Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADR349W32031411361e-157
KLLA0A04037g3021948441e-113
CAGL0G06248g2971948041e-107
Kwal_26.70822992918021e-106
YAL025C (MAK16)3061947761e-102
Scas_663.23041947551e-99
CAGL0F00715g3102065683e-71
YMR306W (FKS3)178572645.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADR349W
         (314 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADR349W [2090] [Homologous to ScYAL025C (MAK16) - SH] complement...   442   e-157
KLLA0A04037g complement(359981..360889) some similarities with s...   329   e-113
CAGL0G06248g 596704..597597 highly similar to sp|P10962 Saccharo...   314   e-107
Kwal_26.7082                                                          313   e-106
YAL025C (MAK16) [43] chr1 complement(100228..101148) Nuclear pro...   303   e-102
Scas_663.2                                                            295   1e-99
CAGL0F00715g complement(80864..81796) similar to sp|P10962 Sacch...   223   3e-71
YMR306W (FKS3) [4260] chr13 (881158..886515) Protein with high s...    29   5.8  

>ADR349W [2090] [Homologous to ScYAL025C (MAK16) - SH]
           complement(1319477..1320439) [963 bp, 320 aa]
          Length = 320

 Score =  442 bits (1136), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 225/314 (71%), Positives = 225/314 (71%)

Query: 1   MRWIREALHSYRIVQGAPPLPMSDEIIWQVINQHFCAYKIKTDKGQNFCRNEYNVTGFCN 60
           MRWIREALHSYRIVQGAPPLPMSDEIIWQVINQHFCAYKIKTDKGQNFCRNEYNVTGFCN
Sbjct: 1   MRWIREALHSYRIVQGAPPLPMSDEIIWQVINQHFCAYKIKTDKGQNFCRNEYNVTGFCN 60

Query: 61  RSSCPLANAKYATVKQVDGKLYLYMKTVERAHTPAKLWERIRLSKNYSTALKQIDEHLLF 120
           RSSCPLANAKYATVKQVDGKLYLYMKTVERAHTPAKLWERIRLSKNYSTALKQIDEHLLF
Sbjct: 61  RSSCPLANAKYATVKQVDGKLYLYMKTVERAHTPAKLWERIRLSKNYSTALKQIDEHLLF 120

Query: 121 WNKFLIHKCKQRLTKLTQVMITERRMALREEERHYVGVAPKVKRRDENXXXXXXXXXXXX 180
           WNKFLIHKCKQRLTKLTQVMITERRMALREEERHYVGVAPKVKRRDEN            
Sbjct: 121 WNKFLIHKCKQRLTKLTQVMITERRMALREEERHYVGVAPKVKRRDENRERKALAAAKIE 180

Query: 181 XXXXXXXXDRLKSGAYGDKPLNVDEKIWKRVMGHVXXXXXXXXXXXXXXXSXXXXXXXXX 240
                   DRLKSGAYGDKPLNVDEKIWKRVMGHV               S         
Sbjct: 181 KAIEKELLDRLKSGAYGDKPLNVDEKIWKRVMGHVEQEQEQDEDYDEDEESDLGEVEYVE 240

Query: 241 XXXXXXXXXXXXXQRWLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAARGPLSKKR 300
                        QRWL                                KAARGPLSKKR
Sbjct: 241 DDGEDDLVEVEDLQRWLDDSDASDASEDSDDSDSEASDSEASDTEDRDSKAARGPLSKKR 300

Query: 301 RPRVEIEYEEESRH 314
           RPRVEIEYEEESRH
Sbjct: 301 RPRVEIEYEEESRH 314

>KLLA0A04037g complement(359981..360889) some similarities with
           sp|P10962 Saccharomyces cerevisiae YAL025c MAK16 nuclear
           viral propagation protein singleton, hypothetical start
          Length = 302

 Score =  329 bits (844), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 151/194 (77%), Positives = 165/194 (85%)

Query: 22  MSDEIIWQVINQHFCAYKIKTDKGQNFCRNEYNVTGFCNRSSCPLANAKYATVKQVDGKL 81
           MSDEIIWQVINQHFCAYK+KTDKGQNFCRNEYNVTG C+R +CPLAN+KYATVK VDG L
Sbjct: 1   MSDEIIWQVINQHFCAYKVKTDKGQNFCRNEYNVTGLCSRQACPLANSKYATVKNVDGTL 60

Query: 82  YLYMKTVERAHTPAKLWERIRLSKNYSTALKQIDEHLLFWNKFLIHKCKQRLTKLTQVMI 141
           YLYMKT ERAHTPAKLWER++LSKNY+ AL QIDEHLL+WNKFLIHKCKQR+TKLTQVMI
Sbjct: 61  YLYMKTAERAHTPAKLWERVKLSKNYTKALAQIDEHLLYWNKFLIHKCKQRMTKLTQVMI 120

Query: 142 TERRMALREEERHYVGVAPKVKRRDENXXXXXXXXXXXXXXXXXXXXDRLKSGAYGDKPL 201
           TERR+ALREEERHYVG+APKVKRR+EN                    +RLKSG YGDKPL
Sbjct: 121 TERRLALREEERHYVGIAPKVKRREENRERKALSAAKIEKAIEKELLERLKSGVYGDKPL 180

Query: 202 NVDEKIWKRVMGHV 215
           NVDEKIWK+VMG V
Sbjct: 181 NVDEKIWKKVMGRV 194

>CAGL0G06248g 596704..597597 highly similar to sp|P10962
           Saccharomyces cerevisiae YAL025c MAK16, start by
           similarity
          Length = 297

 Score =  314 bits (804), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 145/194 (74%), Positives = 162/194 (83%)

Query: 22  MSDEIIWQVINQHFCAYKIKTDKGQNFCRNEYNVTGFCNRSSCPLANAKYATVKQVDGKL 81
           MSDEI+WQVINQ FCAYK+KTDKGQ FCRNEYNVTG C+R SCPLAN+KYATVK  +G+L
Sbjct: 1   MSDEIVWQVINQQFCAYKVKTDKGQTFCRNEYNVTGLCSRQSCPLANSKYATVKSENGRL 60

Query: 82  YLYMKTVERAHTPAKLWERIRLSKNYSTALKQIDEHLLFWNKFLIHKCKQRLTKLTQVMI 141
           YLY++TVERAHTPAK WE+IRLSKNYS ALKQID+HLL+WNKF IHKCKQR TKLTQV I
Sbjct: 61  YLYIRTVERAHTPAKWWEKIRLSKNYSKALKQIDDHLLYWNKFSIHKCKQRFTKLTQVAI 120

Query: 142 TERRMALREEERHYVGVAPKVKRRDENXXXXXXXXXXXXXXXXXXXXDRLKSGAYGDKPL 201
           TERR+A+RE ERHYVGVAPKVKRR+EN                    DRLKSGAYGDKP+
Sbjct: 121 TERRLAMREMERHYVGVAPKVKRREENRERKALAAAKIEKSIEKELLDRLKSGAYGDKPM 180

Query: 202 NVDEKIWKRVMGHV 215
           NVDEKIWK+VMGH+
Sbjct: 181 NVDEKIWKKVMGHL 194

>Kwal_26.7082
          Length = 299

 Score =  313 bits (802), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 169/291 (58%), Positives = 188/291 (64%), Gaps = 1/291 (0%)

Query: 22  MSDEIIWQVINQHFCAYKIKTDKGQNFCRNEYNVTGFCNRSSCPLANAKYATVKQVDGKL 81
           MSDEIIWQVINQ FCAYK+KTDKGQNFCRNEYNVTG CNR SCPLANAKYATVK VDG+L
Sbjct: 1   MSDEIIWQVINQQFCAYKLKTDKGQNFCRNEYNVTGLCNRQSCPLANAKYATVKNVDGRL 60

Query: 82  YLYMKTVERAHTPAKLWERIRLSKNYSTALKQIDEHLLFWNKFLIHKCKQRLTKLTQVMI 141
           YLYMKT ERAHTPAKLWERIRLSKNY+ AL Q+D+HLL+WNKFLIHKCKQRLT+LTQ+ +
Sbjct: 61  YLYMKTAERAHTPAKLWERIRLSKNYAKALTQVDDHLLYWNKFLIHKCKQRLTRLTQIAV 120

Query: 142 TERRMALREEERHYVGVAPKVKRRDENXXXXXXXXXXXXXXXXXXXXDRLKSGAYGDKPL 201
           TERRM LREEERHYVGVAPKVKRRDEN                    +RLKSGAYGDKPL
Sbjct: 121 TERRMELREEERHYVGVAPKVKRRDENRERKALAAAKIEKAIEKELLERLKSGAYGDKPL 180

Query: 202 NVDEKIWKRVMGHVXXXXXXXXXXXXXXXSXXXXXXXXXXXXXXXXXXXXXXQRWLXXXX 261
           NVDEKIWK+V+GHV                                      +RWL    
Sbjct: 181 NVDEKIWKKVLGHV-EDEQEEDYDEEEEEESDAEIEYVEDDGDEDLVDVEDIERWLDDPE 239

Query: 262 XXXXXXXXXXXXXXXXXXXXXXXXXXXXKAARGPLSKKRRPRVEIEYEEES 312
                                       +  + P ++K+RPRVEIEYEEE+
Sbjct: 240 ASDSESSEDEDSEEDSEDDSEKSSKSDKRKKQAPAARKKRPRVEIEYEEET 290

>YAL025C (MAK16) [43] chr1 complement(100228..101148) Nuclear
           protein with HMG-like acidic region, required for
           propagation of M1 double-stranded RNA (dsRNA) virus [921
           bp, 306 aa]
          Length = 306

 Score =  303 bits (776), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 141/194 (72%), Positives = 158/194 (81%)

Query: 22  MSDEIIWQVINQHFCAYKIKTDKGQNFCRNEYNVTGFCNRSSCPLANAKYATVKQVDGKL 81
           MSDEI+WQVINQ FC+++IK   GQNFCRNEYNVTG C R SCPLAN+KYATVK  +GKL
Sbjct: 1   MSDEIVWQVINQSFCSHRIKAPNGQNFCRNEYNVTGLCTRQSCPLANSKYATVKCDNGKL 60

Query: 82  YLYMKTVERAHTPAKLWERIRLSKNYSTALKQIDEHLLFWNKFLIHKCKQRLTKLTQVMI 141
           YLYMKT ERAHTPAKLWERI+LSKNY+ AL+QIDEHLL W+KF  HKCKQR TKLTQVMI
Sbjct: 61  YLYMKTPERAHTPAKLWERIKLSKNYTKALQQIDEHLLHWSKFFRHKCKQRFTKLTQVMI 120

Query: 142 TERRMALREEERHYVGVAPKVKRRDENXXXXXXXXXXXXXXXXXXXXDRLKSGAYGDKPL 201
           TERR+ALREEERHYVGVAPKVKRR++N                    DRLKSGAYGDKPL
Sbjct: 121 TERRLALREEERHYVGVAPKVKRREQNRERKALVAAKIEKAIEKELMDRLKSGAYGDKPL 180

Query: 202 NVDEKIWKRVMGHV 215
           NVDEK+WK++MG +
Sbjct: 181 NVDEKVWKKIMGQM 194

>Scas_663.2
          Length = 304

 Score =  295 bits (755), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 137/194 (70%), Positives = 155/194 (79%)

Query: 22  MSDEIIWQVINQHFCAYKIKTDKGQNFCRNEYNVTGFCNRSSCPLANAKYATVKQVDGKL 81
           MSDEI+WQVINQ FC+++IK+  GQ FCR+ YNVTG C R SCPLAN+KYATV+   G++
Sbjct: 1   MSDEIVWQVINQSFCSHRIKSPSGQTFCRDPYNVTGLCTRQSCPLANSKYATVRADKGRI 60

Query: 82  YLYMKTVERAHTPAKLWERIRLSKNYSTALKQIDEHLLFWNKFLIHKCKQRLTKLTQVMI 141
           YLYMKT ERAHTPAKLWERI+LSKNYS ALKQIDEHLL W  F IHKCKQR TKLTQV I
Sbjct: 61  YLYMKTPERAHTPAKLWERIKLSKNYSKALKQIDEHLLHWKNFFIHKCKQRFTKLTQVAI 120

Query: 142 TERRMALREEERHYVGVAPKVKRRDENXXXXXXXXXXXXXXXXXXXXDRLKSGAYGDKPL 201
           TERR+A+REEERHYVGVAPKVKRR++N                    DRLKSGAYGDKPL
Sbjct: 121 TERRLAMREEERHYVGVAPKVKRREQNRERKALAAAKIEKAIEKELLDRLKSGAYGDKPL 180

Query: 202 NVDEKIWKRVMGHV 215
           NVDEKIWK+V+GH+
Sbjct: 181 NVDEKIWKKVLGHL 194

>CAGL0F00715g complement(80864..81796) similar to sp|P10962
           Saccharomyces cerevisiae YAL025c MAK16 nuclear viral
           propagation protein, hypothetical start
          Length = 310

 Score =  223 bits (568), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 109/206 (52%), Positives = 140/206 (67%), Gaps = 10/206 (4%)

Query: 20  LPMSDEIIWQVINQHFCAYKIKTDKGQNFCRNEYNVTGFCNRSSCPLANAKYATVKQVD- 78
           + +SD++IW +IN  FCA KIKT  GQ F R+ YNVTG   R SCPLAN+KYATV++   
Sbjct: 1   MNVSDDLIWDIINHGFCATKIKTKVGQTFDRDPYNVTGLFTRQSCPLANSKYATVREYGD 60

Query: 79  -GKLYLYMKTVERAHTPAKLWERIRLSKNYSTALKQIDEHLLFWNKFLIHKCKQRLTKLT 137
            G+LYL +KT ERAHTPAK+W+RIRLS NYS ALKQIDEHL++WNKF +H+CKQR  KL+
Sbjct: 61  KGRLYLCIKTPERAHTPAKMWQRIRLSNNYSKALKQIDEHLMYWNKFFLHRCKQRYVKLS 120

Query: 138 QVMITERR---MALREEERHYVGVAPKVKRRDENXXXXXXXXXXXXXXXXXXXXDRLKSG 194
           Q+ + ERR   + +  E++  VG+APKVKRR+ N                    +RLKSG
Sbjct: 121 QIKLVERRQLKLQMNGEQKRLVGIAPKVKRREMNRERKALVAAKIEESISKELLNRLKSG 180

Query: 195 AYGD-----KPLNVDEKIWKRVMGHV 215
           AY +      PLNVDE IW ++MG +
Sbjct: 181 AYSNADKTLTPLNVDENIWNKIMGKL 206

>YMR306W (FKS3) [4260] chr13 (881158..886515) Protein with high
           similarity to 1,3)-beta-D-glucan synthase catalytic
           subunit (C. albicans Fks1p), which is required for cell
           wall biosynthesis, member of the 1,3-beta-glucan
           synthase component family, which are involved in fungal
           cell wall formation [5358 bp, 1785 aa]
          Length = 1785

 Score = 29.3 bits (64), Expect = 5.8,   Method: Composition-based stats.
 Identities = 21/72 (29%), Positives = 32/72 (44%), Gaps = 3/72 (4%)

Query: 99  ERIRLSKNYSTALKQIDEHLLFWNKFLIHKCKQRLTKLTQ---VMITERRMALREEERHY 155
           E     K Y  A   +DE + F N  L  K +QR  K+ +   V I E+     E+E+ +
Sbjct: 84  EHANYRKWYFAAQLDLDEEIGFQNMRLHGKARQRNVKMAKKRGVSIKEQIKQWNEKEQEF 143

Query: 156 VGVAPKVKRRDE 167
           +   PK+    E
Sbjct: 144 INNHPKITLTQE 155

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.134    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,342,717
Number of extensions: 242744
Number of successful extensions: 535
Number of sequences better than 10.0: 9
Number of HSP's gapped: 526
Number of HSP's successfully gapped: 14
Length of query: 314
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 213
Effective length of database: 13,099,691
Effective search space: 2790234183
Effective search space used: 2790234183
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)