLICLSLISSFGNLIVMYNQKENLSYLYLQGTNMVALFFKNIL 492
               +E  IN     L   +  LS+      L+V++    N  +            + +I+
Sbjct: 398  TGLLELEINDISKILCACVFILSI------LLVVFAGLHNDDW------------YVDIM 439

Query: 493  TFWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLVEELGQIEY 552
             + ILFS ++P+SL V +++ K   A+ I       H+++   T+VRTS++ E+LG+IEY
Sbjct: 440  RYLILFSTIIPVSLRVNLDLAKSVYAHQIE------HDKTIPETIVRTSTIPEDLGRIEY 493

Query: 553  IFSDKTGTLTQNVMEFKSCSIAGRCYIQSIPEDKDAAFDEGIEVGYRTYDDMHELLHTPG 612
            + SDKTGTLTQN M+ K   +    Y     +         IE    +  ++     T  
Sbjct: 494  LLSDKTGTLTQNDMQLKKVHLGNVSYTTETADIVSDYIQGMIESKNDSVTNLGPRSTTRK 553

Query: 613  SGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPDEGALVQGAADLGYKFIIRKPNS 672
                 +ID  +T L+ICH V P F E+  + YQAASPDE A+V+    +G     R  +S
Sbjct: 554  DAATHVID-LITTLAICHNVTPTF-EDDELTYQAASPDEIAIVKFTESVGLSLFKRDRHS 611

Query: 673  VTILREDITEEVVYELLNICEFNSTRKRMSAI-FRFPDNSIRLLCKGADTVILERLAATS 731
            +++L E     + Y++L +  FNS  KRM  I +    +    L KGADTV + R+ A +
Sbjct: 612  MSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDKQKDQYWFLQKGADTV-MNRIVANN 670

Query: 732  NPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATTMHNRSEEL-DKVA 790
            +     T     + A EGLRTL I  + + +  YE++ K Y+  + +M+NR +E+ + ++
Sbjct: 671  DWLEEET----GNMAREGLRTLVIGRKKLTKKIYEQFKKEYEEVSASMYNREQEMANTIS 726

Query: 791  EMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSE 850
            + +E  L LLG T +EDKLQ  V  +I  L+ AGIK+W+LTGD+ ETA  + +S KL+S 
Sbjct: 727  KYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISR 786

Query: 851  DMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLGFALEPDLEEFL 910
               + +V + +K     N ++ L+ +N +           L+IDG+SLG  L+   +EF 
Sbjct: 787  GQYVHVVTKLSKPEGAFNQLEYLK-VNKNA---------CLLIDGESLGMFLKYYRQEFF 836

Query: 911  LAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGM 970
              +  +   VI CR +P QKA V  +++  T   +  IGDG NDVSMIQ A VGVGI G 
Sbjct: 837  DVVVHL-PTVIACRCTPQQKADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGK 895

Query: 971  EGMQAARSADFALGQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVLYNA 1030
            EG QA+ +ADF++ QF +L +LLL HG  SY+R ++   +  ++ + + + Q  + + + 
Sbjct: 896  EGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFSVCSQ 955

Query: 1031 FSGQSIMESWTLTFYNWGGTAAP 1053
            F   ++ + W +  Y    T AP
Sbjct: 956  FEPIALYQGWLMVGYATCYTMAP 978

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..548354)
            [3501 bp, 1166 aa]
          Length = 1166

 Score =  394 bits (1012), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 287/877 (32%), Positives = 456/877 (51%), Gaps = 81/877 (9%)

Query: 194  YGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRFXXXXXXXXX 253
            Y  N IS  KYNA TFLP  L+++F  + NL+FL  S+ Q +P +               
Sbjct: 188  YPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFLLVSLSQSIPALRIGYLSSYIVPLAFV 247

Query: 254  XXXSAIKESVEDLKRSNSDKELNHSRADVYSDEMGQFISKKWIDIAVGDIIRVRSEEAIP 313
               +  KE+++D++R   D+E N+   +V ++   Q +  K  ++ VGD++++  +  IP
Sbjct: 248  LVVTMSKEAMDDIQRRRRDRETNNELYEVLNN--SQLVPSK--NLRVGDLVKLHKDSRIP 303

Query: 314  ADLIVLSSSEPEGLCYIETANLDGETNLKIKQARPETSKILDVRELSAMRGKILSEQPNT 373
            AD+I+L SSEP G  +++T  LDGET+ K++ A   T  +     L+ +   I +  P  
Sbjct: 304  ADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNLTQDEMLTKVH--ITASAPEK 361

Query: 374  SLYTYEGTMILHNNRIPLSPDQILLRGATLRNTVWIFGIVIFTGHETKLTRNATATPIKR 433
            S++ + G +    +  PLS D  L     L ++      VI+TG +T+   N + + +K 
Sbjct: 362  SIHMFTGKLTYKGSSAPLSVDNTLWANTVLASSGTCVACVIYTGTDTRQAMNTSKSSVKT 421

Query: 434  TAVERVINLQIVALFGVL-ICLSLISSFGNLIVMYNQKENLSYLYLQGTNMVALFFKNIL 492
              +E    L+I +L  +L IC+  +S    L+V+    ++  Y+             +I+
Sbjct: 422  GLLE----LEINSLSKILCICVFTLSIL--LVVIGGLDDDKWYV-------------DIM 462

Query: 493  TFWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLVEELGQIEY 552
             + ILFS ++P+SL V +++ K   A  I SD      +S   T+VRTS++ E+LG+IEY
Sbjct: 463  RYLILFSTIIPVSLRVNLDLGKSVYARQIESD------KSIPDTIVRTSTIPEDLGRIEY 516

Query: 553  IFSDKTGTLTQNVMEFKSCSIAGRCYIQSIPEDKDAAFDEGIEVGYRTYDDMHELLHTP- 611
            + SDKTGTLTQN M+ +   +    Y     E  D               D  + L +P 
Sbjct: 517  LLSDKTGTLTQNDMQLRKIHLGTVSYTM---ETMDMV------------TDYIQTLTSPA 561

Query: 612  --GSGDGAI----------IDEFLTLLSICHTVIPEFQENGSIKYQAASPDEGALVQGAA 659
              G+   A+          + + +  L+ CH V P F++N  + YQAASPDE A+V+   
Sbjct: 562  NMGAAGVAVTGSRKEVSQRVRDLVVTLATCHNVTPNFEDN-ELAYQAASPDEIAIVKFTE 620

Query: 660  DLGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFR-FPDNSIRLLCKG 718
             +G     R  +S+T+  E     + Y++L++  F S  KRM  I R    N I  L KG
Sbjct: 621  RVGLSLFKRDRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKNEIWFLQKG 680

Query: 719  ADTVILERLAATSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATT 778
            ADTV+ +     SN ++      + + A EGLRTL IA + +    YE++SK Y  A+ +
Sbjct: 681  ADTVMSK--IVQSNDWLE---EEVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLS 735

Query: 779  MHNRSEELDKVAE-MIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQET 837
            M NR E +++V +  +E  L LLG T +EDKLQ  V  +I  L+ AG+K+W+LTGD+ ET
Sbjct: 736  MLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVET 795

Query: 838  AINIGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKS 897
            A  + +S KL+S       V+  TK + R+  + +L  +  ++ S        L+IDG S
Sbjct: 796  ARCVCVSAKLISRGQ---YVHTITKLTRRDGALSRLEYLKANRNS-------CLLIDGDS 845

Query: 898  LGFALEPDLEEFLLAIGKMCR-AVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVS 956
            L   +     EF   +  +C   VI CR +P QKA V  +++  T   +  IGDG NDVS
Sbjct: 846  LAIYMSHYRAEFFEIV--ICLPVVIACRCTPQQKADVALLIREMTGKRVCCIGDGGNDVS 903

Query: 957  MIQAAHVGVGISGMEGMQAARSADFALGQFKYLKKLLLVHGSWSYQRISQAILYSFYKNI 1016
            MIQ A VGVGI G EG QA+ +AD+++ QF +L KLLL HG  SY+R ++   +  ++ +
Sbjct: 904  MIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLLWHGRNSYKRSAKLSQFVIHRGL 963

Query: 1017 ALYMTQFWYVLYNAFSGQSIMESWTLTFYNWGGTAAP 1053
             + + Q  Y + +     ++ + W +  Y    T AP
Sbjct: 964  LISVCQAVYSISSNLKPIALYQGWLMVGYATCYTMAP 1000

>KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, start by similarity
          Length = 1148

 Score =  393 bits (1009), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 279/867 (32%), Positives = 443/867 (51%), Gaps = 64/867 (7%)

Query: 194  YGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRFXXXXXXXXX 253
            Y  N IS  KYN  TF+P  L+++F  + NL+FL  ++ Q +P +               
Sbjct: 173  YPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSYIVPLAFV 232

Query: 254  XXXSAIKESVEDLKRSNSDKELNHSRADVYSDEMGQFISKKWIDIAVGDIIRVRSEEAIP 313
               +  KE+++D+ R   D+E N+   +V +      I  K  D+ VGDII+++    +P
Sbjct: 233  LTVTMSKEAMDDINRRKRDREANNELYEVVNKPCP--IPSK--DLKVGDIIKLKKGARVP 288

Query: 314  ADLIVLSSSEPEGLCYIETANLDGETNLKIKQARPETSKILDVRELSAMRGKILSEQPNT 373
            AD++VL ++EP G  +I+T  LDGET+ K++ A   T  + +   L+ +   I +  P  
Sbjct: 289  ADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLTQSLTENDLLNNI--TITASAPEH 346

Query: 374  SLYTYEGTMILHNN-RIPLSPDQILLRGATLRNTVWIFGIVIFTGHETKLTRNATATPIK 432
            S++ + G +   ++   PLS D  +     L ++      +++TG ET+   N T +  K
Sbjct: 347  SIHNFLGKITYKDSTSSPLSVDNTMWENTVLASSAACICCIVYTGRETRQALNTTKSKAK 406

Query: 433  RTAVERVINLQIVALFGVLI-CLSLISSFGNLIVMYNQKENLSYLYLQGTNMVALFFKNI 491
               +E    L+I  L  +L  C+ L+S        +N  +               ++ +I
Sbjct: 407  TGLLE----LEINGLSKILCACVFLLSIMLVAFAGFNNND---------------WYVDI 447

Query: 492  LTFWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLVEELGQIE 551
            + + ILFS ++P+SL V +++ K   AY I       H++    T+VRTS++ E+LG+IE
Sbjct: 448  MRYLILFSTIIPVSLRVNLDLGKSVYAYKIE------HDKQIEDTIVRTSTIPEDLGRIE 501

Query: 552  YIFSDKTGTLTQNVMEFKSCSIAGRCYIQSIPEDKDAAFDEGIEVGYRTYDDMHELLHTP 611
            Y+ SDKTGTLTQN M+ K   +    Y     E  D   D    +  RT +       TP
Sbjct: 502  YLLSDKTGTLTQNDMQLKKIHLGTVSYTN---ETMDIVTDFIQSMNSRTSNS------TP 552

Query: 612  GSGDGAIID---EFLTLLSICHTVIPEFQENGSIKYQAASPDEGALVQGAADLGYKFIIR 668
             +    I D   + +T L+ICH V P F E+G + YQAASPDE A+V+    +G     R
Sbjct: 553  TTTRKNISDRVIDLVTTLAICHNVTPTF-EDGELTYQAASPDEIAIVKFTESVGLSLFRR 611

Query: 669  KPNSVTILREDITEEVVYELLNICEFNSTRKRMSAI-FRFPDNSIRLLCKGADTVILERL 727
              +S+++  +    ++ Y++  +  FNS  KRM  I F         L KGADTV+    
Sbjct: 612  DRHSISLFHDHSGMKLEYDIKILFPFNSDSKRMGVIIFDKLKQEYWFLQKGADTVMSS-- 669

Query: 728  AATSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATTMHNRSEELD 787
                N ++        + A EGLRTL I  + +  + +E++ K Y  A+ TM +R   + 
Sbjct: 670  IVVRNDWLE---EETSNMATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQ 726

Query: 788  KVA-EMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCK 846
             V  + +E  L LLG T +EDKLQ  V  +I  L+ AGIK+W+LTGD+ ETA  + +S K
Sbjct: 727  NVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAK 786

Query: 847  LLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLGFALEPDL 906
            L+S    +  V +  K     + ++ L      Q++Q       L+IDG+SLG  L+   
Sbjct: 787  LISRGQYVHTVTKVNKPEGALHHLEYL------QVNQNS----CLLIDGESLGLYLQYFP 836

Query: 907  EEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVG 966
            +EF   +  +   V+ CR +P QKA V   +++ T   +  IGDG NDVSMIQ A VGVG
Sbjct: 837  DEFFDIVVNL-PTVVACRCTPQQKADVAVFIRQATGKRVCCIGDGGNDVSMIQCADVGVG 895

Query: 967  ISGMEGMQAARSADFALGQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYV 1026
            I G EG QA+ +ADF++ QF +L KLLL HG  SY+  ++   +  ++ + + + Q  Y 
Sbjct: 896  IVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAKLSQFVIHRGLIISVCQAVYS 955

Query: 1027 LYNAFSGQSIMESWTLTFYNWGGTAAP 1053
            + + F   ++ + W +  Y    T AP
Sbjct: 956  ICSMFEPLALYQGWLMVGYATCYTMAP 982

>Kwal_23.5789
          Length = 1133

 Score =  382 bits (982), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 284/869 (32%), Positives = 446/869 (51%), Gaps = 67/869 (7%)

Query: 194  YGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRFXXXXXXXXX 253
            Y  N IS  KYN  TF+PK L+++F  + NL+FL  ++ Q +P +               
Sbjct: 156  YAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFV 215

Query: 254  XXXSAIKESVEDLKRSNSDKELNHSRADVYSDEMGQFISKKWIDIAVGDIIRVRSEEAIP 313
               +  KE+++D++R   D+E N+   +V S    Q +  K  D+ VGD+I++      P
Sbjct: 216  LTVTMSKEALDDIQRRRRDRESNNELYEVLSK--SQLVPSK--DLKVGDLIKIGKGARAP 271

Query: 314  ADLIVLSSSEPEGLCYIETANLDGETNLKIKQARPETSKILDVRELSAMRGKILSEQPNT 373
            ADL++L SSEP G  +I+T  LDGET+ K++ A P T  +     L   R  I +  P  
Sbjct: 272  ADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIACPLTQHLSQDDLL--YRISITASVPEK 329

Query: 374  SLYTYEGTMILHN-NRIPLSPDQILLRGATLRNTVWIFGIVIFTGHETKLTRNATATPIK 432
            S+  + G +        PLS D  +       +       V++TG +T+   N + + +K
Sbjct: 330  SINNFLGKLTFGEIQSQPLSVDNTMWANTVFASAGTAIACVVYTGADTRQAMNTSMSSVK 389

Query: 433  RTAVERVINLQIVALFGVLI-CLSLISSFGNLIVMYNQKENLSYLYLQGTNMVALFFKNI 491
               +E    L+I +L  +L  C+ ++S        +N  +               ++ +I
Sbjct: 390  TGLLE----LEINSLSKILCACVFILSVALVAFAGFNNND---------------WYVDI 430

Query: 492  LTFWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMP-TVVRTSSLVEELGQI 550
            + + ILFS ++P+SL V +++ K   A+ I  D       S +P T+VRTS++ E+LG+I
Sbjct: 431  MRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHD-------STIPETIVRTSTIPEDLGRI 483

Query: 551  EYIFSDKTGTLTQNVMEFKSCSIAGRCYIQS---IPEDKDAAFDEGIEVGYRTYDDMHEL 607
            EY+ SDKTGTLTQN ME K   +    Y      I  D   A  + +           +L
Sbjct: 484  EYLLSDKTGTLTQNDMELKKLHLGTVSYTMDTMDIVTDYVRAMSDNLNSSAVPSASKKDL 543

Query: 608  LHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPDEGALVQGAADLGYKFII 667
               PG      + + +  L++CH V P F E+G + YQAASPDE A+V+    +G     
Sbjct: 544  ---PGR-----VRDLVLTLALCHQVTPTF-EDGELTYQAASPDEIAIVKFTESVGLTLFR 594

Query: 668  RKPNSVTILREDITEEVVYELLNICEFNSTRKRMS-AIFRFPDNSIRLLCKGADTVILER 726
            R  +S+T+L +       Y++L++  FNS  KRM   IF    +    L KGAD V++ +
Sbjct: 595  RDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVIFDKQKDEYWFLQKGAD-VVMSK 653

Query: 727  LAATSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATTMHNRSEEL 786
            +    N ++     +L   A EGLRTL I  + + +   + ++K Y+ A+  M NR   +
Sbjct: 654  IVQ-KNDWLEEETGNL---AREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTM 709

Query: 787  DKV-AEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAINIGMSC 845
              V ++ +E  L +LG T +EDKLQ+ V  +I  L+ AGIK+W+LTGD+ ETA  + +S 
Sbjct: 710  SNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSISA 769

Query: 846  KLLSEDMNLLIVNEDTK-ESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLGFALEP 904
            KL+S    +  V +  K E    +L  +L  IN +           L+IDG+SLG  LE 
Sbjct: 770  KLVSRGQYVHTVTKVNKPEGALTHL--ELLKINTNS---------CLLIDGESLGLYLEY 818

Query: 905  DLEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVG 964
              ++F   +  +  AVI CR +P QKA V   ++  T   +  IGDG NDVSMIQ+A VG
Sbjct: 819  YRQQFFEIVVNL-PAVIACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVG 877

Query: 965  VGISGMEGMQAARSADFALGQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFW 1024
            VGI G EG QA+ +ADF++ QF +L KLLL HG  SY+R ++   +  ++ + + + Q  
Sbjct: 878  VGIVGKEGKQASLAADFSITQFCHLSKLLLWHGRNSYKRSAKLAQFVIHRGLLISVCQAV 937

Query: 1025 YVLYNAFSGQSIMESWTLTFYNWGGTAAP 1053
            Y + + F   ++ + W +  Y    T AP
Sbjct: 938  YSISSKFEPIALYQGWLMVGYATCYTMAP 966

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score =  299 bits (765), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 191/539 (35%), Positives = 295/539 (54%), Gaps = 36/539 (6%)

Query: 725  ERLAATSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATTMHNRSE 784
            E+L       +  TL  +++++ EGLRTL  + + IP  EY+ W   Y  A T++ NRS 
Sbjct: 927  EKLIKNEEFILEKTLNAIDEFSTEGLRTLLYSYKWIPAEEYKAWEAKYHEAKTSLTNRST 986

Query: 785  ELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAINIGMS 844
            ++ +V   IE  L LLGATAIEDKLQ+GVPE I  +++AGIK+W+LTGD++ETAINIG +
Sbjct: 987  QIAEVGGHIETDLELLGATAIEDKLQEGVPEAIQKIRRAGIKMWMLTGDKRETAINIGYA 1046

Query: 845  CKLLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLG-FALE 903
            CKL+ +   ++I+ ++      +NLI K+ A+ + ++    +    LVIDG SL  F   
Sbjct: 1047 CKLIYDYSTVVILKKND-----DNLISKMTALGE-ELDTGKIAHCVLVIDGASLAVFENN 1100

Query: 904  PDLEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLL-LAIGDGANDVSMIQAAH 962
            P +    + +     +VICCR SP QKAL+V  ++ + K L+ LAIGDGAND++MIQ+A 
Sbjct: 1101 PTMMSVFIELCTKTDSVICCRASPSQKALIVTNIRLKNKDLVTLAIGDGANDIAMIQSAD 1160

Query: 963  VGVGISGMEGMQAARSADFALGQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQ 1022
            +GVGI+G EG+QA+RS+D+++ QF+YL KLL VHG ++Y R S+ +L +FYK +  Y+TQ
Sbjct: 1161 IGVGITGKEGLQASRSSDYSIAQFRYLLKLLFVHGRYNYVRTSKFVLCTFYKEVLFYLTQ 1220

Query: 1023 FWYVLYNAFSGQSIMESWTLTFYNWGGTAAPPGPPKRRDQFERSGLLNRDAQSCTVGQKG 1082
              Y     FSG S+ E W+L+ +N   T+ P       ++  +   L    +  T+GQK 
Sbjct: 1221 MIYQRQTMFSGTSLYEPWSLSMFNTLFTSLPVICIGMFEKDLKPMTLLAVPELYTMGQKC 1280

Query: 1083 QFWPATIFRGSAINGNYHNWITIDGWIMDYRYGAAGAMHGETA--DHWVWGVA-IQPTSI 1139
            Q +   IF           W+     I          + G TA  D+ ++ +  I  TSI
Sbjct: 1281 QAFNLKIFLV---------WMLTAAGISVLITFLNFEIWGFTAQSDNSIYPIGVINFTSI 1331

Query: 1140 IFVLG-KAALITNQ---WTKFTVLAIPGSLVFWLLFFPIYAYLLPGLNVSKEYYGIVSHV 1195
             F++  K   I  +   W  F  L I  S + W+L    +  LLPG+      Y ++  +
Sbjct: 1332 CFLINVKCQFIETRNRNWLAFASLLI--SCIGWIL----WCCLLPGIYGENAIYDVLIGL 1385

Query: 1196 YGSF----TFWAMCYVXXXXXXXXXXXWKYYKRTYTPESYHVVQEMQKYDISDNRPRIE 1250
            Y  F    T+WA C +            + ++    P    +  E+++ D  D R ++E
Sbjct: 1386 YHQFGRDITWWASCLILIMFPMMIDIVCQTFRAMIWPTDGDIFAELEQKD--DIRKKLE 1442

 Score =  236 bits (603), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 152/446 (34%), Positives = 230/446 (51%), Gaps = 61/446 (13%)

Query: 194 YGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRFXXXXXXXXX 253
           Y DN I++++Y   +FLP+ L+ +FSK AN +FL  +I+Q +P+ + T  +         
Sbjct: 116 YRDNVITSSRYTVYSFLPRQLYAQFSKLANAYFLLVAILQMIPSWSTTGTYTTIVPLSIF 175

Query: 254 XXXSAIKESVEDLKRSNSDKELN------------------------------------- 276
              S  +E+ +D KR   DKE N                                     
Sbjct: 176 LSISMAREAWDDFKRHRLDKEENNKSTKVLTMGKDHDELESDSIYSLSNVSARSTDAILS 235

Query: 277 -----HSRADV----YSDEM-------GQF---ISKK-WIDIAVGDIIRVRSEEAIPADL 316
                H+  DV    Y+D          QF   I KK W D+ VG+ + + S++ +PAD+
Sbjct: 236 DFNSMHNLNDVTEPSYTDHFTNLNLLRSQFDIHIKKKEWKDLKVGEFVLLNSDDWVPADI 295

Query: 317 IVLSSSEPEGLCYIETANLDGETNLKIKQARPETSK-ILDVRELSAMRGKILSEQPNTSL 375
           ++LS+       ++ET  LDGETNLK K   PE +K +     LS        E PN  L
Sbjct: 296 LLLSTDGENNEAFVETMALDGETNLKSKNPLPELAKRMTSATGLSMHSATTTLEDPNNDL 355

Query: 376 YTYEGTMILHNNRIPLSPDQILLRGATLRNTVWIFGIVIFTGHETKLTRNATATP-IKRT 434
           Y +EGT+ +     PL  D ++ RG+ LRNT  I GIVIFTG ETK+  NA   P  K  
Sbjct: 356 YNFEGTVEIDGELYPLGSDNVVYRGSILRNTQSIVGIVIFTGEETKIRMNAIKNPRTKAP 415

Query: 435 AVERVINLQIVALFGVLICLSLISSFGNLIVMYNQKENLSYLYLQGTNMVALFFKNILTF 494
            ++  INL ++ +  V+  +++ S  G  I+  N  +N    YL   +  A     I++F
Sbjct: 416 KLQGKINLIVLFMVFVVAAMAMFSYLGQHILKKNYVDNNRAWYLFQED--AGTAPTIMSF 473

Query: 495 WILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLVEELGQIEYIF 554
            I+++ L+P+SL+VT E+IK  Q+ ++  D+D++H ES+ P   RT++++EELGQ+ YIF
Sbjct: 474 IIMYNTLIPLSLYVTTEIIKAMQSKLMEWDIDMYHIESDTPCESRTATILEELGQVSYIF 533

Query: 555 SDKTGTLTQNVMEFKSCSIAGRCYIQ 580
           SDKTGTLT N M F+  SI G  ++ 
Sbjct: 534 SDKTGTLTDNKMIFRKFSICGSSWLH 559

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/117 (41%), Positives = 71/117 (60%), Gaps = 13/117 (11%)

Query: 622 FLTLLSICHTVIPEFQENG--SIKYQAASPDEGALVQGAADLGYKFIIRKPNSVTILR-- 677
           F+  L++CHT +P+   +G  SI YQ++SPDE ALV  A D+G+    R  ++++I    
Sbjct: 672 FILSLALCHTCLPKKTHDGTDSILYQSSSPDELALVTAARDMGFVVTNRNSSTLSIATYP 731

Query: 678 -----EDITEEVVYELLNICEFNSTRKRMSAIFRFP--DNSIRLLCKGADTVILERL 727
                + I E+  YE+L    F+S RKRMS   + P  D+ + L+CKGAD VILERL
Sbjct: 732 NGFDDQPIVED--YEVLEYINFDSQRKRMSVAVKMPNDDDRVLLICKGADNVILERL 786

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score =  299 bits (766), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 192/566 (33%), Positives = 295/566 (52%), Gaps = 65/566 (11%)

Query: 710  NSIRLLCKGADTVILERLAATSNPYV-AATLRHLEDYAAEGLRTLCIASRTIPESEYEEW 768
            N + L   G+D +I      ++  YV   TL  +E ++ EGLRTL  A + I   ++E+W
Sbjct: 938  NDVLLNYIGSDALI------SNEEYVLEKTLEDIESFSTEGLRTLLFAHKWISNEDFEQW 991

Query: 769  SKLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVW 828
               Y  A T++  R +++D+V   IE  L LLGATAIEDKLQ+GV E I  +++AGIK+W
Sbjct: 992  RTRYHEAKTSLSERKQKIDEVGAQIEDELYLLGATAIEDKLQEGVSEAIEKIRRAGIKMW 1051

Query: 829  VLTGDRQETAINIGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNT 888
            +LTGD++ETAINIG SCKL+ +   ++I+      ++  N+I K+ AI+  ++   ++  
Sbjct: 1052 MLTGDKRETAINIGYSCKLIHDYSTVVILT-----TSDENIISKMNAIS-QEVDSGNVAH 1105

Query: 889  LALVIDGKSLG-FALEPDLEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLL-L 946
              +VIDG +L  F   P L      +     +V+CCR SP QKAL+V  ++   KS++ L
Sbjct: 1106 CVIVIDGATLAMFEDNPTLMSVFTELCTKTDSVVCCRASPAQKALMVSNIRNTDKSIVTL 1165

Query: 947  AIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFALGQFKYLKKLLLVHGSWSYQRISQ 1006
            AIGDGAND++MIQ+A +GVGI+G EG+QA+RSAD+++GQF+++ KLLLVHG ++Y R ++
Sbjct: 1166 AIGDGANDIAMIQSADIGVGIAGKEGLQASRSADYSIGQFRFILKLLLVHGRYNYIRTAK 1225

Query: 1007 AILYSFYKNIALYMTQFWYVLYNAFSGQSIMESWTLTFYNWGGTAAPPGPPKRRDQFERS 1066
             IL +FYK +  Y+TQ  Y  Y  FSG S+ E W+L+ YN   T+ P             
Sbjct: 1226 FILCTFYKELTFYLTQLIYQRYTMFSGTSLYEPWSLSMYNTLFTSLP---------VLCV 1276

Query: 1067 GLLNRDAQSCTVGQKGQFWPATIFRGSAINGNYHNWITIDGWIMDYRYGAAGAMHGETAD 1126
            G+  +D +  T+    + +       +       NW     W+     G A A+     +
Sbjct: 1277 GMFEKDLKPVTLLTVPELYSMGRLSKA------FNWSIFAEWVF---LGTANALIITFLN 1327

Query: 1127 HWVWGVAIQPTSIIFVLG-------------KAALI---TNQWTKFT--VLAIPGSLVFW 1168
               WG      + ++ LG             KA  I      W  FT  +L+  G    W
Sbjct: 1328 IVAWGETSLSDNTLYPLGFVNFSATVALINVKAQFIEMRNRNWLAFTSVILSCGG----W 1383

Query: 1169 LLFFPIYAYLLPGLNVSKEYYGIVSHVYGSF----TFWAMCYVXXXXXXXXXXXWKYYKR 1224
            L    ++   LP LN S   Y +   +Y  F    TFW    +           +K +K 
Sbjct: 1384 L----VWCCALPILNRSDGIYDVTYGLYHHFGRDITFWCTSLILAVLPIIVDVVYKTFKI 1439

Query: 1225 TYTPESYHVVQEMQKYDISDNRPRIE 1250
               P    +  E+++   S+ R ++E
Sbjct: 1440 MLAPSDSDIFAELEQK--SEIRKKLE 1463

 Score =  246 bits (629), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 152/461 (32%), Positives = 243/461 (52%), Gaps = 52/461 (11%)

Query: 193 GYGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRFXXXXXXXX 252
            Y +N I++++Y   +F P+ L+ +FSK AN++F   +I+Q +P  + T  +        
Sbjct: 122 AYCNNLITSSRYTIISFFPRQLYAQFSKLANVYFFIVAILQMIPGWSTTGTYTTIVPLCV 181

Query: 253 XXXXSAIKESVEDLKRSNSDKELN----------HSRAD--------------------- 281
               S  +E+ +D +R   DKE N          H R D                     
Sbjct: 182 FMAISMAREAYDDYRRHKLDKEENNKLTKVLQILHEREDNDLDLENNAQHSANNPESISN 241

Query: 282 VYSDEMG--------QFISKKWIDIAVGDIIRVRSEEAIPADLIVLSSSEPEGLCYIETA 333
           +Y +           + + KKW DI VGD + ++ ++ +PAD+++L+S       +IET 
Sbjct: 242 LYFNNFDLLAKKYNVRIVEKKWKDIRVGDFVLLQQDDWVPADILILTSDGDNSEVFIETM 301

Query: 334 NLDGETNLKIKQARPETSKIL-DVRELSAMRGKILSEQPNTSLYTYEGTMILHN-----N 387
            LDGETNLK K   PE +K+      L+ +  ++  E PN  LY +EG + L++      
Sbjct: 302 ALDGETNLKGKVPHPEINKLTKSASGLANINAQVTVEDPNNDLYNFEGNLELNSGSSSKK 361

Query: 388 RIPLSPDQILLRGATLRNTVWIFGIVIFTGHETKLTRNATATP-IKRTAVERVINLQIVA 446
           + PL PD ++ RG+ +RNT    G+VIFTG E+K+  NA   P  K   ++R IN+ +V 
Sbjct: 362 KYPLGPDNVIYRGSIIRNTRNCVGMVIFTGEESKIRMNALRNPRTKAPKLQRKINMIVVF 421

Query: 447 LFGVLICLSLISSFGNLIVMYNQKENLSYLYLQGTNMVALFFKNILTFWILFSNLVPISL 506
           +  V+ C+SL S  G+ I +     N    YL   +  A     I++F I+++ ++P+SL
Sbjct: 422 MVFVVACMSLFSYLGHTIQIKRYVNNNKAWYLLQED--AGTAPTIMSFIIMYNTIIPLSL 479

Query: 507 FVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLVEELGQIEYIFSDKTGTLTQNVM 566
           +VT+E+IK  Q+ M+  D+D++H ES+ P  VRT++++EELGQ+ YIFSDKTGTLT N M
Sbjct: 480 YVTMELIKVAQSRMMEWDIDMYHAESDTPCAVRTATILEELGQVSYIFSDKTGTLTDNKM 539

Query: 567 EFKSCSIAGRCYI----QSIPEDKDAAFDEGIEVGYRTYDD 603
            F+  S  G  ++    Q I E K A      ++   + DD
Sbjct: 540 LFRKLSFCGTSWVHNATQDISEFKPAQLSNKNDIDVISIDD 580

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 71/118 (60%), Gaps = 12/118 (10%)

Query: 622 FLTLLSICHTVIPEFQENGS-----IKYQAASPDEGALVQGAADLGYKFIIRKPNSVTIL 676
           F+  L+ICH  +P+  E G+     I+YQ++SPDE ALV  A D+GY    R  N +T+ 
Sbjct: 678 FILSLAICHICLPKRTEEGNDEDDIIEYQSSSPDELALVTAARDMGYIVYNRNANILTLK 737

Query: 677 R-----EDITEEVVYELLNICEFNSTRKRMSAIFRFPDNSIRLL--CKGADTVILERL 727
                 +++     +E+L + +FNS RKRMS I R P+   R+L  CKGAD VILERL
Sbjct: 738 TFPDGFDELPRFENFEILELVDFNSQRKRMSVIVRVPEEKDRVLLFCKGADNVILERL 795

>Kwal_23.3556
          Length = 1597

 Score =  297 bits (760), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 180/519 (34%), Positives = 289/519 (55%), Gaps = 38/519 (7%)

Query: 738  TLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGL 797
            TL+ +ED++  GLRTL  + + IP  +YE+WSK Y AA T++ NR E++  V E++E  L
Sbjct: 960  TLQAIEDFSTSGLRTLLYSYKWIPSEDYEKWSKKYHAAKTSLENRKEKMHSVGELVETSL 1019

Query: 798  VLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLLIV 857
             LLGATAIEDKLQ+GV + I  +++AGIK+W+LTGD++ETAINIG SC L+ +   ++I+
Sbjct: 1020 HLLGATAIEDKLQEGVADAIDKIRRAGIKMWMLTGDKRETAINIGYSCNLIHDYSTVVIL 1079

Query: 858  NEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSL-GFALEPDLEEFLLAIGKM 916
            +     +   N+  KL A++  +I + ++    +VIDG +L  F   P L    + +   
Sbjct: 1080 S-----AKDENISSKLTAVS-QEIERGNIAHCVVVIDGSTLTTFESNPTLMSVFVELCTK 1133

Query: 917  CRAVICCRVSPLQKALVVKMVKRRTKSLL-LAIGDGANDVSMIQAAHVGVGISGMEGMQA 975
              +VICCR SP QKAL+V  ++   K L+ LAIGDGAND++MIQ+A +GVGI+G EG+QA
Sbjct: 1134 TDSVICCRASPSQKALMVTHIRNTDKKLVTLAIGDGANDIAMIQSADIGVGIAGKEGLQA 1193

Query: 976  ARSADFALGQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVLYNAFSGQS 1035
            +RS+D+++ QF++L KLLLVHG ++Y R ++ +L +FYK +  Y+TQ  Y  +  FSG S
Sbjct: 1194 SRSSDYSIAQFRFLLKLLLVHGRYNYVRTTKFVLCTFYKELLFYLTQMIYQRHTMFSGTS 1253

Query: 1036 IMESWTLTFYNWGGTAAPPGPPKRRDQFERSGLLNRDAQSCT---------VGQKGQFWP 1086
            + E W+L+ +N   T+ P             G+  +D +  T         +G+  Q + 
Sbjct: 1254 LYEPWSLSMFNTLFTSLP---------VLCIGMFEKDLKPMTLLAIPELYSIGRLSQSFN 1304

Query: 1087 ATIFRGSAINGNYHNWITIDGWIMDYRYGAAGAMHGETADHWVWGVAIQPTSIIFVLGKA 1146
              +F         ++ I      ++++  A  ++    +D+ V+ + +   + I  L   
Sbjct: 1305 LRVFLYWMFLAALNSLIIT---FLNWKIWAVSSL----SDNTVYPIGVINFTAIITLVNV 1357

Query: 1147 ALITNQWTKFTVLAIPGSLVFWLLFFPIYAYLLPGLNVSKEYYGIVSHVYGSF----TFW 1202
                 +     VLAI  SLV  +  + ++  LLPG+      Y +++ +Y  F    TFW
Sbjct: 1358 KCQLLETHNRNVLAI-CSLVISVGGWLLWCCLLPGIYSEDGMYDVLTGLYFQFGNDITFW 1416

Query: 1203 AMCYVXXXXXXXXXXXWKYYKRTYTPESYHVVQEMQKYD 1241
              C V           +K  K    P    +  E+++ D
Sbjct: 1417 CACLVLVVLPLIIDVVFKTVKIMIFPSDSEISMELEQKD 1455

 Score =  230 bits (586), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 123/325 (37%), Positives = 199/325 (61%), Gaps = 10/325 (3%)

Query: 261 ESVEDLKRSNSDKELNHSRADVYSDEMG-QFISKKWIDIAVGDIIRVRSEEAIPADLIVL 319
           ES  +   S +D   +H+  D+   + G + + KKW DI VGD + +  +E +PAD++VL
Sbjct: 235 ESTAEAATSQND---DHTNWDLLKSKYGVEAVEKKWKDIKVGDYVVLEQDEWVPADMLVL 291

Query: 320 SSSEPEGLCYIETANLDGETNLKIKQARPETSKILDVRE-LSAMRGKILSEQPNTSLYTY 378
           + S+ +  C++ET  LDGETNLK KQ   E S+++     L+  + K+  E PN  L+ +
Sbjct: 292 TCSDEKNECFVETMALDGETNLKNKQPLTEVSEVMKTAAGLTEFKAKVTVEDPNIDLHNF 351

Query: 379 EGTMIL--HNNRIPLSPDQILLRGATLRNTVWIFGIVIFTGHETKLTRNATATP-IKRTA 435
           EG + L   N ++ + PD I+ RG+ +RNT    G+V+FTG ETK+  NA   P IK   
Sbjct: 352 EGNLELLGENRKLTIGPDHIIYRGSIIRNTSNAVGMVVFTGEETKIRMNAIKNPRIKAPK 411

Query: 436 VERVINLQIVALFGVLICLSLISSFGNLIVMYNQKENLSYLYLQGTNMVALFFKNILTFW 495
           ++R INL ++ +  V+  ++L S  G  I+     +N    YL  ++  A     +++F 
Sbjct: 412 LQRAINLIVLFMVFVVASMALFSLLGQRIIKKKYVDNNRAWYLFNSD--AGLAPTVMSFI 469

Query: 496 ILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLVEELGQIEYIFS 555
           I+++ L+P+SL+VT+E+IK  Q+ ++  D+D++H E+N P   RT++++EELGQ+ YIFS
Sbjct: 470 IMYNTLIPLSLYVTMEIIKAMQSKLMEWDIDMYHAETNTPCESRTATILEELGQVSYIFS 529

Query: 556 DKTGTLTQNVMEFKSCSIAGRCYIQ 580
           DKTGTLT N M F++ S+ G  +I 
Sbjct: 530 DKTGTLTDNKMVFRALSVCGSSWIH 554

 Score = 87.4 bits (215), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 73/130 (56%), Gaps = 11/130 (8%)

Query: 609 HTPGSGDGAIIDEFLTLLSICHTVIPE----FQENGSIKYQAASPDEGALVQGAADLGYK 664
             P +     +  F+  L++CH  +P+     +    ++YQA+SPDE ALV  A D+GY 
Sbjct: 655 QNPNTHFAKKVSFFILSLALCHACLPKSSSGVEGEDCVEYQASSPDELALVTAARDMGYA 714

Query: 665 FIIRKPNSVTILRE----DITEEV-VYELLNICEFNSTRKRMSAIFRFP--DNSIRLLCK 717
            + R  + +TI       D    +  YE+LN  EF+S RKRMS + R P  +N I L+CK
Sbjct: 715 VMNRNSDVLTIKTYPNGFDAEPHLDKYEILNNIEFSSHRKRMSVLVRLPHEENRILLICK 774

Query: 718 GADTVILERL 727
           GAD VILERL
Sbjct: 775 GADNVILERL 784

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 69/158 (43%), Gaps = 22/158 (13%)

Query: 144 GDRYQRSRNKFNLKALFDHYVLRKPAAADTGAGEPRVIYINERRANGAMGYGD------- 196
           GDR+ +  +K      F ++VLR+     T AG    + +N   +   M  GD       
Sbjct: 42  GDRWGQLVDK---AENFAYWVLRRKQQKHTKAGRVIPLCLNHEDSFYRMFTGDGGSQTAK 98

Query: 197 ------------NHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRF 244
                       N I++++Y   TFLP+ L+ +FS+ AN +F   +++Q +P  + T  +
Sbjct: 99  LTDERSGKPYISNLITSSRYTIYTFLPRQLYAQFSRLANAYFFLVAVLQMIPGWSTTGTY 158

Query: 245 XXXXXXXXXXXXSAIKESVEDLKRSNSDKELNHSRADV 282
                       S  +E+ +D +R   D+E N   A V
Sbjct: 159 TTIVPLLIFMGISMSREAWDDFRRHKLDREENDKTARV 196

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of the
            Drs2p-like family of the P-type ATPase superfamily of
            membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score =  290 bits (742), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 193/575 (33%), Positives = 299/575 (52%), Gaps = 61/575 (10%)

Query: 707  FPDNSIRL------LCKGADTVILERLAAT----SNPYVAA-TLRHLEDYAAEGLRTLCI 755
            FP+N++ +      L    DT ILE + +     +  YV   TL+ +++++ EGLRTL  
Sbjct: 979  FPNNNVPIDTRKEGLQHDYDTEILEHIGSDELILNEEYVIERTLQAIDEFSTEGLRTLVY 1038

Query: 756  ASRTIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPE 815
            A + I   +YE W+K Y  A T++ +R  ++D+    IE GL LLG TAIEDKLQDGV E
Sbjct: 1039 AYKWIDIGQYENWNKRYHQAKTSLTDRKIKVDEAGAEIEDGLNLLGVTAIEDKLQDGVSE 1098

Query: 816  TIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKLRA 875
             I  +++AGIK+W+LTGD++ETAINIG SC L+ +   ++I+      +T  N+I K+ A
Sbjct: 1099 AIEKIRRAGIKMWMLTGDKRETAINIGYSCMLIKDYSTVVILT-----TTDENIISKMNA 1153

Query: 876  INDHQISQQDMNTLALVIDGKSLG-FALEPDLEEFLLAIGKMCRAVICCRVSPLQKALVV 934
            ++  ++   ++    +VIDG ++  F   P      + +     +VICCR SP QKAL+V
Sbjct: 1154 VS-QEVDSGNIAHCVVVIDGATMAMFEGNPTYMSVFVELCTKTDSVICCRASPSQKALMV 1212

Query: 935  KMVKRRTKSLL-LAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFALGQFKYLKKLL 993
              ++    +L+ LAIGDGAND++MIQ+A +GVGI+G EG+QA+R +D+++GQF++L KLL
Sbjct: 1213 SNIRNTDPNLVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRVSDYSIGQFRFLLKLL 1272

Query: 994  LVHGSWSYQRISQAILYSFYKNIALYMTQFWYVLYNAFSGQSIMESWTLTFYNWGGTAAP 1053
             VHG ++Y R S+ +L +FYK I  Y TQ  Y  Y  FSG S+ E W+L+ +N   T+ P
Sbjct: 1273 FVHGRYNYIRTSKFMLCTFYKEITFYFTQLIYQRYTMFSGSSLYEPWSLSMFNTLFTSLP 1332

Query: 1054 PGPPKRRDQFERSGLLNRDAQSCTVGQKGQFWPATIFRGSAINGNYHNWITIDGWIMDYR 1113
                         G+  +D +  T+    + +      G    G   NW+    W++   
Sbjct: 1333 ---------VLCIGMFEKDLKPMTLLTVPELYSY----GRLSQG--FNWLIFMEWVI--- 1374

Query: 1114 YGAAGAMHGETADHWVWGVA------IQPTSIIFVLGKAALI----------TNQWTKFT 1157
                 ++     +  +WG++      + P  +I      ALI             W  FT
Sbjct: 1375 LATTNSLIITFLNVVMWGMSSLSDNTMYPLGLINFTAIVALINVKSQFVEMHNRNWLAFT 1434

Query: 1158 --VLAIPGSLVFWLLFFPIYAYLLPGLNVSKEYYGIVSHVYGSFTFWAMCYVXXXXXXXX 1215
              VL+  G LV W    PI        +V+   YG  +H     TFW    V        
Sbjct: 1435 SVVLSCGGWLV-WCCALPILNNTDQIYDVA---YGFYNHFGKDITFWCTSLVLALLPITL 1490

Query: 1216 XXXWKYYKRTYTPESYHVVQEMQKYDISDNRPRIE 1250
               +K +K    P    +  E+++   SD R ++E
Sbjct: 1491 DIVYKTFKVMIWPSDSDIFAELEQK--SDIRKKLE 1523

 Score =  247 bits (630), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 163/547 (29%), Positives = 273/547 (49%), Gaps = 91/547 (16%)

Query: 146 RYQRSRNKFNLKALFDHYVLRKPAAADTGAGEPRVIYINERRANGAMGYGDNHISTTKYN 205
           R   S++  ++  + DH  +    AA    G     ++ + R N    Y DN I++++Y 
Sbjct: 97  RTFHSKDGRHIPIILDHNAIEYKQAATKRDG-----HLIDERFNKP--YCDNRITSSRYT 149

Query: 206 AATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRFXXXXXXXXXXXXSAIKESVED 265
             +FLP+ L+ +FSK AN +F   +++Q +P  + T  +            S  +E+ +D
Sbjct: 150 FYSFLPRQLYAQFSKLANTYFFIVAVLQMIPGWSTTGTYTTIIPLCVFMGISMTREAWDD 209

Query: 266 LKRSNSDK------------ELNHSRADVYS----------------------------- 284
            +R   DK            + N+   +VY+                             
Sbjct: 210 FRRHRLDKEENNKPVGVLVKDGNNDAQEVYTLPSSVVSSTAYLTKSAAAENNPPLNDDRN 269

Query: 285 DEMGQFIS-------------------KKWIDIAVGDIIRVRSEEAIPADLIVLSSSEPE 325
              G F+                    KKW  + VGD + +  ++ +PADL++L+     
Sbjct: 270 SSQGHFLDTHFNNFELLKNKYNVHIHQKKWEKLRVGDFVLLTQDDWVPADLLLLTCDGEN 329

Query: 326 GLCYIETANLDGETNLKIKQARPETSKILDVRE-LSAMRGKILSEQPNTSLYTYEGTMIL 384
             C++ET  LDGETNLK KQ  PE +K+      L+ +  ++  E PN  LY +EG + L
Sbjct: 330 SECFVETMALDGETNLKSKQPHPELNKLTKAASGLANINAQVTVEDPNIDLYNFEGNLEL 389

Query: 385 HNNR------IPLSPDQILLRGATLRNTVWIFGIVIFTGHETKLTRNATATP-IKRTAVE 437
            N+R       PL PD ++ RG+ LRNT  + G+VIF+G ETK+  NA   P  K   ++
Sbjct: 390 KNHRNDTIMKYPLGPDNVIYRGSILRNTQNVVGMVIFSGEETKIRMNALKNPRTKAPKLQ 449

Query: 438 RVINLQIVALFGVLICLSLISSFGNLIVMYNQK---ENLSYLYLQGTNMVALFFKNILTF 494
           R IN+ IV +  V+  +SL S  G+  V++ +K   +N ++   Q    VA     I++F
Sbjct: 450 RKINMIIVFMVFVVATISLFSYLGH--VLHKKKYIDQNKAWYLFQADAGVA---PTIMSF 504

Query: 495 WILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLVEELGQIEYIF 554
            I+++ ++P+SL+VT+E+IK  Q+ M+  D+D++H E+N P   RT++++EELGQ+ YIF
Sbjct: 505 IIMYNTVIPLSLYVTMEIIKVVQSKMMEWDIDMYHAETNTPCESRTATILEELGQVSYIF 564

Query: 555 SDKTGTLTQNVMEFKSCSIAGRCYIQSIP-EDKDAAFDEGIEVGYRTYDDMHELLHTPGS 613
           SDKTGTLT N M F+  S+ G  ++ ++   + +  F++         D+ + L   P +
Sbjct: 565 SDKTGTLTDNKMIFRKFSLCGSSWLHNVDLGNSEDNFEDN-------RDNTNSLRLPPKA 617

Query: 614 GDGAIID 620
            +G+ ID
Sbjct: 618 HNGSSID 624

 Score = 94.0 bits (232), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 58/157 (36%), Positives = 85/157 (54%), Gaps = 25/157 (15%)

Query: 622 FLTLLSICHTVIPEFQEN-----GSIKYQAASPDEGALVQGAADLGYKFIIRKPNSVTI- 675
           F   L++CH+ +P+   N      SI+YQ++SPDE ALV  A DLGY  + R    +TI 
Sbjct: 731 FFLSLALCHSCLPKKTHNESIGEDSIEYQSSSPDELALVTAARDLGYIVLNRNAQILTIK 790

Query: 676 -LREDITEEVV---YELLNICEFNSTRKRMSAIFRFPD--NSIRLLCKGADTVILERLAA 729
              +    E     YE+LN  +FNS RKRMS + R P+  N + L+CKGAD VI+ERL  
Sbjct: 791 TFPDGFDGEAKLENYEILNYIDFNSQRKRMSVLVRMPNQPNQVLLICKGADNVIMERL-- 848

Query: 730 TSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYE 766
                      H  + AA+ +  +C +++   ++E E
Sbjct: 849 -----------HDRELAAKKMADICTSTKERKDAEAE 874

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score =  273 bits (699), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 182/532 (34%), Positives = 275/532 (51%), Gaps = 47/532 (8%)

Query: 730  TSNPYVAA-TLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATTMHNRSEELDK 788
            T+  YV   TL+ ++ +  EGLRTL  + + I   EYE W+  Y AA   + NR E++D 
Sbjct: 932  TNEEYVIERTLQDMDAFTTEGLRTLLYSFKWIGNQEYETWNSRYSAAKAALVNRREQMDT 991

Query: 789  VAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLL 848
            V E+IE+ L LLG   IEDKLQ+GVP+ I  L++AGIK+W+LTGD++ETAINIG SC+L+
Sbjct: 992  VGEIIERDLTLLGTIGIEDKLQEGVPDAIDKLRRAGIKMWMLTGDKRETAINIGYSCRLI 1051

Query: 849  SEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLGFALEPDLEE 908
             +   ++I+  + +     N+  K+  I   +I   ++    +VIDG +L    E +L  
Sbjct: 1052 HDYSTVIILAPNDE-----NMASKITTIT-QEIEAGNVAHCVVVIDGATLTI-FEGNLTL 1104

Query: 909  FLLAIGKMCR---AVICCRVSPLQKALVVKMVKRRTKSLL-LAIGDGANDVSMIQAAHVG 964
              L I ++C    +VICCR SP QKAL+V  +++  K L+ LAIGDGAND++MIQ+A +G
Sbjct: 1105 MTLFI-ELCTKTDSVICCRSSPSQKALMVTKIRKTDKKLVTLAIGDGANDIAMIQSADIG 1163

Query: 965  VGISGMEGMQAARSADFALGQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFW 1024
            V I+G EG+QA+RS+D+++ QF+YL KLLLVHG ++Y R S+ +L +FYK    Y+TQ  
Sbjct: 1164 VDITGKEGLQASRSSDYSIAQFRYLLKLLLVHGRYNYIRTSKFVLCTFYKEFVFYLTQLI 1223

Query: 1025 YVLYNAFSGQSIMESWTLTFYNWGGTAAPPGPPKRRDQFERSGLLNRDAQSCTVGQKGQF 1084
            + +   FSG S  E W LT +N   T+ P       ++  +S  L    +  T G++ Q 
Sbjct: 1224 FQINTMFSGTSQYEPWCLTVFNTLFTSLPVLCIGMFEKDLKSVTLLSIPELYTTGRQSQA 1283

Query: 1085 WPATIF-RGSAINGNYHNWITIDGWIMDYRYGAAGAMHGETADHWVWGVAIQPTSIIFVL 1143
            +   IF R  AI       I    W                     W +  Q  + ++ +
Sbjct: 1284 FNLVIFLRWMAIAALSSVIICFTNW-------------------QCWSLTAQSDNTLYPI 1324

Query: 1144 G-----KAALITNQWTKFTVLAIPGSLVFWLLFFPI-----YAYLLPGLNVSKEYYGIVS 1193
            G        ++ N   +   +A    L F   F  +     +  LLP +      Y +  
Sbjct: 1325 GLINYTAVVVLVNVKCQLLEMANRNWLAFASFFISVCGWLCWCLLLPAIYKETLVYDVRE 1384

Query: 1194 HVYGSF----TFWAMCYVXXXXXXXXXXXWKYYKRTYTPESYHVVQEMQKYD 1241
             +Y  F    TFWA   V           +K  K    P    +  E+++ D
Sbjct: 1385 GLYHQFGPDITFWATNLVLVLLPVMLDLLFKTCKVIIYPSDTEIFAELEQRD 1436

 Score =  226 bits (576), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 146/450 (32%), Positives = 233/450 (51%), Gaps = 46/450 (10%)

Query: 166 RKPAAADTGAGEPRVIYINERRANGAMGYGDNHISTTKYNAATFLPKFLFQEFSKYANLF 225
           R+  A   G G     Y++ R     + Y  N I++++Y+  +FLP+ L  +FSK  N +
Sbjct: 89  RRGFAESAGGGG----YVDRR---SGLPYIGNAITSSRYSVYSFLPRQLCAQFSKVVNSY 141

Query: 226 FLFTSIIQQVPNVTPTNRFXXXXXXXXXXXXSAIKESVEDLKRSNSDKELNH-------- 277
           F   +I+Q VPN + T ++            S  +E  ED +R   D+E N+        
Sbjct: 142 FFGMAILQMVPNWSTTGQYTTIVPLSIFMGISIAREGWEDFRRHKLDREENNKLVKVLAQ 201

Query: 278 ---------------SRADVYSD-EMGQ------FISKKWIDIAVGDIIRVRSEEAIPAD 315
                          +RA  ++D E  Q       + K+W D+ VG+ + +  ++ +PAD
Sbjct: 202 AHDSEFGDNKDISAEARAASFTDFETLQANHGVAVVEKQWKDVEVGEFVLLNQDDWVPAD 261

Query: 316 LIVLSSSEPEGLCYIETANLDGETNLKIKQARPE-TSKILDVRELSAMRGKILSEQPNTS 374
           L +L++      CY+ET  LDGETNLK K   P+  S+      L+  RG    E PN  
Sbjct: 262 LFLLATDGDNNECYVETMALDGETNLKCKHVLPKIASQTRTASGLATFRGMTTVEDPNID 321

Query: 375 LYTYEGTMILHNNR-----IPLSPDQILLRGATLRNTVWIFGIVIFTGHETKLTRNATAT 429
           LY +EG + +  +        +  D +L RG+ +RNT  + G+V+FTG ETK+  NA   
Sbjct: 322 LYNFEGKIEVETDSGEQQAYSIGLDNVLFRGSIIRNTQTVVGMVVFTGEETKIRMNAIKN 381

Query: 430 P-IKRTAVERVINLQIVALFGVLICLSLISSFGNLIVMYNQKENLSYLYLQGTNMVALFF 488
           P IK   ++  INL ++ +  V+   S +S FG L   +  +E  S        + A   
Sbjct: 382 PRIKSPKLQTQINLIVLFMILVVAIFSFLS-FG-LQRFFKNREVDSDRAWYLMKVDAGLA 439

Query: 489 KNILTFWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLVEELG 548
             I++F I+++ L+P+SL+VT+E+IK  Q+ ++  D+D++H E+N     RT++++EELG
Sbjct: 440 PTIMSFIIMYNTLIPLSLYVTMEIIKDMQSRLMEWDIDMYHLETNTGCTSRTATILEELG 499

Query: 549 QIEYIFSDKTGTLTQNVMEFKSCSIAGRCY 578
           Q+ YIFSDKTGTLT N M F+  S  G  +
Sbjct: 500 QVSYIFSDKTGTLTDNRMIFRKFSFCGTAW 529

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 49/120 (40%), Positives = 71/120 (59%), Gaps = 15/120 (12%)

Query: 622 FLTLLSICHTVIPEFQENG------SIKYQAASPDEGALVQGAADLGYKFIIRKPNSVTI 675
           F+  L++CHT +P+ ++        S++YQ++SPDE ALV  A D+GY  + R  + +TI
Sbjct: 653 FILALALCHTCLPKKRQGADSGDFDSVEYQSSSPDELALVTAARDMGYVVLNRNGDELTI 712

Query: 676 ------LREDITEEVVYELLNICEFNSTRKRMSAIFRFPDN--SIRLLCKGADTVILERL 727
                    D   E  YE+LN  +F+S RKRMS + R   +   + L+CKGAD VILERL
Sbjct: 713 KTYPDGFEADCVLE-KYEVLNTIDFSSDRKRMSVLVRMHQHPEKVLLICKGADNVILERL 771

>Scas_669.3
          Length = 1638

 Score =  268 bits (684), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 176/498 (35%), Positives = 277/498 (55%), Gaps = 58/498 (11%)

Query: 735  VAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIE 794
            +  T++ +++++ EGLRTL  + + +   EY++W   Y  A  ++ NR  ++ +V E IE
Sbjct: 992  IEKTIQAIDEFSTEGLRTLVYSYKWVDLQEYQQWEDRYHDAKISLTNRKSKIAEVGEEIE 1051

Query: 795  KGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNL 854
            + L LLGATAIEDKLQ+GV E I  +++AGIK+W+LTGD++ETAINIG SCKL+ +   +
Sbjct: 1052 QDLQLLGATAIEDKLQEGVSEAIEKIRRAGIKIWMLTGDKRETAINIGYSCKLIYDYSTV 1111

Query: 855  LIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLG-FALEPDLEEFLLAI 913
            +I+ +  +     N+I K+ AI+  ++   ++    ++IDG +L  F   P L    + +
Sbjct: 1112 VILAKGDE-----NIISKMNAIS-QEVDSGNVAHCVIIIDGSTLAMFEGNPTLMSVFIEL 1165

Query: 914  GKMCRAVICCRVSPLQKALVVKMVKRRTKSLL-LAIGDGANDVSMIQAAHVGVGISGMEG 972
                 +VICCR SP QK+L+V  ++   K+L+ LAIGDGAND++MIQ+A +G+GI G EG
Sbjct: 1166 CTKTDSVICCRASPSQKSLMVTNIRNSNKNLVTLAIGDGANDIAMIQSADIGIGIGGKEG 1225

Query: 973  MQAARSADFALGQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVLYNAFS 1032
            +QA+R+AD+++ QF+++ KLLLVHG ++Y R ++ IL +F+K I  Y+TQ  +  Y  FS
Sbjct: 1226 LQASRTADYSIAQFRFILKLLLVHGRYNYIRTAKFILCTFFKEITFYLTQLIFQRYTMFS 1285

Query: 1033 GQSIMESWTLTFYNWGGTAAPPGPPKRRDQFERSGLLNRDAQSCTVGQKGQFWPATIFRG 1092
            G S+ E W+L+ +N   T+ P             G+  +D +  T+    + +      G
Sbjct: 1286 GSSLYEPWSLSMFNTLFTSLP---------VLCIGMFEKDLKPMTLLTIPELYSM----G 1332

Query: 1093 SAINGNYHNWITIDGWIMDYRYGAAGAM---------HGETA--DHWVWGVA-IQPTSII 1140
                G   N I    W++     AA A+          GETA  DH ++ +  I  T+I+
Sbjct: 1333 RLSQG--FNLIIFGEWVIQ---AAAYALLITFLNIIIWGETALSDHTMYPLGVINFTAIV 1387

Query: 1141 FVLG-KAALI---TNQWTKFT--VLAIPGSLVFWLLFFPIY-----AYLLPGLNVSKEYY 1189
             ++  K   I      W  FT  +L+  G LV W    PI       Y +P        Y
Sbjct: 1388 ALVNVKCQFIEMNNRNWVVFTSVILSCGGWLV-WCCALPILNRSDVIYDVP--------Y 1438

Query: 1190 GIVSHVYGSFTFWAMCYV 1207
            G   H     T+W  C+V
Sbjct: 1439 GFFYHFGKDITWWCSCFV 1456

 Score =  250 bits (639), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 157/510 (30%), Positives = 263/510 (51%), Gaps = 63/510 (12%)

Query: 127 NSQYQSFEMQDYRDTHSGDRYQRSRNKFNLKALFDHYVLRKPAAADTGAGEPRVIYINER 186
           N+Q  S   +         R  RS++  ++    DH V +     +T   +   + I+ER
Sbjct: 76  NNQLPSVLTRLLDLLLDRSRTLRSKDGRHIPISLDHSVAQFQRYTNTKHKKNAGLLIDER 135

Query: 187 RANGAMGYGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRFXX 246
            ++    Y +N+I++++Y   +F PK L+ +FSK AN++F   +I+Q +P  + T  +  
Sbjct: 136 TSSV---YCNNNITSSRYTIYSFFPKQLYAQFSKVANVYFFVVAILQMIPGWSTTGTYTT 192

Query: 247 XXXXXXXXXXSAIKESVEDLKRSNSDKELNHSRADVYSDEM--------GQFISKK---- 294
                     S  +E+ +D +R   DKE N+    + + E          Q  S++    
Sbjct: 193 IVPLCIFMGISMAREAWDDFRRHRLDKEENNKTCSILTKEFSNKPMPDDAQLPSRQNIDN 252

Query: 295 --------------------------------WIDIAVGDIIRVRSEEAIPADLIVLSSS 322
                                           W ++ VGD + ++ +  +PAD++VL+S 
Sbjct: 253 LSNDSNTDYLNTKFNNFPFLEERHGVRIQETTWSNLHVGDFVLLKQDNWVPADILVLTSD 312

Query: 323 EPEGLCYIETANLDGETNLKIKQARPETSKI-LDVRELSAMRGKILSEQPNTSLYTYEGT 381
                C++ET  LDGETNLK+KQ  PE +K+      L+ +   I  E PN+ LY +EG 
Sbjct: 313 GDNNECFVETMALDGETNLKVKQPHPELNKLACSASGLANINALITVEDPNSDLYNFEGN 372

Query: 382 MILHNN------RIPLSPDQILLRGATLRNTVWIFGIVIFTGHETKLTRNATATP-IKRT 434
           + L +N      + P+ PD +  RG+ +RNT  + G+VI+TG ETK+  NA   P  K  
Sbjct: 373 LELTDNNNNSLKKYPVGPDNVAYRGSIIRNTDNVIGMVIYTGKETKIRMNALNNPRTKAP 432

Query: 435 AVERVINLQIVALFGVLICLSLISSFGNLIVMYNQK---ENLSYLYLQGTNMVALFFKNI 491
            +++ IN+ I  +  V+  +SL S  G+  V+ N+K   EN ++  L      A     I
Sbjct: 433 KLQKNINIIITFMVFVVAVISLFSYLGH--VLQNKKAIDENQAWYLLTKDAGAA---PTI 487

Query: 492 LTFWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLVEELGQIE 551
           ++F I+++ ++P+SL+VT+E+IK  Q+ M+  D+D++H E+N P   RT++++EELGQ+ 
Sbjct: 488 MSFIIMYNTIIPLSLYVTMEIIKAMQSKMMEWDIDMYHSETNTPCESRTATILEELGQVS 547

Query: 552 YIFSDKTGTLTQNVMEFKSCSIAGRCYIQS 581
           Y+FSDKTGTLT N M F+  SI G  ++ S
Sbjct: 548 YMFSDKTGTLTDNKMIFRKFSICGSSWLHS 577

 Score = 94.4 bits (233), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 83/142 (58%), Gaps = 16/142 (11%)

Query: 600 TYDDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPE---FQENGS--IKYQAASPDEGAL 654
           ++D +  + H P +        F+  L++CHT +P+   F E G   I+YQ++SPDE AL
Sbjct: 680 SFDLIQFIQHNPNTLFAKKAKFFILSLALCHTCLPKKSNFPEGGEDVIEYQSSSPDELAL 739

Query: 655 VQGAADLGYKFIIRKPNSVTIL-------REDITEEVVYELLNICEFNSTRKRMSAIFRF 707
           V  A DLGY  + +  + +TI         E I E+  Y++LN  +FNS RKRMS + + 
Sbjct: 740 VTAARDLGYVVLNKNADVLTIKTYPDGFENEPIFED--YQILNYIDFNSQRKRMSVLVKT 797

Query: 708 PD--NSIRLLCKGADTVILERL 727
           PD  N + L+CKGAD +ILERL
Sbjct: 798 PDEPNKVLLICKGADNMILERL 819

>Scas_89.1
          Length = 271

 Score =  167 bits (422), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 103/269 (38%), Positives = 156/269 (57%), Gaps = 12/269 (4%)

Query: 765  YEEWSKLYDAAATTMHNRSEELDKV-AEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQA 823
            Y+++ K Y  A+ +M N  E +  V  + +E  L LLG T +EDKLQ+ V  +I  L+ A
Sbjct: 2    YDKFEKEYHDASLSMLNXDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNA 61

Query: 824  GIKVWVLTGDRQETAINIGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQ 883
            G+K+W+LTGD+ ETA  + +S KL+S    +  V + ++     N ++ L+ IN      
Sbjct: 62   GVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGALNALEYLK-IN------ 114

Query: 884  QDMNTLALVIDGKSLGFALEPDLEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKS 943
                +  L+IDG+SLG  L    +EF   +  +  AVI CR +P QKA V  +++  T  
Sbjct: 115  ---KSSCLLIDGESLGMFLTYYKQEFFDIVVDL-PAVIACRCTPQQKADVALLIREITGK 170

Query: 944  LLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFALGQFKYLKKLLLVHGSWSYQR 1003
             +  IGDG NDVSMIQ A VGVGI G EG QA+ +ADF++ QF +L KLLL HG  SY+R
Sbjct: 171  RVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKR 230

Query: 1004 ISQAILYSFYKNIALYMTQFWYVLYNAFS 1032
             ++   +  ++ + + + Q  Y + +  S
Sbjct: 231  SAKLAQFVIHRGLIISVCQAVYSVCSKLS 259

>CAGL0K12034g complement(1161299..1164562) highly similar to sp|P13587
            Saccharomyces cerevisiae YDR040c ENA1 or sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 or sp|Q12691
            Saccharomyces cerevisiae YDR038c ENA5, hypothetical start
          Length = 1087

 Score = 91.3 bits (225), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 180/816 (22%), Positives = 321/816 (39%), Gaps = 165/816 (20%)

Query: 267  KRSNSDKELNHSRADVYSDEMGQFISKKWIDIAVGDIIRVRSEEAIPADLIVLSSSE--- 323
            K  N+ + L+   A V  +   + +     D+  GD++ V+  + IPADL ++S      
Sbjct: 113  KTMNALRALSSPNAHVIRNGNSEVVDST--DVVPGDLVVVKVGDTIPADLRLVSQQNFET 170

Query: 324  PEGLCYIETANLDGETNLKIKQARPETSKI-LDVRELSAMRGKILSEQPNTSLYTYEGTM 382
             E L   E+  +  + N       P   +I L     + ++G+       T L T  G +
Sbjct: 171  DEALLTGESLPVSKDANEIFDDETPVGDRINLAFSSSTVVKGRAQGIAIKTGLNTEIGKI 230

Query: 383  ILH----NNRIPLSPDQILLRGATLRNTVWIFGIVIFTGHETKLTRNATATPIKRTAVER 438
                   N  I   P +   + A      WI          TK T  A     + T + R
Sbjct: 231  AKSLRGGNELISRDPAKTWYQNA------WI---------STKRTVGAFLGTTQGTPLHR 275

Query: 439  VINLQIVALFGVLICLSLISSFGNLIVMYNQKENLSYLYLQGTNMVALFFKNILTFWILF 498
             ++   V LF + +  +++       VM +QK ++          VAL            
Sbjct: 276  KLSKLAVLLFWIAVVFAIV-------VMASQKFDVDRGVAIYAVCVAL------------ 316

Query: 499  SNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLVEELGQIEYIFSDKT 558
             +++P SL V + +     A ++AS             ++R    +E LG +  I SDKT
Sbjct: 317  -SMIPSSLVVVLTITMSVGAAVMAS----------RNVIIRKLDSLEALGAVNDICSDKT 365

Query: 559  GTLTQNVMEFKSCSIAGRCYIQSI-------PEDKDAAF-----------DEGIEVG-YR 599
            GTLTQ  M  K   +     +Q +       PE  D  F           +E  +VG  +
Sbjct: 366  GTLTQGKMIAKQIWVPKFGTLQVVGSNEPLNPEKGDINFIPNLSPYEYSHNETEDVGIMQ 425

Query: 600  TYDDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQA-ASPDEGALVQGA 658
             + D +E    PG+    + D++L   S+ + +   F +  + +++A   P E A+   A
Sbjct: 426  NFKDKYEGKSIPGNCQYQLFDKWLETASLAN-IASVFTDPETKEWKAHGDPTEIAIQVFA 484

Query: 659  ADLGYKFIIRKPNSV-TILREDITEEVVYELLNICE-----------------FNSTRKR 700
              +        P  V T  R+D+ E+ +   +++ E                 F+ST KR
Sbjct: 485  TRMDL------PRHVLTGERDDMDEDEIMSSVSLSEKDATAANAKFRHAAEFPFDSTIKR 538

Query: 701  MSAIFRFPD-NSIRLLCKGADTVILERLAA--TSNPYVAATL---------RHLEDYAAE 748
            MS+++   D  +  +  KGA   +L         +P  A  +          +++  ++E
Sbjct: 539  MSSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNTATVMTDADVDTIKENIDSMSSE 598

Query: 749  GLRTLCIASRTIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDK 808
            GLR L  A+++ P+S+  E              + +++ K  +  E GL  LG   I D 
Sbjct: 599  GLRVLAFANKSYPKSDVNE-------------EKLQKILKERDYAETGLTFLGLIGIYDP 645

Query: 809  LQDGVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLLIVNEDTKESTRNN 868
             ++     +    QAGI V +LTGD   TA       K +++++ +L             
Sbjct: 646  PREETAGAVKKFHQAGINVRMLTGDFPGTA-------KAIAQEVGIL------------- 685

Query: 869  LIDKLRAINDHQISQQDMNTLALVIDGKSLGFALEPDLEEFLLAIGKMCRAVICCRVSPL 928
                    N +  S++ ++ +  V+ GK      E +++   +        ++  R SP 
Sbjct: 686  ------PTNLYHYSKEVVDIM--VMTGKQFDNLSEDEIDNLPVL------PLVIARCSPQ 731

Query: 929  QKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA-DFALGQFK 987
             K  +++ + RR K   +  GDG ND   ++ A+VG+ + G+ G   A+ A D  L    
Sbjct: 732  TKVRMIEALHRREKFCAMT-GDGVNDSPSLKMANVGIAM-GINGSDVAKDASDIVLSDDN 789

Query: 988  YLKKLLLV-HGSWSYQRISQAILYSFYKNI--ALYM 1020
            +   L  V  G      I + +L    +N+  ALY+
Sbjct: 790  FASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYL 825

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
           complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 158/727 (21%), Positives = 280/727 (38%), Gaps = 125/727 (17%)

Query: 297 DIAVGDIIRVRSEEAIPADLIVLSSSEPEGLCYIETANLDGETNLKIKQARPETSKILDV 356
           D+ VGD++ +++ + +P D I++     EG C  + + + GE++           K+   
Sbjct: 200 DLLVGDLLSLQTGDVVPVDCILV-----EGKCECDESGITGESD--------TIKKVSLA 246

Query: 357 RELSAMRGKILSEQPNTSLYTYEGTMILHNNRIPLSPDQILLRGATLRNTVWIFGIVIFT 416
             L   R  + ++ P+  + +        +N   L PD +L+ G+ L + +    +    
Sbjct: 247 MSLQVYR-TVAADNPSADIGS-------SDNGHSLVPDPMLISGSKLLSGIGHAVVTAVG 298

Query: 417 GHET--KLTRNATATPIKRTAVERVINL-QIVALFGVLICLSLISSFGNLIVMYNQKENL 473
            H    K+     + P      ER+  L   ++++G +    L        + Y  K  L
Sbjct: 299 PHSVHGKMMLALKSEPETTPLQERLNTLADDISIYGSVAAFLLFVVLFLRFLSYLPKGRL 358

Query: 474 SYLYLQGTNMVALFFKNILTFWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESN 533
            Y  L      + F    +T   +    VP  L + V +   +    +  D +L      
Sbjct: 359 -YHDLPSARKGSRFMDIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNL------ 411

Query: 534 MPTVVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKSCSIAGRCYIQSIPEDKDAAFDEG 593
               VR     E +G    + SDKTGTLTQN M        G  +   I ED + A  + 
Sbjct: 412 ----VRVLRACETMGSATTVCSDKTGTLTQNKMVVVK-GFLGSSHFDDISEDSNCAQSDA 466

Query: 594 I--EVGYRTYDDM--HELLHTPGSGDGAIIDEFLT----------LLSICHTVIPEFQEN 639
           +  ++   T +D+  +  L++    +  + D  +T          L        P++   
Sbjct: 467 LRQDMSQHTLNDILANIALNSTAFENKQVADPVITENPYHKPRRSLFPWSRNNKPKYPAP 526

Query: 640 GSIKYQAA-----SPDEGALVQGA-ADLGYKFIIRKPNSVTILREDITEEVVYELLNICE 693
                Q+A     S  E AL+  A   LG +       S+  LR+D     +  ++ +  
Sbjct: 527 KDSSVQSAEFFIGSKTEAALLSLAKGSLGLE-------SLQALRDDPHHIGIASIVQMIP 579

Query: 694 FNSTRKRMSAIFRFPDNSIRLLCKGADTVILERL--AATSNPYVA--ATLRHLE------ 743
           F S+RK    + R  D + R   KGA   I +      +SN  V   +  +H E      
Sbjct: 580 FESSRKWAGLVVRLVDGNYRFFIKGASETIFKSCHYMRSSNDDVIKLSPQKHGEIFGLIN 639

Query: 744 DYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATTMHN-----------RSEELDKVAEM 792
           + A++ LRT+ +A +   +      ++L DA+  +  +            + +   +   
Sbjct: 640 NLASDALRTISLAHKDFTDISSWPPAELRDASDPSTASPDLLLGDEYVPTATDRPSIITN 699

Query: 793 IEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSEDM 852
              GL+L G   I D L+ GV E++   QQ+G+ V ++TGD   T   I  +C +LSE  
Sbjct: 700 NNSGLILDGVVGIHDPLRPGVKESVKNCQQSGVTVRMITGDNITTGRAIARACGILSESE 759

Query: 853 NLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLGFALEPDLEEFLLA 912
                  D + +    +  KL        S++ M   A             P L+     
Sbjct: 760 -----YADHECAMEGPVFRKL--------SRRQMMDAA-------------PKLK----- 788

Query: 913 IGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEG 972
                   +  R SP  K + V ++K+  + ++   GDG ND   +  A VG  + G+ G
Sbjct: 789 --------VLARSSPEDKRIFVDILKKMNE-VVAVTGDGTNDAPALTLADVGFSM-GISG 838

Query: 973 MQAARSA 979
              AR A
Sbjct: 839 TGVAREA 845

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 81/307 (26%), Positives = 132/307 (42%), Gaps = 57/307 (18%)

Query: 693  EFNSTRKRMSAIFR-FPDNSIRLLCKGADTVILERLAATSNPYVAATLRH--LEDYAAEG 749
            EF S  +RMS I + F +N+     KGA  VI    A   NP       H  L  Y   G
Sbjct: 908  EFLSELRRMSVIVKGFKENTYWSFTKGAPEVI----ADICNPATIPKDFHELLHHYTHNG 963

Query: 750  LRTLCIASRTIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKL 809
             R +  A +T+P+S +     LY          S+++ +  E +E  L  LG    E+KL
Sbjct: 964  FRIIACAGKTLPKSSW-----LY----------SQKVSR--EEVEDNLEFLGFIVFENKL 1006

Query: 810  QDGVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLLIVNEDTKESTRNNL 869
            +      +  LQ A I+  + TGD   TA+++G    L+S +   +    D  E +R   
Sbjct: 1007 KSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESR--- 1063

Query: 870  IDKLRAINDHQISQQDMNTLALVIDGKSLGFALEPDLEEFLLAIGKMCRAV--------- 920
                     H +S +D++    V+D  +L    +P+    L   G + R +         
Sbjct: 1064 ---------HLLSWRDVDEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILFRNDEILPD 1114

Query: 921  -----------ICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISG 969
                       I  R+SP +K  +V+ +++   ++    GDGAND   ++AA++G+ +S 
Sbjct: 1115 DYISTVLMKGSIYARMSPDEKHELVEQLQKLDYNVGFC-GDGANDCGALKAANIGISLSE 1173

Query: 970  MEGMQAA 976
             E   AA
Sbjct: 1174 AEASVAA 1180

>Kwal_26.9207
          Length = 1469

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 114/469 (24%), Positives = 200/469 (42%), Gaps = 57/469 (12%)

Query: 535  PTVVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKSCSIAGRCYIQSIPE---------- 584
            PT V  S      G+I+ +  DKTGTLT++ ++     +A     Q+             
Sbjct: 772  PTRVNVS------GKIDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGALITNVRGL 825

Query: 585  -DKDAAFDEGIEVGYRTYDDMHELL--HTPGSGDGAIIDEFLTLLSICHTVIPEFQENGS 641
             +K +  D G  + +++ + +  LL  H+    DG ++ + L       T     ++   
Sbjct: 826  FNKYSLNDCGSPIDFKSRNFLVSLLTCHSLRVVDGELLGDPLDFKMFQFTNWSYAEDFQD 885

Query: 642  IKYQAASPDEGALVQGAADLGYKFIIRKPNSVTILREDITEEVVYELLNIC---EFNSTR 698
             K+ + + +         + G    +  PN+ +      TE   + LL +    EF S  
Sbjct: 886  FKFHSLNEERNNKSTLPENAGIAPAVVHPNAEST-ENKFTENDPHNLLGVIRSFEFVSEL 944

Query: 699  KRMSAIFR-FPDNSIRLLCKGADTVILERLAATSNPYVAATLRHLEDYAAEGLRTLCIAS 757
            +RMS I + + +N      KGA  VI E    ++ P  A   + L+ Y   G R +  A 
Sbjct: 945  RRMSVIVKPYGENVFWGFTKGAPEVISEICNKSTLP--ANYEQILQQYTHNGYRVIACAG 1002

Query: 758  RTIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETI 817
            +T+P+  +    K+         +R E        +E  +  LG    E+KL+     T+
Sbjct: 1003 KTLPKRTWRFAQKV---------SREE--------VESNMEFLGFVVFENKLKPSTTPTL 1045

Query: 818  HTLQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKLRAIN 877
             +LQ AGI+  + TGD   TAI++G    L++E    +    D  +   + +I   R ++
Sbjct: 1046 ASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLII--WRDVD 1103

Query: 878  DHQ-----ISQQDMN-----TLALVIDGKSLGFALEPDLEEFLLAIGKMCRAVICCRVSP 927
            D       ++ + MN     T+A+  D   L F     L E  + +  + ++ I  R+SP
Sbjct: 1104 DCDLILDGVTLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINM-VLLKSSIYARMSP 1162

Query: 928  LQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAA 976
             +K  +V  ++     ++   GDGAND   ++AA VGV +S  E   AA
Sbjct: 1163 DEKHELVGQLQ-GLDYVVGFCGDGANDCGALKAADVGVSLSEAEASVAA 1210

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 90/330 (27%), Positives = 143/330 (43%), Gaps = 56/330 (16%)

Query: 664  KFIIRKP-NSVTILREDITEEVVYELLNICEFNSTRKRMSAIFR-FPDNSIRLLCKGADT 721
            +FI R+P N + I+R               EF S  +RMS I + F +N      KGA  
Sbjct: 900  RFIEREPSNVIGIVRS-------------FEFLSNLRRMSVIVKPFSENVFMSFTKGAPE 946

Query: 722  VILERLAATSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATTMHN 781
            VI E  +  + P     L H   Y   G R +  A + +     + W  LY         
Sbjct: 947  VIFELCSKQTLPLDYEALLH--HYTHNGYRVIACAGKKLTR---QSW--LY--------- 990

Query: 782  RSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAINI 841
             S+++ +  E IE  L  LG    E+KL+    ET+ +L +A I+  + TGD   TAI++
Sbjct: 991  -SQKVSR--EEIESNLEFLGFIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISV 1047

Query: 842  GMSCKLLSEDMNLLIVNEDTKESTRNNLI---------DKLRAINDHQISQQDMNTLALV 892
            G    L+      + V  D   S   ++I         D L ++    +S  D +   L 
Sbjct: 1048 GREAGLVESPRVFVSVINDIDTSQEGDIITWQNVANSSDTLDSVTLRPLS-GDTDDYTLA 1106

Query: 893  IDGKSLGFALEPD---LEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAI- 948
            + G+      + D   +EE +  I  + +  I  R+SP +K  +V+    R +S+   + 
Sbjct: 1107 VTGEVFRLLFKTDKSQIEEVINNI--LLKTSIYARMSPDEKHELVE----RLQSIGYQVG 1160

Query: 949  --GDGANDVSMIQAAHVGVGISGMEGMQAA 976
              GDGAND   ++AA +G+ +S  E   AA
Sbjct: 1161 FCGDGANDCGALKAADIGISLSEAEASVAA 1190

>Scas_665.30
          Length = 1439

 Score = 80.5 bits (197), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 77/298 (25%), Positives = 132/298 (44%), Gaps = 37/298 (12%)

Query: 693 EFNSTRKRMSAIFRFPDNSIR-LLCKGADTVILERLAATSNPYVAATLRHLEDYAAEGLR 751
           EF S  +RMS I +  +  +     KGA  VI +     + P  A     L  Y  +G R
Sbjct: 709 EFLSELRRMSVIVKPSNEDVYWAFTKGAPEVITQICNKATLP--ANFEEMLNYYTHKGYR 766

Query: 752 TLCIASRTIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQD 811
            +  A R +P + +     LY          S+++ +  E +E  +  LG    E+KL+ 
Sbjct: 767 VIACAGRVLPRNTW-----LY----------SQKVSR--EEVESNMEFLGFIIFENKLKK 809

Query: 812 GVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLLIVNEDTKESTRNNLID 871
              +T+ TLQ+A I+  + TGD   TAI++G  C L+      +   E+   + + ++I 
Sbjct: 810 ETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQTSII- 868

Query: 872 KLRAINDHQISQQDMNTLALVIDGKSLGFALEPDLEEFLLAIGK-------------MCR 918
             R + D+     D  TL  + +  S  + L    + F +  G              + +
Sbjct: 869 -WRDV-DNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTVLLK 926

Query: 919 AVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAA 976
             I  R+SP +K  +++ ++R   ++    GDGAND   ++AA VG+ +S  E   AA
Sbjct: 927 GTIYARMSPDEKHELMEQLQRLNYTVGFC-GDGANDCGALKAADVGISLSEAEASVAA 983

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score = 80.1 bits (196), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 94/358 (26%), Positives = 159/358 (44%), Gaps = 64/358 (17%)

Query: 636  FQENGSIKYQAASPDEGALVQGAADLGYKFIIRKPNSVT-ILREDITEEVVYELLNICEF 694
            F EN  I      P++       +D   KF+   PN++  I+R               EF
Sbjct: 883  FPENNDIIPAIVHPND-------SDERNKFVQNDPNNILGIIRS-------------FEF 922

Query: 695  NSTRKRMSAIFRFPDNS--IRLLCKGADTVILERLAATSNPYVAATLRHLEDYAAEGLRT 752
             S  +RMS I + P+N        KGA  VI++     + P     +  L  Y   G R 
Sbjct: 923  LSELRRMSVIVK-PNNENVYWAYTKGAPEVIIDICNPATLPSDYDDI--LNFYTHSGYRV 979

Query: 753  LCIASRTIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDG 812
            +  A +T+P++ +     LY         R EE       +E  +  LG    ++KL+D 
Sbjct: 980  IACAGKTLPKNTW-----LYSQKV-----RREE-------VESNMEFLGFIIFQNKLKDA 1022

Query: 813  VPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSE-----------DMNLLIVNEDT 861
               T+  L+ A I+  + TGD   TAI++G  C+L++E           DM +  V    
Sbjct: 1023 TSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHWN 1082

Query: 862  KESTRNNLID--KLRAINDHQISQQDMNTLALVIDGKSLGFALEPDL-EEFLLAIGKMCR 918
            + S   +++D   L+ I+D+        TLA+  +   + F+ + +  EE++  I  + +
Sbjct: 1083 EISNAEHILDTFTLQPIDDY----SGPYTLAITGEVFRIIFSNQDNYSEEYVNEI--LLK 1136

Query: 919  AVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAA 976
              I  R+SP +K  +V+ +++   ++    GDGAND   ++AA VG+ +S  E   AA
Sbjct: 1137 GSIFARMSPDEKHELVEQLQKMDYTVGFC-GDGANDCGALKAADVGISLSEAEASVAA 1193

>Kwal_47.17547
          Length = 1240

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 78/315 (24%), Positives = 133/315 (42%), Gaps = 61/315 (19%)

Query: 685 VYELLNICEFNSTRKRMSAIFRFPDNSIRLLCKGADTVILERLAATSNPYVAATLRHLED 744
           + +++ I  F S+RK    + ++ +   R   KGA  ++L R           TL   +D
Sbjct: 583 IEKIVQIIPFESSRKWGGIVVKYKNGLHRFYIKGAAELLLRRCMQKRASDSKLTLISQKD 642

Query: 745 Y----------AAEGLRTLCIASRTIPESEYEEWSKLYD-----AAATTMH-----NRSE 784
           +          AAE LR + +A R  P       S+L D     AA+  +      +RS+
Sbjct: 643 FDEESQTITNLAAEALRAISLAHRDYPNCPNWPPSELQDEVEPEAASPDLLFGDEVSRSD 702

Query: 785 ELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAINIGMS 844
            + + A+ +   +VL G   I+D L+ GV +++   Q+AG+ V ++TGD   TA  I   
Sbjct: 703 SVSEPAQELVSPMVLDGIVGIQDPLRKGVRKSVEQCQKAGVTVRMVTGDNILTATAIAKK 762

Query: 845 CKLLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLGFALEP 904
           C +LSE+       E+ + S       KL   N  ++                    + P
Sbjct: 763 CSILSEEQ-----AENPESSMEGPRFRKLS--NKERVR-------------------ILP 796

Query: 905 DLEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVG 964
           +L              +  R SP  K ++V+ +K +   ++   GDG ND   ++ A VG
Sbjct: 797 NLR-------------VLARSSPEDKRILVETLK-KMGDVVAVTGDGTNDAPALKLADVG 842

Query: 965 VGISGMEGMQAARSA 979
             + G+ G + AR A
Sbjct: 843 FSM-GIAGTEVAREA 856

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 71/285 (24%), Positives = 114/285 (40%), Gaps = 61/285 (21%)

Query: 297 DIAVGDIIRVRSEEAIPADLIVLSSSEPEGLCYIETANLDGETNLKIKQARPETSKILDV 356
           DI VGDI+ +++ + +PAD I++     +G C  + + L GE+   IK+A       +DV
Sbjct: 203 DILVGDILSLQTGDVVPADCILV-----KGSCECDESALTGES-ATIKKAA------IDV 250

Query: 357 -----RELSAMRGKILSEQPNTSLYTYEGTMILHNNRIPLSPDQILLRGATL-----RNT 406
                ++LSA    I    P                     PD +L+ G+ L     R  
Sbjct: 251 CYEKYKQLSATDAAIDIGTPGAEKV----------------PDPMLISGSKLLSGLGRAV 294

Query: 407 VWIFGIVIFTGHE-TKLTRNATATPIKRTAVERVINL-QIVALFGVLICLSL-ISSFGNL 463
           V   G+    G     L   A  TP++    ER+ +L   ++++G    L L    F   
Sbjct: 295 VTSVGVNSMHGRTLMALKVEAETTPLQ----ERLDSLANSISVYGSAAALLLFFILFMRF 350

Query: 464 IVMYNQKENLSYLY--LQGTNMVALFFKNILTFWILFSNLVPISLFVTVEMIKYYQAYMI 521
           +    +   L  L    +G+  + +F   I    +     VP  L + V +   +    +
Sbjct: 351 LANLKKGGELHDLTPAQKGSRFMNIFIVGITVIVV----AVPEGLPLAVTLALAFATTRM 406

Query: 522 ASDLDLFHEESNMPTVVRTSSLVEELGQIEYIFSDKTGTLTQNVM 566
           A D +L          VR     E +G    + SDKTGTLT+N M
Sbjct: 407 AKDGNL----------VRVLRACETMGSATAVCSDKTGTLTENRM 441

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 86/312 (27%), Positives = 133/312 (42%), Gaps = 59/312 (18%)

Query: 693  EFNSTRKRMSAIFRFPDNSIRL-LCKGADTVILERLAATSNPYVAATLRHLEDYAAEGLR 751
            EF S  +RMS I +  ++ +     KGA  VI E    ++ P  A     L  Y   G R
Sbjct: 933  EFLSELRRMSVIVKTNNDDVYWSFTKGAPEVISEICNKSTLP--ADFEEVLRCYTHNGYR 990

Query: 752  TLCIASRTIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQD 811
             +  A +T+P+  +     LY    +             E +E  L  LG    ++KL+ 
Sbjct: 991  VIACAGKTLPKRTW-----LYSQKVS------------REEVESNLEFLGFIIFQNKLKK 1033

Query: 812  GVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLS---------EDMNL----LIVN 858
               ET+ +LQ A I+  + TGD   TAI++G    L+           D  L    +IV 
Sbjct: 1034 ETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIVW 1093

Query: 859  EDTKESTR-------------NNLIDKLRAINDHQISQQDMNTLALVIDGKSLGFALEPD 905
             D  E  +             NN ++ LR  N          TLA+  D   L F  E +
Sbjct: 1094 RDVNEPDKILDTKTLKPVKLGNNSVESLRECN---------YTLAVSGDVFRLLFRDENE 1144

Query: 906  L-EEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVG 964
            + EE+L  I  +  + I  R+SP +K  ++  +++   ++    GDGAND   ++AA VG
Sbjct: 1145 IPEEYLNEI--LLNSSIYARMSPDEKHELMIQLQKLDYTVGFC-GDGANDCGALKAADVG 1201

Query: 965  VGISGMEGMQAA 976
            + +S  E   AA
Sbjct: 1202 ISLSEAEASVAA 1213

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
            Ca2+-transporting P-type ATPase of Golgi membrane
            involved in Ca2+ and Mn2+ import into Golgi [2853 bp, 950
            aa]
          Length = 950

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 119/500 (23%), Positives = 190/500 (38%), Gaps = 113/500 (22%)

Query: 537  VVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKS--C--SIAGRCYIQSIPEDKDAAFDE 592
            +VR    VE LG +  I SDKTGTLT N M      C  S++ +  + S+ ++K      
Sbjct: 352  IVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKKTKNSN 411

Query: 593  GIEVGYRTYDDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPDEG 652
            G    Y T D                + E LT+ ++C+     F +  +I     +P + 
Sbjct: 412  GNLKNYLTED----------------VRETLTIGNLCNNA--SFSQEHAIFL--GNPTDV 451

Query: 653  ALVQGAADLGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFP-DNS 711
            AL++  A+     I    N+V  ++E               FNS RK M+     P DN 
Sbjct: 452  ALLEQLANFEMPDI---RNTVQKVQE-------------LPFNSKRKLMATKILNPVDNK 495

Query: 712  IRLLCKGADTVILERLAATSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKL 771
              +  KGA     ER+   S  Y+ +  +  E        T+         S   E  ++
Sbjct: 496  CTVYVKGA----FERILEYSTSYLKSKGKKTEKLTEAQKATI----NECANSMASEGLRV 547

Query: 772  YDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLT 831
            +  A  T+ + S  L    E + K L   G   + D  +  V   I  L Q G+ + ++T
Sbjct: 548  FGFAKLTLSDSSTPL---TEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMIT 604

Query: 832  GDRQETAINIGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLAL 891
            GD + TA+NI     +   D  L +++ D           KL  ++D Q        LA 
Sbjct: 605  GDSENTAVNIAKQIGIPVIDPKLSVLSGD-----------KLDEMSDDQ--------LAN 645

Query: 892  VIDGKSLGFALEPDLEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDG 951
            VID                          I  R +P  K  +V+ +++R   + +  GDG
Sbjct: 646  VID-----------------------HVNIFARATPEHKLNIVRALRKRGDVVAMT-GDG 681

Query: 952  ANDVSMIQAAHVGVGISGMEGMQAARSA--------DFAL---------GQFKYLKKLLL 994
             ND   ++ + +GV + G  G   A+ A        DF+          G F  ++  L 
Sbjct: 682  VNDAPALKLSDIGVSM-GRIGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLT 740

Query: 995  VHGSWSYQRISQAILYSFYK 1014
               S S   +S   L + +K
Sbjct: 741  FQLSTSVAALSLVALSTAFK 760

>Kwal_23.3160
          Length = 1100

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 182/823 (22%), Positives = 309/823 (37%), Gaps = 178/823 (21%)

Query: 267  KRSNSDKELNHSRADVYSDEMGQFISKKWIDIAVGDIIRVRSEEAIPADLIVLSSSEPEG 326
            K  NS K L+   A V  D   + I  K   +  GD+  V++ + +PADL ++     E 
Sbjct: 123  KTMNSLKSLSTPSAHVIRDGNDETIPSK--QLVPGDLCVVKAGDTVPADLRLIECVNFE- 179

Query: 327  LCYIETANLDGETNLKIKQAR---PETSKI-------LDVRELSAMRGKILSEQPNTSLY 376
                + A L GE+    K+A    P T          L     +  +G+       T L 
Sbjct: 180  ---TDEALLTGESLPIAKEASQVYPATEDTPVGDRLNLAFASSTVSKGRATGIVVKTGLN 236

Query: 377  TYEGTMI--LHNNRIPLSPDQILLRGATLRNTVWIFGIVIFTGHETKLTRNATATPIKRT 434
            T  G +   L  +   +S D+          T W    +             T TP+ R 
Sbjct: 237  TEIGKIAQSLKGDNSLISKDE--------NKTFWANAGITLAATIGSFLGTTTGTPLHRK 288

Query: 435  AVERVINLQIVALFGVLICLSLISSFGNLIVMYNQKENLSYLYLQGTNMVALFFKNILTF 494
                        L  + + L  I+    ++VM  QK  ++              K +  +
Sbjct: 289  ------------LSKLAVLLFFIAVVFAIVVMATQKFVVN--------------KEVAIY 322

Query: 495  WILFS-NLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLVEELGQIEYI 553
             I  + +++P SL V + +     A ++A+             VVR    +E LG +  +
Sbjct: 323  AICVAVSMIPSSLVVVLTITMSVGAKIMAT----------RNVVVRKLDSLEALGAVNDV 372

Query: 554  FSDKTGTLTQNVM--------EFKSCSIAGRCY--------IQSIPE------DKDAAFD 591
             SDKTGTLTQ  M         F + +++            I+ IP         D+  D
Sbjct: 373  CSDKTGTLTQGKMIVKQAWVPSFGTITVSNSSNPFDPTDGGIELIPRFSPHQYKHDSTED 432

Query: 592  EGIEVGYRT--YDDMHELLHTPGSGDGAIIDEFL---TLLSICHTVIPEFQENGSIKYQA 646
             GI   ++   Y+D       P   +  +   +L    L +I H     +Q+  + +++A
Sbjct: 433  VGIITSFKNKFYND-----KLPAGLNSKLFLNWLKTAALANIAHV----YQDPETEEWKA 483

Query: 647  -ASPDEGALVQGA--ADLGYKFIIRKPNSVTILREDI-----TEEVVYELLNICEF--NS 696
               P E A+   A   D+    +  +  S +   ED      T  V     +I EF  +S
Sbjct: 484  HGDPTEIAIQVFAHKLDMPRNALTAEDKSDSESDEDAALGEKTSSVEPHYKHIAEFPFDS 543

Query: 697  TRKRMSAIFRF--PDNSIRLLCKGADTVILERLA---------ATSNPYVAA----TLRH 741
            + KRMSA++     DN+ R+  KGA   +L+            + + P          ++
Sbjct: 544  SIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMTEEDKEEVFKN 603

Query: 742  LEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLG 801
            +E  ++EGLR L  A+++  ES+                  SE+L K  + +E  L+  G
Sbjct: 604  VETLSSEGLRVLAFATKSFTESQ--------------ALKVSEDLRKNRDFVESDLIFQG 649

Query: 802  ATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLLIVNEDT 861
               I D  +      +    +AGI V +LTGD   TA  I     +L    NL    ++ 
Sbjct: 650  LVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPR--NLYHYPKEV 707

Query: 862  KESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLGFALEPDLEEFLLAIGKMCRAVI 921
             +S        + A    Q++ ++++ L L+                           ++
Sbjct: 708  VDSMV------MTAAQFDQLTDEEIDNLLLL--------------------------PLV 735

Query: 922  CCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA-D 980
              R +P  K  ++  + RR K   +  GDG ND   ++ A+VG+ + G+ G   A+ A D
Sbjct: 736  IARCAPQTKVRMIDALHRREKFCAMT-GDGVNDSPSLKKANVGIAM-GINGSDVAKDASD 793

Query: 981  FALGQFKYLKKLLLV-HGSWSYQRISQAILYSFYKNI--ALYM 1020
              L    +   L  V  G      I + +L    +N+  ALY+
Sbjct: 794  IVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYL 836

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
           Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 1280

 Score = 70.9 bits (172), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 74/320 (23%), Positives = 135/320 (42%), Gaps = 62/320 (19%)

Query: 676 LREDITEEVVYELLNICEFNSTRKRMSAIFRFPDNS-IRLLCKGADTVILERLAATSNP- 733
           LR   ++  + +++ +  F S+RK  +   +  DN   R   KGA  ++L+  +   N  
Sbjct: 620 LRTKPSDLGIDKVVQVIPFESSRKWGAIAVQLADNKGYRFYAKGAAEILLKVCSNQRNSD 679

Query: 734 ---------YVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAA-ATTMHNRS 783
                        + + ++D A+  LRT+ +  R   E   +E++   D + A+      
Sbjct: 680 NSIVPMNQDLYDESFKKIQDMASHALRTISLVHRDFKEWPPKEFADSTDPSIASPDLVMG 739

Query: 784 EELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAINIGM 843
            ELD    +  +G+ L     ++D L++GV E++   Q+AG+ V ++TGD   TA  I  
Sbjct: 740 HELDH-KNLSSEGMTLDAMVGLQDPLREGVKESVEQCQRAGVTVRMVTGDNILTARAISR 798

Query: 844 SCKLLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLGFALE 903
           +C +LSE+                         ND + + +                   
Sbjct: 799 NCNILSEE-----------------------GYNDPECAMEG------------------ 817

Query: 904 PDLEEFLLAIGKMCRAV----ICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQ 959
           P   +  L   KM R +    +  R SP  K ++V+ +K+  + ++   GDG ND   ++
Sbjct: 818 PTFRK--LPYKKMLRVIPKLRVLARSSPEDKRILVETLKKMGE-VVAVTGDGTNDAPALK 874

Query: 960 AAHVGVGISGMEGMQAARSA 979
            A VG  + G+ G + AR A
Sbjct: 875 LADVGFSM-GISGTEVAREA 893

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 64/296 (21%), Positives = 123/296 (41%), Gaps = 82/296 (27%)

Query: 297 DIAVGDIIRVRSEEAIPADLIVLSSSEPEGLCYIETANLDGETNLKIKQA-RPETSKILD 355
           D+ VGD+I +++ + +PAD +++S     G C  + + L GE++   K A +P   K   
Sbjct: 256 DLLVGDVISLQTGDVVPADAVLIS-----GSCECDESALTGESDTIKKVALKPALEKY-- 308

Query: 356 VRELSAMRGKILSEQPNTSLYTYE-GTMILHNNRIPLSPDQILLRGATLRNTVWIFGIVI 414
                    +I  + P   + ++  G  +         PD +L+ G+ L + +    ++ 
Sbjct: 309 --------KQIFEKDPTIDIGSHGVGEKV---------PDPLLISGSKLLSGIG-NAVIT 350

Query: 415 FTGHET-------KLTRNATATPIKRTAVERVINL-QIVALFGVLICLSLISSFGNLIVM 466
             G  +        L   + +TP++    ER+ NL   ++++G   C++ +  F  L + 
Sbjct: 351 SVGENSVNGRIMMALKTESESTPLQ----ERLSNLADNISIYG---CMAALVLFIILFIR 403

Query: 467 YNQKENLSYL-----------YLQGTNMVALFFKNILTFWILFSNLVPISL-----FVTV 510
           +     L+YL             +G+  + +F   +    +     +P+++     F T 
Sbjct: 404 F-----LTYLPNGKKYHDLPPAQKGSKFMNIFITAVTVIVVAVPEGLPLAVTLALAFATT 458

Query: 511 EMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLVEELGQIEYIFSDKTGTLTQNVM 566
            M K                + N+  V+R     E +G    I SDKTGTLT+N M
Sbjct: 459 RMTK----------------DGNLVRVLRA---CETMGSATAICSDKTGTLTENRM 495

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
            Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 951

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 135/589 (22%), Positives = 211/589 (35%), Gaps = 171/589 (29%)

Query: 537  VVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKS--C--SIAGRCYIQSIPEDKDAAFDE 592
            +VR    VE LG +  I SDKTGTLT N M      C  S+A +  + S+ ++K      
Sbjct: 360  IVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLDKNKG----- 414

Query: 593  GIEVGYRTYDDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPDEG 652
                               G+    + D+  T L +C          G++   A+   E 
Sbjct: 415  -------------------GNLKNYLTDDVKTTL-LC----------GNLCNNASYSQEH 444

Query: 653  ALVQGAADLGYKFIIRKPNSVTILRE-------DITEEVVYELLNICEFNSTRKRMSAIF 705
            A   G            P  V +L +       D+  E  Y  +    FNS RK M+   
Sbjct: 445  AKYLG-----------NPTDVALLEQLQKFELADVRSE--YTKVKELSFNSKRKMMATKI 491

Query: 706  RFPDNSIRLLCKGADTVILERLAATSNPYVAA-------TLRHLED-------YAAEGLR 751
            +  +    L  KGA     ER+   S+ Y+         T  H E         A+EGLR
Sbjct: 492  QDNEKKTTLFIKGA----FERILDKSSSYLTEKGKIEKLTAGHRETIIDCANTLASEGLR 547

Query: 752  TLCIASRTIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQD 811
             L  A R + +S     SKL +             D +++++  GL+      + D  + 
Sbjct: 548  VLAFAKRAMTDSS----SKLVE-------------DDISDLVFTGLI-----GMNDPPRS 585

Query: 812  GVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLLIVNEDTKESTRNNLID 871
             V   I    Q GI + ++TGD + TA+NI     +   D  L +++ D           
Sbjct: 586  SVKFAIDQFLQGGIHIIMITGDSENTAVNIARQIGIPVIDPKLSVLSGD----------- 634

Query: 872  KLRAINDHQISQQDMNTLALVIDGKSLGFALEPDLEEFLLAIGKMCRAVICCRVSPLQKA 931
            KL  + D Q        LA VID                          I  R +P  K 
Sbjct: 635  KLNEMTDDQ--------LANVID-----------------------HVNIFARATPEHKL 663

Query: 932  LVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFALGQFKYLKK 991
             +V+ ++RR   + +  GDG ND   ++ A +GV +  M    A  ++D  L    +   
Sbjct: 664  NIVRALRRRGDVVAMT-GDGVNDAPALKLADIGVSMGRMGTDVAKEASDMILTDDDFSTI 722

Query: 992  LLLV-HGSWSYQRISQAILYSFYKNIA---LYMTQFWYVLYNAFSGQSIMESWTLTFYNW 1047
            L  +  G   +  I   + +    +IA   L      ++L N  +   I+  W     + 
Sbjct: 723  LTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPNPLNAMQIL--WINILMD- 779

Query: 1048 GGTAAPPG---------------PPKRR-DQFERSGLLNR--DAQSCTV 1078
                 PP                PP++R D+   + LL R     SC +
Sbjct: 780  ----GPPAQSLGVEPVDHEVMKKPPRKRTDKILTAELLKRLIGTASCII 824

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
            cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
            efflux, start by similarity
          Length = 1082

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 135/581 (23%), Positives = 230/581 (39%), Gaps = 119/581 (20%)

Query: 500  NLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLVEELGQIEYIFSDKTG 559
            +++P SL V + +     A ++A+             +VR    +E LG +  I SDKTG
Sbjct: 323  SMIPSSLVVVLTITMSAGAKVMAT----------RNVIVRKLDSLEALGAVNDICSDKTG 372

Query: 560  TLTQNVMEFKSCSIA--GRCYIQS--------------IPE------DKDAAFDEGIEVG 597
            TLTQ  M  K   I   G   +Q               IP+        D   D GI   
Sbjct: 373  TLTQGKMIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYKHDDEEDVGIIPD 432

Query: 598  YRTYDDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQA-ASPDEGALVQ 656
            +++     EL    G  + ++ D++L   ++ + +   FQ++ +  ++A   P E A+  
Sbjct: 433  FKSKYLAGEL----GPLNVSLFDQWLYTATLAN-IATVFQDSETQDWKAHGDPTEIAIQV 487

Query: 657  GAA--DLGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPDNSI-- 712
             A   DL    +  +        +D      +E +    F+S+ KRMSAI++  ++    
Sbjct: 488  FATRMDLPRHVLTGEDKDD---EKDARANSSFEHVAEFPFDSSVKRMSAIYKNTEDPATP 544

Query: 713  --RLLCKGADTVILE-----------RLAATSNPYVAATLRHLEDYAAEGLRTLCIASRT 759
               +  KGA   +L+           + +  S   +    ++++  ++EGLR L  A ++
Sbjct: 545  IYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAFAKKS 604

Query: 760  IPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHT 819
              ESE+              +   ++L K  + +E  L  LG   I D  +      +  
Sbjct: 605  FNESEF--------------NANKDKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKK 650

Query: 820  LQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLL---IVNEDTKESTRNNLIDKLRAI 876
              QAGI V +LTGD   TA +I     +L  ++      +VN     +T         A+
Sbjct: 651  CHQAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMAAT------DFDAL 704

Query: 877  NDHQISQQDMNTLALVIDGKSLGFALEPDLEEFLLAIGKMCRAVICCRVSPLQKALVVKM 936
            +D +I   D+  L LVI                              R +P  K  +++ 
Sbjct: 705  SDQEI--DDLRVLPLVI-----------------------------ARCAPQTKVRMIEA 733

Query: 937  VKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA-DFALGQFKYLKKLLLV 995
            + RR+K   +  GDG ND   ++ A+VG+ + G+ G   A+ A D  L    +   L  V
Sbjct: 734  LHRRSKFCAMT-GDGVNDSPSLKIANVGIAM-GINGSDVAKDASDIVLSDDNFASILNAV 791

Query: 996  -HGSWSYQRISQAILYSFYKNI--ALY-MTQFWYVLYNAFS 1032
              G      I + +L    +N+  ALY M    +V    FS
Sbjct: 792  EEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFVDKEGFS 832

>Scas_707.48*
          Length = 741

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 117/465 (25%), Positives = 178/465 (38%), Gaps = 128/465 (27%)

Query: 537 VVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKS--C--SIAGRCYIQSIPEDKDAAFDE 592
           +VR    VE LG +  I SDKTGTLT N M      C  S+A +  + S+ + K  +   
Sbjct: 352 IVRRLPSVETLGSVNVICSDKTGTLTSNHMTASKIWCLDSMANKANVLSLEKSKSGSLKN 411

Query: 593 GIEVGYRTYDDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEF-QENGSIKYQAASPDE 651
                Y T D                +   LT+ +IC+     F QE+G  KY   +P +
Sbjct: 412 -----YLTED----------------VKSTLTIGNICNNA--SFSQEHG--KY-LGNPTD 445

Query: 652 GALVQGAADLGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPDNS 711
            AL++  +      I  +P          T + V E+     FNS RK M+      +  
Sbjct: 446 IALLEQLSKFDLSDI--RP----------TFKKVQEI----PFNSKRKFMAVKIVNSEGK 489

Query: 712 IRLLCKGADTVIL-------------ERLAATSNPYVAATLRHLEDYAAEGLRTLCIASR 758
             L  KGA   +L             E+L       +  T   L   A+EGLR L  A  
Sbjct: 490 YSLCVKGAFEKVLSQCSHYLNQKGKTEKLTQGQRDVIIETANSL---ASEGLRMLAFAKT 546

Query: 759 TIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIH 818
           T+P+S             T +   S     V ++I  GL+      + D  +  V   I 
Sbjct: 547 TLPDS------------PTLLTEES-----VGDLIFTGLI-----GMNDPPRPTVKPAIE 584

Query: 819 TLQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKLRAIND 878
            L Q G+ + ++TGD + TA+NI     +   D  L +++ D           KL  ++D
Sbjct: 585 QLLQGGVHIIMITGDSENTAVNIARQIGIPVLDPKLSVLSGD-----------KLNEMSD 633

Query: 879 HQISQQDMNTLALVIDGKSLGFALEPDLEEFLLAIGKMCRAVICCRVSPLQKALVVKMVK 938
            Q        LA VID                          I  R +P  K  +V+ ++
Sbjct: 634 DQ--------LANVID-----------------------HVNIFARATPEHKLNIVRALR 662

Query: 939 RRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAL 983
           +R   + +  GDG ND   ++ A +GV +  M    A  ++D  L
Sbjct: 663 KRGDVVAMT-GDGVNDAPALKLADIGVSMGRMGTDVAKEASDMVL 706

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative
           Ca2+-transporting ATPase, member of the P-type ATPase
           superfamily of membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 153/711 (21%), Positives = 271/711 (38%), Gaps = 169/711 (23%)

Query: 290 FISKKWIDIAVGDII--------RVRSEEAIPADLIVLSSSEPEGLCYIETANLDGETNL 341
           F +KKW+ +   +++        R   E AIP DLI+L     +G   +  A L GE+  
Sbjct: 259 FRNKKWVALQTNELLPMDLVSITRTAEESAIPCDLILL-----DGSAIVNEAMLSGESTP 313

Query: 342 KIKQA---RPETSKI-LD-VRELSAMRG--KILSEQPNTSLYTYEGTMILHNNRIPLSPD 394
            +K++   RP    + LD V +++ + G  K L   P             H + IP  PD
Sbjct: 314 LLKESIKLRPSEDNLQLDGVDKIAVLHGGTKALQVTPPE-----------HKSDIPPPPD 362

Query: 395 QILLRGATLRNTVWIFGIVIFTGHETKLTRNATATPIKRTAVERVI--NLQIVALFGVLI 452
                G  L        IV  TG ET      +   +   + ERV   N + +     L+
Sbjct: 363 -----GGAL-------AIVTKTGFETS---QGSLVRVMIYSAERVSVDNKEALMFILFLL 407

Query: 453 CLSLISSFGNLIVMYNQKENLSYLYLQGTNMVALFFKNILTFWILFSNLVPISLFVTVEM 512
             ++I+S+              Y++++GT M  +  K IL   ++ +++VP  L + + M
Sbjct: 408 IFAVIASW--------------YVWVEGTKMGRIQSKLILDCILIITSVVPPELPMELTM 453

Query: 513 IKYYQAYMIASDLDLFHEESNMPTVVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKSCS 572
                   +A       E   +P            G+I+    DKTGTLT   + F+  +
Sbjct: 454 AVNSSLAALAKFYVYCTEPFRIPFA----------GRIDVCCFDKTGTLTGEDLVFEGLA 503

Query: 573 IAGRCYIQSIPEDKDAAFDEGIEVGYRTYDDMHELLHTPGSGDGAIIDEFLTLLSICHTV 632
                               GI         ++     P S         + ++   H +
Sbjct: 504 --------------------GISADSENIRHLYSAAEAPEST--------ILVIGAAHAL 535

Query: 633 IPEFQENGSIKYQAASPDEGALVQGAADLGYKFIIRKPNSVTILREDITEEVVYELLNIC 692
           +    E+G I      P E A ++        + + + NS    RE   +    +++   
Sbjct: 536 VK--LEDGDI---VGDPMEKATLKAVG-----WAVERKNSN--YREGTGK---LDIIRRF 580

Query: 693 EFNSTRKRMSAIFRFPDNSIRLLCKGADTVILERLAATSNPYVAATLRHLEDYAAEGLRT 752
           +F+S  KR ++I    D ++    KGA   I ERL+     Y        + +   G R 
Sbjct: 581 QFSSALKRSASIASHND-ALFAAVKGAPETIRERLSDIPKNYDEI----YKSFTRSGSRV 635

Query: 753 LCIASRTIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDG 812
           L +AS+++P+    +   L         NR +        +E  L   G       L+D 
Sbjct: 636 LALASKSLPKMSQSKIDDL---------NRDD--------VESELTFNGFLIFHCPLKDD 678

Query: 813 VPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLLIVNEDTKESTRNNLIDK 872
             ETI  L ++  +  ++TGD   TA+++     ++  +  +L               D+
Sbjct: 679 AIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIVFGETLIL---------------DR 723

Query: 873 LRAINDHQISQQDMN-TLALVIDGKSLGFALEPDLEEFLLAI-GKMCRAV---------- 920
               +D+Q+  +D+  T+++  D     F      + + +A+ G    A+          
Sbjct: 724 AGKSDDNQLLFRDVEETVSIPFDPSKDTFDHSKLFDRYDIAVTGYALNALEGHSQLRDLL 783

Query: 921 ----ICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGI 967
               +  RVSP QK  ++  +K      L+  GDG NDV  ++ AHVG+ +
Sbjct: 784 RHTWVYARVSPSQKEFLLNTLKDMGYQTLMC-GDGTNDVGALKQAHVGIAL 833

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 178/860 (20%), Positives = 315/860 (36%), Gaps = 222/860 (25%)

Query: 267  KRSNSDKELNHSRADVYSDEMGQFISKKWIDIAVGDIIRVRSEEAIPADLIVLSSSEPEG 326
            K  NS K L+   A V  +   + I+ K  D+  GDI  V+  + IPADL +        
Sbjct: 117  KTMNSLKNLSSPNAHVIRNGKSETINSK--DVVPGDICLVKVGDTIPADLRL-------- 166

Query: 327  LCYIETANLDGETNLKIKQARP------------ETSKILDVRELS---------AMRGK 365
               IET N D + +L   ++ P            E + + D   L+           +G 
Sbjct: 167  ---IETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGI 223

Query: 366  ILSEQPNTSLYTYEGTMILHNNRIPLSPDQILLRGATLRNTVWIFGIVIFTGHETKLTRN 425
            ++    N+ +     ++   +  I   P +     + L+NT WI          TK    
Sbjct: 224  VIKTALNSEIGKIAKSLQGDSGLISRDPSK-----SWLQNT-WI---------STKKVTG 268

Query: 426  ATATPIKRTAVERVINLQIVALFGVLICLSLISSFGNLIVMYNQKENLSYLYLQGTNMVA 485
            A       T + R ++   V LF + +  ++I       VM +QK ++            
Sbjct: 269  AFLGTNVGTPLHRKLSKLAVLLFWIAVLFAII-------VMASQKFDVD----------- 310

Query: 486  LFFKNILTFWILFS-NLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLV 544
               K +  + I  + +++P SL V + +     A ++ S             +VR    +
Sbjct: 311  ---KRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVS----------RNVIVRKLDSL 357

Query: 545  EELGQIEYIFSDKTGTLTQNVM--------EFKSCSIAG--------------------- 575
            E LG +  I SDKTGTLTQ  M         F + +I+                      
Sbjct: 358  EALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPY 417

Query: 576  ------------------RCYIQSIPEDKDA-AFDEGIE------VGYRTYDDMHELLHT 610
                              R Y + +PED D   F + +E      +     DD  +    
Sbjct: 418  EYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKA 477

Query: 611  PGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPDEGALVQGAADLGYKFIIRKP 670
             G      I  F T + + H  +   +       Q+   D+ +L Q            KP
Sbjct: 478  HGDPTEIAIQVFATKMDLPHNALTGEKSTN----QSNENDQSSLSQHN---------EKP 524

Query: 671  NSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPDN-SIRLLCKGADTVILE---- 725
             S             +E +    F+ST KRMS+++    N +  +  KGA   I+     
Sbjct: 525  GSAQ-----------FEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSS 573

Query: 726  -------RLAATSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATT 778
                   ++   ++  V    +++   + EGLR L  AS++  + +  +     D     
Sbjct: 574  WYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVND-----DQLKNI 628

Query: 779  MHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETA 838
              NR+          E  LV LG   I D  ++     +    QAGI V +LTGD   TA
Sbjct: 629  TSNRATA--------ESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTA 680

Query: 839  INIGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSL 898
                   K +++++ +L                     N +  SQ+ ++++  V+ G   
Sbjct: 681  -------KAIAQEVGIL-------------------PTNLYHYSQEIVDSM--VMTGSQF 712

Query: 899  GFALEPDLEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMI 958
                E ++++  +        ++  R SP  K  +++ + RR K   +  GDG ND   +
Sbjct: 713  DGLSEEEVDDLPVL------PLVIARCSPQTKVRMIEALHRRKKFCAMT-GDGVNDSPSL 765

Query: 959  QAAHVGVGISGMEGMQAARSA-DFALGQFKYLKKLLLV-HGSWSYQRISQAILYSFYKNI 1016
            + A+VG+ + G+ G   ++ A D  L    +   L  V  G      I + +L    +N+
Sbjct: 766  KMANVGIAM-GINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENV 824

Query: 1017 ALYMTQFWYVLYNAFSGQSI 1036
            A  +     +++   +G+S+
Sbjct: 825  AQALYLIIGLVFRDENGKSV 844

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
            involved in Na+ and Li+ efflux, required for Na+
            tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 178/860 (20%), Positives = 315/860 (36%), Gaps = 222/860 (25%)

Query: 267  KRSNSDKELNHSRADVYSDEMGQFISKKWIDIAVGDIIRVRSEEAIPADLIVLSSSEPEG 326
            K  NS K L+   A V  +   + I+ K  D+  GDI  V+  + IPADL +        
Sbjct: 117  KTMNSLKNLSSPNAHVIRNGKSETINSK--DVVPGDICLVKVGDTIPADLRL-------- 166

Query: 327  LCYIETANLDGETNLKIKQARP------------ETSKILDVRELS---------AMRGK 365
               IET N D + +L   ++ P            E + + D   L+           +G 
Sbjct: 167  ---IETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGI 223

Query: 366  ILSEQPNTSLYTYEGTMILHNNRIPLSPDQILLRGATLRNTVWIFGIVIFTGHETKLTRN 425
            ++    N+ +     ++   +  I   P +     + L+NT WI          TK    
Sbjct: 224  VIKTALNSEIGKIAKSLQGDSGLISRDPSK-----SWLQNT-WI---------STKKVTG 268

Query: 426  ATATPIKRTAVERVINLQIVALFGVLICLSLISSFGNLIVMYNQKENLSYLYLQGTNMVA 485
            A       T + R ++   V LF + +  ++I       VM +QK ++            
Sbjct: 269  AFLGTNVGTPLHRKLSKLAVLLFWIAVLFAII-------VMASQKFDVD----------- 310

Query: 486  LFFKNILTFWILFS-NLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLV 544
               K +  + I  + +++P SL V + +     A ++ S             +VR    +
Sbjct: 311  ---KRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVS----------RNVIVRKLDSL 357

Query: 545  EELGQIEYIFSDKTGTLTQNVM--------EFKSCSIAG--------------------- 575
            E LG +  I SDKTGTLTQ  M         F + +I+                      
Sbjct: 358  EALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPY 417

Query: 576  ------------------RCYIQSIPEDKDA-AFDEGIE------VGYRTYDDMHELLHT 610
                              R Y + +PED D   F + +E      +     DD  +    
Sbjct: 418  EYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKA 477

Query: 611  PGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPDEGALVQGAADLGYKFIIRKP 670
             G      I  F T + + H  +   +       Q+   D+ +L Q            KP
Sbjct: 478  HGDPTEIAIQVFATKMDLPHNALTGEKSTN----QSNENDQSSLSQHN---------EKP 524

Query: 671  NSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPDN-SIRLLCKGADTVILE---- 725
             S             +E +    F+ST KRMS+++    N +  +  KGA   I+     
Sbjct: 525  GSAQ-----------FEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSS 573

Query: 726  -------RLAATSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATT 778
                   ++   ++  V    +++   + EGLR L  AS++  + +  +     D     
Sbjct: 574  WYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVND-----DQLKNI 628

Query: 779  MHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETA 838
              NR+          E  LV LG   I D  ++     +    QAGI V +LTGD   TA
Sbjct: 629  TSNRATA--------ESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTA 680

Query: 839  INIGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSL 898
                   K +++++ +L                     N +  SQ+ ++++  V+ G   
Sbjct: 681  -------KAIAQEVGIL-------------------PTNLYHYSQEIVDSM--VMTGSQF 712

Query: 899  GFALEPDLEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMI 958
                E ++++  +        ++  R SP  K  +++ + RR K   +  GDG ND   +
Sbjct: 713  DGLSEEEVDDLPVL------PLVIARCSPQTKVRMIEALHRRKKFCTMT-GDGVNDSPSL 765

Query: 959  QAAHVGVGISGMEGMQAARSA-DFALGQFKYLKKLLLV-HGSWSYQRISQAILYSFYKNI 1016
            + A+VG+ + G+ G   ++ A D  L    +   L  V  G      I + +L    +N+
Sbjct: 766  KMANVGIAM-GINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENV 824

Query: 1017 ALYMTQFWYVLYNAFSGQSI 1036
            A  +     +++   +G+S+
Sbjct: 825  AQALYLIIGLVFRDENGKSV 844

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 178/860 (20%), Positives = 315/860 (36%), Gaps = 222/860 (25%)

Query: 267  KRSNSDKELNHSRADVYSDEMGQFISKKWIDIAVGDIIRVRSEEAIPADLIVLSSSEPEG 326
            K  NS K L+   A V  +   + I+ K  D+  GDI  V+  + IPADL +        
Sbjct: 117  KTMNSLKNLSSPNAHVIRNGKSETINSK--DVVPGDICLVKVGDTIPADLRL-------- 166

Query: 327  LCYIETANLDGETNLKIKQARP------------ETSKILDVRELS---------AMRGK 365
               IET N D + +L   ++ P            E + + D   L+           +G 
Sbjct: 167  ---IETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGI 223

Query: 366  ILSEQPNTSLYTYEGTMILHNNRIPLSPDQILLRGATLRNTVWIFGIVIFTGHETKLTRN 425
            ++    N+ +     ++   +  I   P +     + L+NT WI          TK    
Sbjct: 224  VIKTALNSEIGKIAKSLQGDSGLISRDPSK-----SWLQNT-WI---------STKKVTG 268

Query: 426  ATATPIKRTAVERVINLQIVALFGVLICLSLISSFGNLIVMYNQKENLSYLYLQGTNMVA 485
            A       T + R ++   V LF + +  ++I       VM +QK ++            
Sbjct: 269  AFLGTNVGTPLHRKLSKLAVLLFWIAVLFAII-------VMASQKFDVD----------- 310

Query: 486  LFFKNILTFWILFS-NLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLV 544
               K +  + I  + +++P SL V + +     A ++ S             +VR    +
Sbjct: 311  ---KRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVS----------RNVIVRKLDSL 357

Query: 545  EELGQIEYIFSDKTGTLTQNVM--------EFKSCSIAG--------------------- 575
            E LG +  I SDKTGTLTQ  M         F + +I+                      
Sbjct: 358  EALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPY 417

Query: 576  ------------------RCYIQSIPEDKDA-AFDEGIE------VGYRTYDDMHELLHT 610
                              R Y + +PED D   F + +E      +     DD  +    
Sbjct: 418  EYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKA 477

Query: 611  PGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPDEGALVQGAADLGYKFIIRKP 670
             G      I  F T + + H  +   +       Q+   D+ +L Q            KP
Sbjct: 478  HGDPTEIAIQVFATKMDLPHNALTGEKSTN----QSNENDQSSLSQHN---------EKP 524

Query: 671  NSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPDN-SIRLLCKGADTVILE---- 725
             S             +E +    F+ST KRMS+++    N +  +  KGA   I+     
Sbjct: 525  GSAQ-----------FEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSS 573

Query: 726  -------RLAATSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATT 778
                   ++   ++  V    +++   + EGLR L  AS++  + +  +     D     
Sbjct: 574  WYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVND-----DQLKNI 628

Query: 779  MHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETA 838
              NR+          E  LV LG   I D  ++     +    QAGI V +LTGD   TA
Sbjct: 629  TSNRATA--------ESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTA 680

Query: 839  INIGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSL 898
                   K +++++ +L                     N +  SQ+ ++++  V+ G   
Sbjct: 681  -------KAIAQEVGIL-------------------PTNLYHYSQEIVDSM--VMTGSQF 712

Query: 899  GFALEPDLEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMI 958
                E ++++  +        ++  R SP  K  +++ + RR K   +  GDG ND   +
Sbjct: 713  DGLSEEEVDDLPVL------PLVIARCSPQTKVRMIEALHRRKKFCAMT-GDGVNDSPSL 765

Query: 959  QAAHVGVGISGMEGMQAARSA-DFALGQFKYLKKLLLV-HGSWSYQRISQAILYSFYKNI 1016
            + A+VG+ + G+ G   ++ A D  L    +   L  V  G      I + +L    +N+
Sbjct: 766  KMANVGIAM-GINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENV 824

Query: 1017 ALYMTQFWYVLYNAFSGQSI 1036
            A  +     +++   +G+S+
Sbjct: 825  AQALYLIIGLVFRDENGKSV 844

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
           complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 117/470 (24%), Positives = 180/470 (38%), Gaps = 120/470 (25%)

Query: 532 SNMPTVVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKS--C--SIAGRCYIQSIPEDKD 587
           +N   +VR    VE LG +  I SDKTGTLT N M      C  S+A +  + S+ E K 
Sbjct: 353 ANRKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTASKIWCLGSMANKNNVLSL-EAKS 411

Query: 588 AAFDEGIEVGYRTY--DDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQ 645
           +    G     + Y  DD+   L                + SIC+        N S  ++
Sbjct: 412 SGGLPGKLPNLKNYLSDDVKATLR---------------IGSICN--------NASFSHE 448

Query: 646 AASPDEGALVQGAADLGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIF 705
                 G  +    D+    +++K     ++ E  T   V EL     FNS RK M+   
Sbjct: 449 -----HGKYLGNPTDIALLEVLQK---FDLVDERPTTTRVDEL----TFNSKRKYMAVKV 496

Query: 706 RFPDNSIR--LLCKGADTVILERLAA----------TSNPYVAATLRHLEDYAAEGLRTL 753
             P NS +  +  KGA   ILER A+           S+ + +      +  A+EGLRTL
Sbjct: 497 DSPANSGKHIIYVKGAFERILERSASFIGGAGKVEKLSDSHKSLINDCAKSLASEGLRTL 556

Query: 754 CIASRTIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGV 813
             A          E S       +T+ N               L  +G   ++D  +  V
Sbjct: 557 AFAQL--------ECSTNKPMNDSTIQN---------------LTFVGLIGMKDPPRSTV 593

Query: 814 PETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKL 873
              I  L Q G+ V ++TGD + TA+NI       +  + + ++N +    T     D+L
Sbjct: 594 RPAIEELLQGGVHVIMITGDAENTAVNI-------ARQIGIPVINPEISVLTG----DRL 642

Query: 874 RAINDHQISQQDMNTLALVIDGKSLGFALEPDLEEFLLAIGKMCRAVICCRVSPLQKALV 933
             + D Q        LA VID                          I  R +P  K  +
Sbjct: 643 DQMTDDQ--------LAGVID-----------------------HVNIFARATPEHKLNI 671

Query: 934 VKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAL 983
           V+ +++R   ++   GDG ND   ++ A +GV +  M    A  ++D  L
Sbjct: 672 VRALQKR-GDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVL 720

>CAGL0L01419g 156123..159767 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           hypothetical start
          Length = 1214

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 164/704 (23%), Positives = 273/704 (38%), Gaps = 163/704 (23%)

Query: 294 KWIDIAVGD--------IIRVRSEEAIPADLIVLSSSEPEGLCYIETANLDGETNLKIKQ 345
           KW+++   +        ++R   + A+P DLI++     +G C +  A L GE+   +K+
Sbjct: 261 KWVEMQTNELLPMDVVSVVRTAEDSALPCDLILV-----DGTCIVNEAMLSGESTPLLKE 315

Query: 346 A---RP--ETSKILDVRELSAMRGKILSEQPNTSLYTYEGTMILHNNRIPLSPDQILLRG 400
           +   RP  E  +I    ++S + G     Q  T   T          ++P  PD     G
Sbjct: 316 SIRLRPGNEELQIEGTDKISVLHGGTKVLQVTTPEKT---------GKVPSPPDG----G 362

Query: 401 ATLRNTVWIFGIVIFTGHETKLTRNATATPIKRTAVERVINLQIVALFGVLICL--SLIS 458
           A          IV  TG ET      +   +   + ERV      AL+ +L  L  ++++
Sbjct: 363 A--------IAIVTKTGFETS---QGSLVRVMIYSSERVGVDNKEALYFILFLLIFAVVA 411

Query: 459 SFGNLIVMYNQKENLSYLYLQGTNMVALFFKNILTFWILFSNLVPISLFVTVEMIKYYQA 518
           S+              Y++++GT M  +  K IL   ++ +++VP  L + + M      
Sbjct: 412 SW--------------YVWVEGTKMGRVQSKLILDCILIITSVVPPELPMELTM----AV 453

Query: 519 YMIASDLDLFHEESNMPTVVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKSCSIAGRCY 578
               S L  F+     P  +  +      G+I+    DKTGTLT   + F+     G   
Sbjct: 454 NSSLSALSKFYVYCTEPFRIPFA------GRIDVCCFDKTGTLTGEDLVFE-----GLAG 502

Query: 579 IQSIPEDKDAAFDEGIEVGYRTYDDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQE 638
           + S P+D        I   Y   D        P S           ++   H ++    E
Sbjct: 503 LSSDPKD--------IRHLYSATD-------CPNSTS--------LVVGAAHALVR--LE 537

Query: 639 NGSIKYQAASPDEGALVQG---AADLGYKFIIRKPNSVTILREDITEEVVYELLNICEFN 695
           +G I      P E A ++      + G K    K   VTILR               +F+
Sbjct: 538 DGEI---VGDPMEKATLKALKWTVEKGDKVFNEKNGQVTILRR-------------FQFS 581

Query: 696 STRKRMSAIFRFPDNSIRLLCKGADTVILERLAATSNPYVAATLRHLEDYAAEGLRTLCI 755
           S  KR S++    D  +    KGA   I ERL      Y        + +   G R L +
Sbjct: 582 SALKRSSSVATH-DGKLYSAVKGAPETIRERLFTIPANYDEI----YKSFTRSGSRVLAL 636

Query: 756 ASRTIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPE 815
           AS+ +     E+ S+          ++ E+ D+  E  E+ L   G       L+    E
Sbjct: 637 ASKKL-----EKMSQ----------SQIEDADR--EHFERDLEFNGFLIFHCPLKHDAIE 679

Query: 816 TIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLLIVN-----EDTKESTRNNLI 870
           TI  L ++  +  ++TGD   TA+++     ++  +   LIV+      D K   RN  +
Sbjct: 680 TIQMLNESAHRCVMITGDNPLTAVHVAKEVGIVKGET--LIVDMVDNGNDDKLVFRN--V 735

Query: 871 DKLRAINDHQISQQDMNTLALV--IDGKSLGFALEP-----DLEEFLLAIGKMCRAVICC 923
           ++  +  +  +S+       +    D    G ALE       L++ +        A I  
Sbjct: 736 EETLSF-EFVVSKDSFEKYGIFDKYDLAVTGHALEALKGHHQLQDLIR------HAWIYA 788

Query: 924 RVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGI 967
           RVSP QK  ++  +K      L+  GDG NDV  ++ AHVGV +
Sbjct: 789 RVSPAQKEFILNNLKDMGYQTLMC-GDGTNDVGALKQAHVGVAL 831

>Scas_583.14*
          Length = 875

 Score = 63.9 bits (154), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 74/296 (25%), Positives = 127/296 (42%), Gaps = 30/296 (10%)

Query: 687 ELLNICEFNSTRKRMSAIFRFPDNSIRLLCKGADTVILERLAATSNPYVAATLRHLEDYA 746
           ++L   +F+S  KR S++    D  +    KGA   I ERLA     Y        + + 
Sbjct: 229 QILRRFQFSSALKRSSSVASHKDK-LFTAVKGAPETIRERLAVVPKNYDEI----YKSFT 283

Query: 747 AEGLRTLCIASRTIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIE 806
             G R L +AS+++P    ++   L         +R E        IE GL   G     
Sbjct: 284 RSGSRVLALASKSLPNLSSKQLDDL---------DRDE--------IETGLTFNGFLVFH 326

Query: 807 DKLQDGVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLLIVNEDTKESTR 866
             L+    ETI  L ++  +  ++TGD   TA+++     +++ +  +L  +E   +   
Sbjct: 327 CPLKPDAVETIKMLNESAHRSIMITGDNPLTAVHVAKEVAIVTGETLILDKSETVGDGKL 386

Query: 867 --NNLIDKLRAINDHQISQQDMNTLALVIDGKSLGFALEPDLEEFLLAIGKMCRAV-ICC 923
              N+ + ++   D    + D   L    D    G+AL  +L E    +  + R   +  
Sbjct: 387 LFFNVEETIKIPFDPASDKFDHRELFDKYDIAVTGYAL--NLLEDHSQLKDLIRHTWVYA 444

Query: 924 RVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 979
           RVSP QK  ++  +K      L+  GDG NDV  ++ AHVGV +  + G + + +A
Sbjct: 445 RVSPSQKEFILNNLKEMGYQTLMC-GDGTNDVGALKQAHVGVAL--LNGTEESMTA 497

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
           cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score = 64.3 bits (155), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 166/768 (21%), Positives = 298/768 (38%), Gaps = 152/768 (19%)

Query: 273 KELNHSRAD----VYSDEMGQFISKKWIDIAVGDIIRVRSEEAIPADLIVLSSSEPEGLC 328
           ++LN  R D    V  D     IS    ++ VGD++++++ + +PAD +++      G C
Sbjct: 148 QQLNRKREDRQVVVVRDAAESLISIH--NLLVGDLLKLQTGDVVPADCVLV-----RGEC 200

Query: 329 YIETANLDGETNLKIKQARPETSKILDVRELSAMRGKILSEQPNTSLYTYEGTMILHNNR 388
             + + L GE+N  IK+       + D  E  +  G    +  +TS     G     ++R
Sbjct: 201 ETDESALTGESN-TIKKL-----PLADALEYHSAHGG--RDIGDTSASGASGAA--DDSR 250

Query: 389 IPLSPDQILLRGATLRNTVWIFGIVIFTGHETKLTRNATATPIKRTAVERVINLQIVAL- 447
               PD +L+ G+ + +        I T          T   +K  + +  + +++  L 
Sbjct: 251 ---CPDCMLISGSRVLSG---LASAIVTNVGVNSVHGKTMASLKEDSEDTPLQMRLSQLT 304

Query: 448 --FGVLICLSLISSFGNLIVMYNQKENLSYLYLQGTNMVAL--------FFKNILTFWIL 497
               V  C++ I+ F  L   Y     LSY+   G     L        F    +T   +
Sbjct: 305 DNISVYGCVAAITLFVVLFARY-----LSYILPSGGKYHDLPPAEKGSKFMDIFITAITV 359

Query: 498 FSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLVEELGQIEYIFSDK 557
               VP  L + V +   +    +  D        N+  V+R+    E +G    + SDK
Sbjct: 360 IVVAVPEGLPLAVTLALAFATTRMTKD-------GNLVRVLRS---CETMGSATAVCSDK 409

Query: 558 TGTLTQNVMEFKSCSI--AGRCYIQSIPEDKDAAFDEGIEVGYRT--YDDM--------H 605
           TGTLT+N+M     ++  AG   I + P   +  F +      RT  YD++        +
Sbjct: 410 TGTLTENIMTVVRGTLGRAGFDDIGADPSKSNLVFKKKCSDLLRTVIYDNIVLNSTAFEN 469

Query: 606 ELLHTPGSGDGAIIDEFLTLL-SICHTV---IPEFQEN-------GSIKYQAASPDEGAL 654
           +    P + +     +   L+  I  T+    P+ +EN       G  +    S  E AL
Sbjct: 470 KDYKDPNNYNSIDDSQPRRLIRRITQTLQKKKPDDEENLLAHAAEGRQEPYIGSKTETAL 529

Query: 655 VQGA-ADLGYKFIIRKPNSVTILREDITE-EVVYELLNICEFNSTRKRMSAIFRFPDN-- 710
           +  A    G KF      ++   R    +   V  ++ I  F S+RK  + + +   N  
Sbjct: 530 LSLARKSFGLKF-----GALQSFRGHPEKLPTVETIVQIIPFESSRKWSAIVVKLNSNKE 584

Query: 711 ----SIRLLCKGADTVILE--RLAATSNPYVAATLRHLED--------YAAEGLRTLCIA 756
                 RL  KGA  ++ +   L    N  ++   +  +D         A + LR + +A
Sbjct: 585 NEGKKFRLYVKGAAEIVAKACTLKNVCNEGISEIDQKSKDDIEEQIFSLAKDALRAISLA 644

Query: 757 SRTI-----PESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQD 811
                    P  E  +    ++A A  +      +D     +E GL L     I+D L++
Sbjct: 645 HMDFDVNEWPPKELADPENSHEALAVKL------IDPKKPHLE-GLTLDAIVGIQDPLRE 697

Query: 812 GVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLLIVNEDTKESTRNNLID 871
            V  ++   Q+AG+ V ++TGD   TA  I  +C +LS                      
Sbjct: 698 NVKNSVAQCQKAGVTVRMVTGDNLLTAKAIARNCGILSS--------------------- 736

Query: 872 KLRAINDHQISQQDMNTLALVIDGKSLGFALEPDLEEFLLAIGKMCRAVICCRVSPLQKA 931
             +++ND           A  ++G +     + + +  L  +  + R+      SP  K 
Sbjct: 737 --KSLNDS----------ACAMEGPAFRKLSDSERKRILPKLRVLARS------SPEDKK 778

Query: 932 LVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 979
           ++V+ +K   + ++   GDG ND   ++ A VG  + G+ G + AR A
Sbjct: 779 ILVRALKEMGE-VVAVTGDGTNDAPALKLADVGFSM-GITGTEVAREA 824

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           start by similarity
          Length = 1206

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 161/728 (22%), Positives = 286/728 (39%), Gaps = 173/728 (23%)

Query: 290 FISKKWIDIAVG--------DIIRVRSEEAIPADLIVLSSSEPEGLCYIETANLDGETNL 341
           F   KW+++            I R   + AIP DL+++     +G C +  A L GE+  
Sbjct: 258 FRDGKWVEMQTDKLFPMDLVSITRTAEDSAIPCDLLLI-----DGSCIVNEAMLSGESTP 312

Query: 342 KIKQA---RPETSKI-LD-VRELSAMRGKILSEQPNTSLYTYEGTMILHNNR--IPLSPD 394
            +K++   RP   ++ LD V + + + G   + Q                NR  +   PD
Sbjct: 313 LLKESIKLRPANDQLQLDGVDKNAVLHGGTKALQVTAP-----------ENRTGVITPPD 361

Query: 395 QILLRGATLRNTVWIFGIVIFTGHETKLTRNATATPIKRTAVERVINLQIVALFGVLICL 454
                G  L        +V  TG ET      +   +   + ERV      AL+ +L  L
Sbjct: 362 -----GGAL-------AVVTKTGFETS---QGSLVRVMIFSAERVDVGNKEALYFILFLL 406

Query: 455 --SLISSFGNLIVMYNQKENLSYLYLQGTNMVALFFKNILTFWILFSNLVPISLFVTVEM 512
             ++++S+              Y++ +GT M  +  K IL   ++ +++VP  L   +E+
Sbjct: 407 IFAIVASW--------------YVWKEGTRMGRIQSKLILDCILIITSVVPPEL--PMEL 450

Query: 513 IKYYQAYMIASDLDLFHEESNMPTVVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKSCS 572
                + + A  L  F+     P  +  +      G+I+    DKTGTLT   + F    
Sbjct: 451 TMAVNSSLAA--LSKFYVYCTEPFRIPYA------GRIDVCCFDKTGTLTAEDLVF---- 498

Query: 573 IAGRCYIQSIPEDKDAAFDEGIEVGYRTYDDMHELLHTPGSGDGAIIDEFLTLLSICHTV 632
                              EG+  G     D+  L     + D +   E L+ +   H +
Sbjct: 499 -------------------EGL-AGLHDGSDIRTL---KSANDAS--QEVLSAIGAAHAL 533

Query: 633 IPEFQENGSIKYQAASPDEGALVQGAA-DLGYKFIIRKPNSVTILREDITEEVVYELLNI 691
           +    ++G I      P E A ++ ++  + +K ++++  +  I            +L  
Sbjct: 534 VK--LDDGEI---VGDPMEKATLKASSWTVDFKDVVKRAGADNI-----------RILRR 577

Query: 692 CEFNSTRKRMSAIFRFPDNSIRLLCKGADTVILERLAATSNPYVAATLRHLEDYAAEGLR 751
            +F+S+ KR ++I     N      KGA   I ERL +  + Y        + +   G R
Sbjct: 578 FQFSSSLKRSASIAS-QSNRFFAAVKGAPETIRERLNSVPSDYDDI----YKSFTRSGSR 632

Query: 752 TLCIASRTIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQD 811
            L +A + +P+                 +++ + +D+  + IE GL           L+D
Sbjct: 633 VLALAYKDLPKMS---------------NSQIDNIDR--DEIETGLTFGAFLVFHCPLKD 675

Query: 812 GVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLLIVNEDTKESTRNNLID 871
              ETI  L ++  +  ++TGD   TA+++     ++  D   LI++E    S+   +  
Sbjct: 676 DAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIV--DRETLILDEPIDGSSHALV-- 731

Query: 872 KLRAINDHQISQQDMNTLALVIDGKSL---------GFALEPDLEEFLLAIGKMCRAVI- 921
            +R +N+  +  +  N  A   D K +         G AL+      LL   K  R VI 
Sbjct: 732 -MRDVNETIV--KPFNPDADTFDEKEIFQKYDLAVTGHALK------LLQGHKQLRDVIR 782

Query: 922 ----CCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGI-----SGMEG 972
                 RVSP QK  ++  +K      L+  GDG NDV  ++ AHVG+ +       ++ 
Sbjct: 783 HTWIYARVSPSQKEFILITLKDMGYQTLMC-GDGTNDVGALKQAHVGIALLNGTEDSLKK 841

Query: 973 MQAARSAD 980
           +Q  R  D
Sbjct: 842 LQEQRKID 849

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
            involved in Na+ efflux, hypothetical start
          Length = 1082

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 128/572 (22%), Positives = 230/572 (40%), Gaps = 126/572 (22%)

Query: 500  NLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLVEELGQIEYIFSDKTG 559
            +++P SL V + +     A ++A+             ++R    +E LG +  I SDKTG
Sbjct: 323  SMIPSSLVVVLTITMSAGAKVMAT----------RHVIIRKLDSLEALGAVNDICSDKTG 372

Query: 560  TLTQNVM--------EFKSCSIAGR--------CYIQSIPE------DKDAAFDEGIEVG 597
            TLTQ  M        +F + ++             IQ IP+        D   D G+   
Sbjct: 373  TLTQGKMIAKQVWIPQFGTINVQNSNEPFNPTIGEIQLIPKFSPYQYKHDDEEDVGMITD 432

Query: 598  YRTYDDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQA-ASPDEGALVQ 656
            +++     EL    G  + ++  ++L   ++ + +   F++  +  ++A   P E A+  
Sbjct: 433  FKSKYYADEL----GPLNVSLFTQWLYTATLAN-IATVFRDPETQDWKAHGDPTEIAIQV 487

Query: 657  GAA--DLGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRF---PDNS 711
             A   DL  + +  + N      ++I  ++ +E +    F+S+ KRMSAI++    P   
Sbjct: 488  FATRMDLPRRVLTGEDNDD---EKNIHNDITFEHVAEYPFDSSVKRMSAIYKNVEEPKAP 544

Query: 712  I-RLLCKGADTVILERLAATSNPY---------------VAATLRHLEDYAAEGLRTLCI 755
            I  +  KGA     ER+    N +               +    ++++  ++EGLR L  
Sbjct: 545  IYEVFTKGA----FERVLQCCNSWYTTPDGSPQPLTEEDLETVQKNVDTLSSEGLRVLAF 600

Query: 756  ASRTIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPE 815
            A +T  ES++            T++   ++L K  + +E  L  LG   I D  +     
Sbjct: 601  AKKTFNESQF------------TINK--DKLLKERDFVENNLTFLGLVGIYDPPRRESLA 646

Query: 816  TIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLL---IVNEDTKESTRNNLIDK 872
             +     AGI V +LTGD   TA +I     +L  ++      +VN     +T       
Sbjct: 647  AVKKCHLAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMTAT------D 700

Query: 873  LRAINDHQISQQDMNTLALVIDGKSLGFALEPDLEEFLLAIGKMCRAVICCRVSPLQKAL 932
              A++D +I +  +  L LVI                              R +P  K  
Sbjct: 701  FDALSDKEIDE--LPVLPLVI-----------------------------ARCAPQTKVR 729

Query: 933  VVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA-DFALGQFKYLKK 991
            +++ + RR +   +  GDG ND   ++ A+VG+ + G+ G   A+ A D  L    +   
Sbjct: 730  MIEALHRRNRFCAMT-GDGVNDSPSLKIANVGIAM-GINGSDVAKDASDIVLSDDNFASI 787

Query: 992  LLLV-HGSWSYQRISQAILYSFYKNI--ALYM 1020
            L  V  G      I + +L    +N+  ALY+
Sbjct: 788  LNAVEEGRRMSDNIQKFVLQLLAENVAQALYL 819

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
           Ca2+-transporting P-type ATPase, member of the cation
           transporting (E1-E2) P-type ATPase superfamily,
           functions to pump Ca2+ into the vacuole [3522 bp, 1173
           aa]
          Length = 1173

 Score = 60.8 bits (146), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 73/327 (22%), Positives = 133/327 (40%), Gaps = 62/327 (18%)

Query: 669 KPNSVTILREDITEEV-VYELLNICEFNSTRKRMSAIFRFPDNS-----IRLLCKGADTV 722
           +P  +  LR+   E+  + +++    F S+RK    + ++ +        R   KGA  +
Sbjct: 589 QPGELQYLRDQPMEKFNIEKVVQTIPFESSRKWAGLVVKYKEGKNKKPFYRFFIKGAAEI 648

Query: 723 ILERLAATSNP----------YVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLY 772
           + +  +   N               T   +++ A++ LR + +A +   E +     +L 
Sbjct: 649 VSKNCSYKRNSDDTLEEINEDNKKETDDEIKNLASDALRAISVAHKDFCECDSWPPEQLR 708

Query: 773 DAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTG 832
           D  +  +      LD +    +KGL+L G   I+D L+ GV E++   Q+AG+ V ++TG
Sbjct: 709 DKDSPNI----AALDLLFNS-QKGLILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTG 763

Query: 833 DRQETAINIGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALV 892
           D   TA  I  +C +LS D     ++ +   +       KL                   
Sbjct: 764 DNILTAKAIARNCAILSTD-----ISSEAYSAMEGTEFRKLT------------------ 800

Query: 893 IDGKSLGFALEPDLEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGA 952
              K+    + P+L              +  R SP  K L+V+ +K     ++   GDG 
Sbjct: 801 ---KNERIRILPNLR-------------VLARSSPEDKRLLVETLK-GMGDVVAVTGDGT 843

Query: 953 NDVSMIQAAHVGVGISGMEGMQAARSA 979
           ND   ++ A VG  + G+ G + AR A
Sbjct: 844 NDAPALKLADVGFSM-GISGTEVAREA 869

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 59/281 (20%), Positives = 119/281 (42%), Gaps = 47/281 (16%)

Query: 298 IAVGDIIRVRSEEAIPADLIVLSSSEPEGLCYIETANLDGETNLKIKQARPETSKILDVR 357
           + VGD+I +++ + +PAD +++S     G C  + +++ GE+N    Q  P  + + D +
Sbjct: 210 VLVGDVISLQTGDVVPADCVMIS-----GKCEADESSITGESN--TIQKFPVDNSLRDFK 262

Query: 358 ELSAMRGKILSEQPNTSLYTYEGTMILHNNRIPLSPDQILLRGATL-----RNTVWIFGI 412
           + +++     S+  +      +G  I          D +L+ G+ +     R  +   GI
Sbjct: 263 KFNSIDSHNHSKPLDIGDVNEDGNKI---------ADCMLISGSRILSGLGRGVITSVGI 313

Query: 413 VIFTGHE-TKLTRNATATPIKRTAVERVINLQIVALFGVLIC-LSLISSFGNLIVMYNQK 470
               G   T L     +TP++    +   N+ +      +I  L L + +   I+  + +
Sbjct: 314 NSVYGQTMTSLNAEPESTPLQLHLSQLADNISVYGCVSAIILFLVLFTRYLFYIIPEDGR 373

Query: 471 ENLSYLYLQGTNMVALFFKNILTFWILFSNLVPISL-----FVTVEMIKYYQAYMIASDL 525
            +      +G+  + +F  +I    +     +P+++     F T  M K           
Sbjct: 374 FHDLDPAQKGSKFMNIFITSITVIVVAVPEGLPLAVTLALAFATTRMTK----------- 422

Query: 526 DLFHEESNMPTVVRTSSLVEELGQIEYIFSDKTGTLTQNVM 566
                + N+  V+R+    E +G    + SDKTGTLT+NVM
Sbjct: 423 -----DGNLVRVLRS---CETMGSATAVCSDKTGTLTENVM 455

>CAGL0J01870g 181666..184506 highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1, hypothetical
           start
          Length = 946

 Score = 60.5 bits (145), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 104/457 (22%), Positives = 172/457 (37%), Gaps = 129/457 (28%)

Query: 537 VVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKS--CSIAGRCYIQSIPEDKDAAFDEGI 594
           +VR    VE LG +  I +DKTGTLT N M      C  +   Y  +I  ++D+ FD   
Sbjct: 359 IVRRLPSVETLGSVNVICTDKTGTLTTNHMTVSKLFCLDSSGTYENAISPEEDSEFD--- 415

Query: 595 EVGYRTYDDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPDEGAL 654
                 +D+               + E LT+ +IC+      + N  I     +P + AL
Sbjct: 416 -----VHDND--------------VKETLTIANICNNAKYSEEHNLYI----GNPTDVAL 452

Query: 655 VQGAADLGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPDNSIRL 714
           ++     G            I  +  + E + EL     FNS RK M+           L
Sbjct: 453 IEVLTKFG------------IPDQRDSHEKMEEL----SFNSKRKYMAIKSSKESGEHVL 496

Query: 715 LCKGADTVILERLAATSNPYV--AATLRHLEDY------------AAEGLRTLCIASRTI 760
             KGA     ER+   S+ Y+  A  +R  +++            A++GLRT+  A +  
Sbjct: 497 YIKGA----FERILDKSSYYLDKAGEVREFDEHSKVMVLEAAHSCASDGLRTIACAFK-- 550

Query: 761 PESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTL 820
                           T   N   E D        GL   G   + D  +  V  +I  L
Sbjct: 551 ---------------PTDSDNVISEDDI------NGLTFTGLFGLADPPRPNVKASIEKL 589

Query: 821 QQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQ 880
            + G+ + ++TGD   TA++I     L  +D          +ES+          +   +
Sbjct: 590 HRGGVHIIMITGDSVNTAVSIAEKIGLSVQD----------RESS---------VMTGDK 630

Query: 881 ISQQDMNTLALVIDGKSLGFALEPDLEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRR 940
           +S+   + L+ VID                       +  I  R +P  K  +VK +++R
Sbjct: 631 VSELTEDELSKVID-----------------------KVNIFARATPENKLNIVKALRKR 667

Query: 941 TKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAAR 977
              ++   GDG ND   ++ A +G+ + G+ G   A+
Sbjct: 668 -GDIVAMTGDGVNDAPALKLADIGIAM-GISGTDVAK 702

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
            (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 83/352 (23%), Positives = 137/352 (38%), Gaps = 72/352 (20%)

Query: 685  VYELLNICEFNSTRKRMSAIF-RFPDNSIR-LLCKGADTVILERLA--------ATSNPY 734
            +YE      F+S+ KRMSA++    D + R +  KGA   +L+             ++P 
Sbjct: 522  IYEHAAEFPFDSSIKRMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPL 581

Query: 735  VAATL----RHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATTMHNRSEELDKVA 790
                L    ++++  + EGLR L  A++TIP  E E              +  E L K  
Sbjct: 582  TEDDLEIIQKNVDTLSNEGLRVLAFATKTIPAEEAE--------------SLGERLTKDR 627

Query: 791  EMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSE 850
            + +E  L+  G   I D  +      +    +AGI V +LTGD   TA  I     +L  
Sbjct: 628  DFVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPH 687

Query: 851  DMNLL---IVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLGFALEPDLE 907
            ++      +V+     +T      +  ++ D ++ Q  +  L LVI              
Sbjct: 688  NLYHYPKEVVDIMVMTAT------QFDSLTDEELDQ--LPVLPLVI-------------- 725

Query: 908  EFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGI 967
                            R +P  K  ++  + RR K   +  GDG ND   ++ A+VG+ +
Sbjct: 726  ---------------ARCAPQTKVRMIDALHRREKFCAMT-GDGVNDSPSLKKANVGIAM 769

Query: 968  SGMEGMQAARSA-DFALGQFKYLKKLLLV-HGSWSYQRISQAILYSFYKNIA 1017
             G+ G   A+ A D  L    +   L  V  G      I + +L     N+A
Sbjct: 770  -GINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAANVA 820

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 74/309 (23%), Positives = 124/309 (40%), Gaps = 51/309 (16%)

Query: 267 KRSNSDKELNHSRADVYSDEMGQFISKKWIDIAVGDIIRVRSEEAIPADLIV---LSSSE 323
           K  NS K+L+   A V  +  G+ +      +  GDI++VR  + +PADL +   L+   
Sbjct: 121 KTMNSLKDLSTPSARVIRN--GEDVVMASAQVVPGDIVQVRVGDTVPADLRLVEALNLET 178

Query: 324 PEGLCYIETANLDGETNLKIKQARPETSKI-LDVRELSAMRGKILSEQPNTSLYTYEGTM 382
            E L   E   +  +     +Q  P   ++ L     +  +G+       T L +  G +
Sbjct: 179 DEALLTGEALPVAKDPAAVFEQDTPVGDRLNLAFASSTVSKGRATGIVVRTGLRSEIGKI 238

Query: 383 I--LHNNRIPLSPDQILLRGATLRNTVWIFGIVIFTGHETKLTRNATATPIKRTAVERVI 440
              L   +  +S D+     + L+NTV              LT  A+      T V   +
Sbjct: 239 AESLQGKQSLISRDE---NKSGLQNTV--------------LTVKASVGSFLGTNVGTPL 281

Query: 441 NLQIVALFGVLICLSLISSFGNLIVMYNQKENLSYLYLQGTNMVALFFKNILTFWILFSN 500
           + ++  L  +L  ++++ +   LIVM  QK  ++         VAL             +
Sbjct: 282 HRKLAKLALILFAIAVLFA---LIVMATQKFIVNREVAIYAICVAL-------------S 325

Query: 501 LVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLVEELGQIEYIFSDKTGT 560
           ++P SL V + +     A ++          S    +VR    +E LG +  I SDKTGT
Sbjct: 326 MIPSSLVVVLTITMSAGAKVM----------STRNVIVRRLDSLEALGAVNDICSDKTGT 375

Query: 561 LTQNVMEFK 569
           LTQ  M  K
Sbjct: 376 LTQGKMILK 384

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
           (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 71/299 (23%), Positives = 122/299 (40%), Gaps = 45/299 (15%)

Query: 693 EFNSTRKRMSAIFRFPDNSIRLLCKGADTVILERLAATSNPYVAATLRHLEDYAAEGLRT 752
           +F+S  KR S I          + KGA   I ERL+     Y        + +   G R 
Sbjct: 582 QFSSALKRSSTIAVHNKQHYSAV-KGAPETIRERLSQVPTDYDQV----YKSFTRAGSRV 636

Query: 753 LCIASRTIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDG 812
           L +AS+ +P    ++  KL                   E +E  L   G       L+D 
Sbjct: 637 LALASKKLPSMSIKQIEKLER-----------------EAVESDLEFKGFLVFHCPLKDD 679

Query: 813 VPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLLIVNEDTKESTR----NN 868
             ETI  L ++  +  ++TGD   TA+++     ++  +   LI++E    S+      N
Sbjct: 680 AIETIKMLNESSHRCIMITGDNPLTAVHVAKEVAIVERET--LILDEPIDGSSHALVFRN 737

Query: 869 LIDKLRAINDHQISQQDMNTLALVIDGKSLGFALEPDLEEFLLA----IGKMCRAV-ICC 923
           + + +    + +    + + L    D    G AL+      LL+    + ++ R   +  
Sbjct: 738 IEETIVNPFNPEKDTFEHSKLFAKYDIAVTGHALQ------LLSGHSQLNELIRHTWVYA 791

Query: 924 RVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGI-----SGMEGMQAAR 977
           RVSP QK  ++  +K      L+  GDG NDV  ++ AHVG+ +      G++ +Q  R
Sbjct: 792 RVSPAQKEFIMNSLKDMGYQTLMC-GDGTNDVGALKQAHVGIALLNGTEEGLKKLQEQR 849

>Kwal_14.1498
          Length = 939

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 98/465 (21%), Positives = 171/465 (36%), Gaps = 127/465 (27%)

Query: 537 VVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKSC----SIAGRCYIQSIPEDKDAAFDE 592
           ++R    VE LG +  I SDKTGTLT N M         S++ +  I  + +    +F +
Sbjct: 347 IIRRLPSVETLGSVNVICSDKTGTLTANHMSVNKVWCLGSMSNKSNILKLDKATSGSFKK 406

Query: 593 GIEVGYRTYDDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAA----S 648
            +       +D+   L T                ++C+        N +  ++ A    +
Sbjct: 407 NLT------EDLRATLRTG---------------NLCN--------NSTYSHEHAKYLGN 437

Query: 649 PDEGALVQGAADLGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFP 708
           P + AL++    + +KF +          ++I+            FNS RK M+   +  
Sbjct: 438 PTDIALLE----VLHKFGLEDERPQVTRSDEIS------------FNSKRKFMAVKVKEA 481

Query: 709 DNSIRLLCKGADTVILER---LAATSNPYVA--ATLRHL-----EDYAAEGLRTLCIASR 758
           +    +  KGA   ILE+        N  V   + LR       +  A++GLRTL  A  
Sbjct: 482 NGKFVVHVKGAYEKILEKSTHFINAENKVVKLDSNLRQAITDSADALASDGLRTLAFAQL 541

Query: 759 TIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIH 818
            +     +                     K+ E    GL   G   + D  +  V   + 
Sbjct: 542 ELSNGNSK---------------------KLTEDDINGLTFAGLLGMNDPPRPSVKAAVE 580

Query: 819 TLQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKLRAIND 878
            L +  + + ++TGD + TA++I       +  + + +VN +T   T + L        D
Sbjct: 581 RLSEGSVHIIMITGDAENTAVSI-------ARQIGIPVVNPETAVLTGDKL--------D 625

Query: 879 HQISQQDMNTLALVIDGKSLGFALEPDLEEFLLAIGKMCRAVICCRVSPLQKALVVKMVK 938
           H    Q    LA +ID                          I  R +P  K  +V+ ++
Sbjct: 626 HMSEDQ----LASIID-----------------------HVNIFARATPEHKLNIVRALQ 658

Query: 939 RRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAL 983
           +R   ++   GDG ND   ++ A +GV +  M    A  ++D  L
Sbjct: 659 KR-GDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVL 702

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
           Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 108/476 (22%), Positives = 174/476 (36%), Gaps = 150/476 (31%)

Query: 537 VVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKSCSIAG------RCYIQSIPEDKDAAF 590
           +VR    VE LG +  I SDKTGTLT N M        G       C   S  +++    
Sbjct: 347 IVRRLPSVETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALSKVKERPIKM 406

Query: 591 DEGIEVGYRTYDDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGS-----IKYQ 645
           ++ +    R                         + +IC+        NG+     +KY 
Sbjct: 407 EQDVATTLR-------------------------IGNICN--------NGTYSQEHLKY- 432

Query: 646 AASPDEGALVQGAADLGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIF 705
             +P + A+++     G   I    NSV  + E               FNS RK M+   
Sbjct: 433 LGNPTDIAILESLQHFG---INDCRNSVNKINE-------------IPFNSKRKFMAVKT 476

Query: 706 RFPDNSIRLLCKGADTVILERLAATSNPYVA--ATLRHLED------------YAAEGLR 751
              ++ + +  KGA     E++   S  Y+     +  L+              A+EGLR
Sbjct: 477 IDANDKVVVYVKGA----FEKIVEKSINYIGRDGKVHKLKPNDKAIINDAAVALASEGLR 532

Query: 752 TLCIA----SRTIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIED 807
           TL  A    S T  + E+ E                       +M+E GL   G  A+ D
Sbjct: 533 TLAFAELEVSATHGDKEFNE-----------------------DMVE-GLTFTGLIAMND 568

Query: 808 KLQDGVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLLIVNEDTKESTRN 867
             +  V   I  L Q  + V ++TGD + TA++I       +  + + ++N +    +  
Sbjct: 569 PPRPTVRSAIEELLQGSVHVIMITGDAENTAVSI-------ARQIGIPVINPEYSVLSG- 620

Query: 868 NLIDKLRAINDHQISQQDMNTLALVIDGKSLGFALEPDLEEFLLAIGKMCRAVICCRVSP 927
              DKL  + D Q        LA VID  ++ FA                      R +P
Sbjct: 621 ---DKLDQMTDDQ--------LASVIDHVNV-FA----------------------RATP 646

Query: 928 LQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAL 983
             K  +V+ +++R   ++   GDG ND   ++ A +GV +  M    A  ++D  L
Sbjct: 647 EHKLNIVRALQKR-GDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVL 701

 Score = 30.8 bits (68), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 52/106 (49%), Gaps = 10/106 (9%)

Query: 263 VEDLKRSNSDKELNH-SRADVYSDEMGQFISKKWIDIAVGDIIRVRSEEAIPADLIVLSS 321
           V++ K   S + LN    A+ +    GQ       ++  GD++R +  + IPADL ++ S
Sbjct: 128 VQEYKSEKSLEALNKLVPAECHLTRSGQLSHVLASNLVPGDLVRFKVGDRIPADLRIVES 187

Query: 322 SEPEGLCYIETANLDGETNLKIKQARPETSKILDVRELSAMRGKIL 367
            +   LC ++ +NL GE      +   ++S  +D +  S + G I+
Sbjct: 188 ID---LC-VDESNLTGE-----NEPVHKSSGAVDPKNYSHIPGSII 224

>Kwal_47.17522
          Length = 899

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 95/453 (20%), Positives = 160/453 (35%), Gaps = 160/453 (35%)

Query: 537 VVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKSCSIAGRCYIQSIPEDKDAAFDEGIEV 596
           +V+  S +E L  +E + SDKTGTLT+N +                              
Sbjct: 340 IVQKLSAIESLAGVEILCSDKTGTLTKNKLS----------------------------- 370

Query: 597 GYRTYDDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPDEGALVQ 656
                      LH P + +G   D+   +L+ C                AAS  +  L  
Sbjct: 371 -----------LHEPYTVEGVEPDDL--MLTAC---------------LAASRKKKGL-- 400

Query: 657 GAADLGY-KFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPDNSIRLL 715
            A D  + K +I+ P +   L +       Y++L+   F+   K+++A+   P+   R++
Sbjct: 401 DAIDKAFLKSLIQYPRAKNALTK-------YKVLDFHPFDPVSKKVTAVVESPEGE-RII 452

Query: 716 C-KGADTVILERLAATSNPYVAATLRHLEDYAAE----GLRTLCIASRTIPESEYEEWSK 770
           C KGA   +L +     +P       + E+  AE    G R L +A R   E  +E    
Sbjct: 453 CVKGAPLFVL-KTVEEDHPIPEDVHENYENKVAELASRGFRALGVA-RKRGEGHWE---- 506

Query: 771 LYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVL 830
                                       +LG     D  +D   +T+H  ++ G++V +L
Sbjct: 507 ----------------------------ILGVMPCMDPPRDDTAQTVHEARRLGLRVKML 538

Query: 831 TGD----RQETAINIGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDM 886
           TGD     +ET   +G+   + + +   L    D   S   + ++               
Sbjct: 539 TGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSELADFVE--------------- 583

Query: 887 NTLALVIDGKSLGFALEPDLEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLL 946
                     + GFA                       V P  K  VV+++++R   L+ 
Sbjct: 584 ---------NADGFA----------------------EVFPQHKYSVVEILQQR-GYLVA 611

Query: 947 AIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 979
             GDG ND   ++ A  G+ + G     AARSA
Sbjct: 612 MTGDGVNDAPSLKKADTGIAVEG--ATDAARSA 642

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 96/453 (21%), Positives = 157/453 (34%), Gaps = 160/453 (35%)

Query: 537 VVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKSCSIAGRCYIQSIPEDKDAAFDEGIEV 596
           +V+  S +E L  +E + SDKTGTLT+N +                              
Sbjct: 340 IVQKLSAIESLAGVEILCSDKTGTLTKNKLS----------------------------- 370

Query: 597 GYRTYDDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPDEGALVQ 656
                      LH P + +G   D+   +L+ C                AAS  +  L  
Sbjct: 371 -----------LHEPYTVEGVDPDDL--MLTAC---------------LAASRKKKGL-- 400

Query: 657 GAADLGY-KFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPDNSIRLL 715
            A D  + K +I  P +   L +       Y+LL    F+   K+++AI   P+   R++
Sbjct: 401 DAIDKAFLKSLISYPRAKAALTK-------YKLLEFHPFDPVSKKVTAIVESPEGE-RII 452

Query: 716 C-KGADTVILERLAATSNPYVAATLRHLEDYAAE----GLRTLCIASRTIPESEYEEWSK 770
           C KGA   +L +     +P       + E+  AE    G R L +A R   E  +E    
Sbjct: 453 CVKGAPLFVL-KTVEEEHPIPEDVRENYENKVAELASRGFRALGVA-RKRGEGHWE---- 506

Query: 771 LYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVL 830
                                       +LG     D  +D   +T++  +  G++V +L
Sbjct: 507 ----------------------------ILGVMPCMDPPRDDTAQTVNEARHLGLRVKML 538

Query: 831 TGD----RQETAINIGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDM 886
           TGD     +ET   +G+   + + +   L    D   S   + ++               
Sbjct: 539 TGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSELADFVE--------------- 583

Query: 887 NTLALVIDGKSLGFALEPDLEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLL 946
                     + GFA                       V P  K  VV+++++R   L+ 
Sbjct: 584 ---------NADGFA----------------------EVFPQHKYNVVEILQQR-GYLVA 611

Query: 947 AIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 979
             GDG ND   ++ A  G+ + G     AARSA
Sbjct: 612 MTGDGVNDAPSLKKADTGIAVEG--ATDAARSA 642

>Kwal_56.23467
          Length = 280

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 76/182 (41%), Gaps = 22/182 (12%)

Query: 1085 WPATIFRGSAINGNYHNWITIDGWIMDYRYGAAGAMHGETADHWVWGVAIQPTSIIFVLG 1144
            W  T F    ++G Y + I+     + Y      + +G   DH  W V I   SI  V  
Sbjct: 5    WNLTKFWLYMVDGLYQSVISFFFPFLAYYKTGMVSPNGLGLDHRYW-VGILVGSIASVSC 63

Query: 1145 KAALITNQ--WTKFTVLAIPGSLVFWLLFFPIYAY--LLPGLNVSKEYYGIVSHVYGSFT 1200
               ++ +Q  W  F+ L I  S +       +Y +  +      S E+Y   +HVYGS  
Sbjct: 64   NLYILIHQFRWDWFSTLFIALSCLV------VYGWTGIWSTFTTSGEFYKSAAHVYGSPI 117

Query: 1201 FWAMCYVXXXXXXXXXXXWKYYKRTYTPESYHVVQEM----------QKYDISD-NRPRI 1249
            +WA+ +V           +  +++ + P+   +++E           + YD +D NRP+I
Sbjct: 118  YWAIFFVGVLFCLLPRFTFDVFQKMFFPKDIDIIREFWVQGHFDQYPEDYDPTDPNRPQI 177

Query: 1250 EQ 1251
             +
Sbjct: 178  AK 179

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score = 38.9 bits (89), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 104/507 (20%), Positives = 178/507 (35%), Gaps = 166/507 (32%)

Query: 484 VALFFKNILTFWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSL 543
           VA F+++I    IL   L    + V V +       M      L  +++    +V+  S 
Sbjct: 291 VACFYRSIDIVTILRYTLAITVVGVPVGLPAVVTTTMAVGAAYLAKKKA----IVQKLSA 346

Query: 544 VEELGQIEYIFSDKTGTLTQNVMEFKSCSIAGRCYIQSIPEDKDAAFDEGIEVGYRTYDD 603
           +E L  +E + SDKTGTLT+N +                                     
Sbjct: 347 IESLAGVEILCSDKTGTLTKNKLS------------------------------------ 370

Query: 604 MHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPDEGALVQGAADLGY 663
               LH P + +G   D+   +L+ C                AAS  +  L   A D  +
Sbjct: 371 ----LHEPYTVEGVEADDL--MLTAC---------------LAASRKKKGL--DAIDKAF 407

Query: 664 -KFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPDNSIRLLC-KGADT 721
            K +I  P +   L +       Y++L    F+   K+++AI   P+   R++C KGA  
Sbjct: 408 LKSLINYPRAKAALTK-------YKVLEFHPFDPVSKKVTAIVESPEGE-RIVCVKGAPL 459

Query: 722 VILERLAATSNPYVAATLRH-----LEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAA 776
            +L+ +    N  +   ++      + + A+ G R L +A R   E  +E          
Sbjct: 460 FVLKTV--EENHLIPEDVKENYENKVAELASRGYRALGVA-RKRGEGHWE---------- 506

Query: 777 TTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGD--- 833
                                 +LG     D  +D   +T++  +  G++V +LTGD   
Sbjct: 507 ----------------------ILGVMPCMDPPRDDTAQTVNEARHLGLRVKMLTGDAVG 544

Query: 834 -RQETAINIGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALV 892
             +ET   +G+   + + +   L    D   S   + ++                     
Sbjct: 545 IAKETCRQLGLGTNIYNAERLGLGGGGDMPGSELADFVE--------------------- 583

Query: 893 IDGKSLGFALEPDLEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGA 952
               + GFA                       V P  K  VV+++++R   L+   GDG 
Sbjct: 584 ---NADGFA----------------------EVFPQHKYNVVEILQQR-GYLVAMTGDGV 617

Query: 953 NDVSMIQAAHVGVGISGMEGMQAARSA 979
           ND   ++ A  G+ + G     AARSA
Sbjct: 618 NDAPSLKKADTGIAVEG--ATDAARSA 642

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score = 38.1 bits (87), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 94/450 (20%), Positives = 161/450 (35%), Gaps = 154/450 (34%)

Query: 537 VVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKSCSIAGRCYIQSIPEDKDAAFDEGIEV 596
           +V+  S +E L  +E + SDKTGTLT+N +                              
Sbjct: 388 IVQKLSAIESLAGVEILCSDKTGTLTKNKLS----------------------------- 418

Query: 597 GYRTYDDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPDEGALVQ 656
                      LH P + +G   D+   +L+ C                AAS  +  L  
Sbjct: 419 -----------LHEPYTVEGVSPDDL--MLTAC---------------LAASRKKKGL-- 448

Query: 657 GAADLGY-KFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPDNSIRLL 715
            A D  + K +I  P +    ++ +T+   Y++L    F+   K+++A+   P+   R++
Sbjct: 449 DAIDKAFLKSLIEYPKA----KDALTK---YKVLEFHPFDPVSKKVTAVVESPEGE-RIV 500

Query: 716 C-KGADTVILERLAATSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDA 774
           C KGA   +L+ +               ED+              IPE  +E     Y+ 
Sbjct: 501 CVKGAPLFVLKTVE--------------EDHP-------------IPEDVHEN----YEN 529

Query: 775 AATTMHNRSEELDKVAEMIEKG-LVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGD 833
               + +R      VA    +G   +LG     D  +D   +TI+  +  G+++ +LTGD
Sbjct: 530 KVAELASRGFRALGVARKRGEGHWEILGVMPCMDPPRDDTAQTINEARNLGLRIKMLTGD 589

Query: 834 ----RQETAINIGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTL 889
                +ET   +G+   + + +   L    D   S   + ++                  
Sbjct: 590 AVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSELADFVE------------------ 631

Query: 890 ALVIDGKSLGFALEPDLEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIG 949
                  + GFA                       V P  K  VV++++ R   L+   G
Sbjct: 632 ------NADGFA----------------------EVFPQHKYRVVEILQNR-GYLVAMTG 662

Query: 950 DGANDVSMIQAAHVGVGISGMEGMQAARSA 979
           DG ND   ++ A  G+ + G     AARSA
Sbjct: 663 DGVNDAPSLKKADTGIAVEG--ATDAARSA 690

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 89/440 (20%), Positives = 157/440 (35%), Gaps = 152/440 (34%)

Query: 537 VVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKSCSIAGRCYIQSIPEDKDAAFDEGIEV 596
           +V+  S +E L  +E + SDKTGTLT+N +                              
Sbjct: 343 IVQKLSAIESLAGVEILCSDKTGTLTKNKLS----------------------------- 373

Query: 597 GYRTYDDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPDEGALVQ 656
                      LH P + +G   D+   +L+ C                AAS  +  L  
Sbjct: 374 -----------LHEPYTVEGVSADDL--MLTAC---------------LAASRKKKGL-- 403

Query: 657 GAADLGY-KFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPDNSIRLL 715
            A D  + K +I  P +    ++ +T+   Y+++    F+   K+++A+   P+   R++
Sbjct: 404 DAIDKAFLKSLINYPKA----KDALTK---YKVIEFHPFDPVSKKVTAVVESPEGE-RIV 455

Query: 716 C-KGADTVILERLAATSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDA 774
           C KGA   +L+ +               ED+              IPE  +E     Y+ 
Sbjct: 456 CVKGAPLFVLKTVE--------------EDHP-------------IPEDVHEN----YEN 484

Query: 775 AATTMHNRSEELDKVAEMIEKG-LVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGD 833
               + +R      VA    +G   +LG     D  +D   ET++  ++ G++V +LTGD
Sbjct: 485 KVAELASRGFRALGVARKRGEGHWEILGVMPCMDPPRDDTAETVNEARRLGLRVKMLTGD 544

Query: 834 ----RQETAINIGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTL 889
                +ET   +G+   + + +   L    D   S   + ++                  
Sbjct: 545 AVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSELADFVE------------------ 586

Query: 890 ALVIDGKSLGFALEPDLEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIG 949
                  + GFA                       V P  K  VV++++ R   L+   G
Sbjct: 587 ------NADGFA----------------------EVFPQHKYKVVEILQNR-GYLVAMTG 617

Query: 950 DGANDVSMIQAAHVGVGISG 969
           DG ND   ++ A  G+ + G
Sbjct: 618 DGVNDAPSLKKADTGIAVEG 637

>Scas_569.0d
          Length = 468

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 920 VICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 979
           ++  R SP  K  +++ + RR K   +  GDG ND   ++ A+VG+ + G+ G   A+ A
Sbjct: 103 LVIARCSPQTKVRMIEALHRRDKFCAMT-GDGVNDSPSLKMANVGIAM-GINGSDVAKDA 160

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score = 35.0 bits (79), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 63/303 (20%), Positives = 108/303 (35%), Gaps = 93/303 (30%)

Query: 686 YELLNICEFNSTRKRMSAIFRFPDNSIRLLC-KGADTVILERLAATSNPYVAATLRHLED 744
           Y++L    F+   K+++A+   P+   R++C KGA   +L+ +    +P       + E+
Sbjct: 443 YKVLEFHPFDPVSKKVTAVVESPEGE-RIVCVKGAPLFVLKTVE-EDHPIPEDVHENYEN 500

Query: 745 YAAE----GLRTLCIASRTIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLL 800
             AE    G R L +A R   E  +E                                +L
Sbjct: 501 KVAELASRGFRALGVA-RKRGEGHWE--------------------------------IL 527

Query: 801 GATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDR----QETAINIGMSCKLLSEDMNLLI 856
           G     D  +D   +T+   +  G++V +LTGD     +ET   +G+   + + +   L 
Sbjct: 528 GVMPCMDPPRDDTAQTVSEARHLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLG 587

Query: 857 VNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLGFALEPDLEEFLLAIGKM 916
              D   S   + ++                         + GFA               
Sbjct: 588 GGGDMPGSELADFVEN------------------------ADGFA--------------- 608

Query: 917 CRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAA 976
                   V P  K  VV++++ R   L+   GDG ND   ++ A  G+ + G     AA
Sbjct: 609 -------EVFPQHKYRVVEILQNR-GYLVAMTGDGVNDAPSLKKADTGIAVEG--ATDAA 658

Query: 977 RSA 979
           RSA
Sbjct: 659 RSA 661

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 537 VVRTSSLVEELGQIEYIFSDKTGTLTQN 564
           +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 359 IVQKLSAIESLAGVEILCSDKTGTLTKN 386

>Scas_710.41
          Length = 904

 Score = 34.7 bits (78), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 62/302 (20%), Positives = 106/302 (35%), Gaps = 91/302 (30%)

Query: 686 YELLNICEFNSTRKRMSAIFRFPDNSIRLLCKGADTVILERLAATSNPYVAATLRHLEDY 745
           Y++L    F+   K+++A+ + P+       KGA   +L+ +    +P       + E+ 
Sbjct: 430 YKILEFHPFDPVSKKVTAVVKSPEGETITCVKGAPLFVLKTVE-EDHPVPEDVHENYENK 488

Query: 746 AAE----GLRTLCIASRTIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLG 801
            AE    G R+L +A R   E  +E                                +LG
Sbjct: 489 VAELASRGFRSLGVA-RKRGEGYWE--------------------------------ILG 515

Query: 802 ATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDR----QETAINIGMSCKLLSEDMNLLIV 857
                D  +D    TI   +  G++V +LTGD     +ET+  +G+   + + +   L  
Sbjct: 516 VMPCMDPPRDDTARTIAEARTLGLRVKMLTGDAVGIAKETSRQLGLGVNIYNAEKLGLGG 575

Query: 858 NEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLGFALEPDLEEFLLAIGKMC 917
             D   S   + ++                         + GFA                
Sbjct: 576 GGDMPGSELADFVEN------------------------ADGFA---------------- 595

Query: 918 RAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAAR 977
                  V P  K  VV++++ R   L+   GDG ND   ++ A  G+ + G     AAR
Sbjct: 596 ------EVFPQHKYKVVEILQNR-GYLVAMTGDGVNDAPSLKKADTGIAVEG--ATDAAR 646

Query: 978 SA 979
           SA
Sbjct: 647 SA 648

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 537 VVRTSSLVEELGQIEYIFSDKTGTLTQN 564
           +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 346 IVQKLSAIESLAGVEILCSDKTGTLTKN 373

>Scas_297.1
          Length = 800

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 921 ICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 979
           +  R SP  K L+V+ +K     ++   GDG ND   ++ A VG  + G+ G + AR A
Sbjct: 51  VMARSSPEDKRLLVETLKG-MGDVVAVTGDGTNDAPALKLADVGFSM-GISGTEVAREA 107

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 34/51 (66%), Gaps = 6/51 (11%)

Query: 297 DIAVGDIIRVRSEEAIPADLIVLSSSEPEGLCYIETANLDGETNLKIKQAR 347
           ++ VGDII +++ + IPAD +++     EG C ++ +++ GE++  IK+ +
Sbjct: 615 NLLVGDIITLQTGDVIPADGVLV-----EGQCEVDESSITGESD-TIKKVK 659

>Kwal_27.10623
          Length = 1142

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/105 (20%), Positives = 45/105 (42%), Gaps = 9/105 (8%)

Query: 688 LLNICEFNSTRKRMSAIFRFPDNSIRLLCKGADTVILERLAATSNPYVAATLRHLEDYAA 747
           L +   F+S     + +F+  D +  +LC    T+  +  +     YV       E Y +
Sbjct: 321 LFSALSFDSKTDAQNCVFQLADGNTTILCNHFVTLTADSPSIILQKYVGVVSSEYERYDS 380

Query: 748 -----EGLRTLCIASRT----IPESEYEEWSKLYDAAATTMHNRS 783
                E  + + + S++    + E+ ++EW  LYD A+  + + S
Sbjct: 381 SVTNMEAAKKIALTSKSKFSELVETHHQEWIDLYDNASVDIPSDS 425

>Scas_688.1
          Length = 913

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 64/303 (21%), Positives = 109/303 (35%), Gaps = 93/303 (30%)

Query: 686 YELLNICEFNSTRKRMSAIFRFPDNSIRLLC-KGADTVILERLAATSNPYVAATLRHLED 744
           Y++L    F+   K+++A+   P+   R++C KGA   +L+ +    +P       + E+
Sbjct: 438 YKVLEFHPFDPVSKKVTAVVESPEGE-RIICVKGAPLFVLKTVE-EDHPIPEDIHENYEN 495

Query: 745 YAAE----GLRTLCIASRTIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLL 800
             AE    G R L +A R   E  +E                                +L
Sbjct: 496 KVAELASRGFRALGVA-RKRGEGHWE--------------------------------IL 522

Query: 801 GATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDR----QETAINIGMSCKLLSEDMNLLI 856
           G     D  +D   ET+   ++ G++V +LTGD     +ET   +G+   + + +   L 
Sbjct: 523 GVMPCMDPPRDDTGETVAEARRLGLRVKMLTGDAVGIAKETCRQLGLGTNVYNAERLGLS 582

Query: 857 VNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLGFALEPDLEEFLLAIGKM 916
              D   S   + ++                         + GFA               
Sbjct: 583 GGGDMPGSELADFVEN------------------------ADGFA--------------- 603

Query: 917 CRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAA 976
                   V P  K  VV++++ R   L+   GDG ND   ++ A  G+ + G     AA
Sbjct: 604 -------EVFPQDKYRVVEILQTR-GYLVAMTGDGVNDAPSLKKADTGIAVEG--ATDAA 653

Query: 977 RSA 979
           RSA
Sbjct: 654 RSA 656

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 537 VVRTSSLVEELGQIEYIFSDKTGTLTQN 564
           +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 354 IVQKLSAIESLAGVEILCSDKTGTLTKN 381

>Scas_630.14
          Length = 701

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 55/121 (45%), Gaps = 13/121 (10%)

Query: 507 FVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLVEELGQIEYIFSDKTGTLTQNVM 566
           +V V+++++Y   M  S+ D   E + + T+V TS ++     I YI+ DK   +  N+ 
Sbjct: 282 YVQVQLLRWYSLTMYPSNTDTLEEITIVNTLVSTSLMLGLHQDINYIYMDKLPNIIPNLE 341

Query: 567 EFKSCSIAGRCYIQSIPEDKDAAFDEG--IEVGYRTYDDMHELLHTPGSGDGAIIDEFLT 624
                      ++ ++  D   +F  G  ++VG   Y+D +  L        A + +FL 
Sbjct: 342 TL---------WLWTMFADLTTSFKIGKPLQVGTSYYNDAY--LKDSTGTSNARLKKFLL 390

Query: 625 L 625
           L
Sbjct: 391 L 391

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
           cerevisiae YDR270w CCC2 probable copper-transporting
           ATPase, start by similarity
          Length = 975

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 37/72 (51%), Gaps = 4/72 (5%)

Query: 799 LLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLLIVN 858
           L+G   I D++++     +  LQ  GIK  ++TGD  ++A+ +     + + D    + +
Sbjct: 741 LVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQLGISAND----VFS 796

Query: 859 EDTKESTRNNLI 870
           E T E  R+ +I
Sbjct: 797 EVTPEQKRDIVI 808

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 54/136 (39%), Gaps = 20/136 (14%)

Query: 924  RVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAL 983
             V+P QK  +V  ++      +  +GDG ND   +  A +G+ IS    + A  +AD  +
Sbjct: 797  EVTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISISSGTDI-AIEAADIVI 855

Query: 984  ----GQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVLYNAFS---GQSI 1036
                 +   LK L+          I++   Y    N       FW V YN F       +
Sbjct: 856  LDSDNKNNSLKGLVYA------LDIARKTFYRVKLNF------FWAVCYNTFMIPIAMGL 903

Query: 1037 MESWTLTFYNWGGTAA 1052
            +  W +T +    +AA
Sbjct: 904  LAPWGITLHPMLSSAA 919

>YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa subunit
            of elongator and elongating RNA polymerase II holoenzyme,
            has WD (WD-40) repeats [2367 bp, 788 aa]
          Length = 788

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 27/72 (37%), Gaps = 8/72 (11%)

Query: 1065 RSGLLNRDAQSCTVGQKGQFWPATIFRGSAIN--------GNYHNWITIDGWIMDYRYGA 1116
            R G ++    S   G  G FW    F    ++        G++  W T D  I D R G 
Sbjct: 322  RLGEMSSKGASTATGSSGGFWSCLWFTHERMDFFLTNGKTGSWRMWATKDNIICDQRLGI 381

Query: 1117 AGAMHGETADHW 1128
            +GA    T   W
Sbjct: 382  SGATKDVTDIAW 393

>KLLA0D04092g complement(344666..348124) some similarities with
            sp|P38995 Saccharomyces cerevisiae YDR270w CCC2 probable
            copper-transporting ATPase P16.2.f2.1, hypothetical start
          Length = 1152

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 33/70 (47%), Gaps = 9/70 (12%)

Query: 921  ICCRVSPLQKALVVKMVKRRT------KSLLLAIGDGANDVSMIQAAHVGVGI-SGMEGM 973
            +   V P +KA  VK ++           ++  +GDG ND   + AA VG+ + SG E  
Sbjct: 972  VIAEVLPEEKAAKVKWIQHNNIGANGHHKVVAMVGDGINDAPALAAADVGIALASGSE-- 1029

Query: 974  QAARSADFAL 983
             A  S DF L
Sbjct: 1030 LAMTSCDFVL 1039

>YIL140W (AXL2) [2536] chr9 (85366..87837) Membrane glycoprotein
           localized at site of bud emergence, required for axial
           budding pattern [2472 bp, 823 aa]
          Length = 823

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 9/61 (14%)

Query: 81  IENPFDDERGQ------QRYLASANRLSVPQPSGWQRLVGGL---RDSVGGRGTENSQYQ 131
           + NPFDD+          R LA+ N L +   S  +  +  +   RDS+ G  T N Q+Q
Sbjct: 565 LNNPFDDDASSYDDTSIARRLAALNTLKLDNHSATESDISSVDEKRDSLSGMNTYNDQFQ 624

Query: 132 S 132
           S
Sbjct: 625 S 625

>Scas_665.1
          Length = 392

 Score = 30.8 bits (68), Expect = 8.8,   Method: Composition-based stats.
 Identities = 24/83 (28%), Positives = 38/83 (45%), Gaps = 11/83 (13%)

Query: 732 NPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATTMHNRSEELDKVAE 791
           NP++  TL+ + D   E  + +         SE EE+ K+ +     +   S  LDK  +
Sbjct: 82  NPFIQQTLQLIIDTINEKKKKV---------SENEEFKKILETQKAELLEYS--LDKEND 130

Query: 792 MIEKGLVLLGATAIEDKLQDGVP 814
            +  G+    ATAI D   DG+P
Sbjct: 131 RLFDGIFKNSATAIVDDSDDGIP 153

>CAGL0M05379g 574752..575390 highly similar to sp|P38307
           Saccharomyces cerevisiae YBR201w DER1, start by
           similarity
          Length = 212

 Score = 30.0 bits (66), Expect = 9.9,   Method: Composition-based stats.
 Identities = 32/134 (23%), Positives = 60/134 (44%), Gaps = 24/134 (17%)

Query: 403 LRNTVWIFGIVIFTGHETKLTRNATATPIKRTAVERVINLQIVALFGVLICLSLISSFGN 462
           L N + +  IVI   H + L  + +   +KR  V  ++ L + +L G+      ++S G 
Sbjct: 65  LFNWMSLMNIVIAANHLSFLENSFS---LKRRYV-WILFLTLCSLLGMSYFGQPVASLGV 120

Query: 463 LIVMYNQKENLSYLYLQGTN---------------MVALFFKNILTFWILFSNLVPISLF 507
           L+     +ENLSY YL+  N               ++  F+ N L  ++   ++V +++F
Sbjct: 121 LL-----QENLSYYYLKKNNEQMNIRLFGNIAVSPLLVPFYLNCLLLFVYHMDVVEVAMF 175

Query: 508 VTVEMIKYYQAYMI 521
                I +Y   M+
Sbjct: 176 FLPGHIMFYMDDML 189

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 41,287,223
Number of extensions: 1821109
Number of successful extensions: 5221
Number of sequences better than 10.0: 96
Number of HSP's gapped: 5086
Number of HSP's successfully gapped: 169
Length of query: 1287
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1174
Effective length of database: 12,684,275
Effective search space: 14891338850
Effective search space used: 14891338850
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)