Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADR348C1901879841e-138
KLLA0E09394g1401332084e-21
Scas_533.4d1711611073e-06
Kwal_27.1183979879690.46
YJR003C53951642.3
AFR198W77669633.1
Kwal_23.57051228107623.9
Scas_678.29124580599.2
CAGL0D02618g248315810.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADR348C
         (187 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADR348C [2089] [Homologous to NOHBY] (1318681..1319253) [573 bp,...   383   e-138
KLLA0E09394g 836226..836648 no similarity, hypothetical start          85   4e-21
Scas_533.4d                                                            46   3e-06
Kwal_27.11839                                                          31   0.46 
YJR003C (YJR003C) [2904] chr10 complement(440908..442527) Protei...    29   2.3  
AFR198W [3390] [Homologous to ScYKL134C - SH] complement(797451....    29   3.1  
Kwal_23.5705                                                           28   3.9  
Scas_678.29                                                            27   9.2  
CAGL0D02618g 268327..269073 similar to sp|Q12462 Saccharomyces c...    27   10.0 

>ADR348C [2089] [Homologous to NOHBY] (1318681..1319253) [573 bp,
           190 aa]
          Length = 190

 Score =  383 bits (984), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 187/187 (100%), Positives = 187/187 (100%)

Query: 1   MECASNPRTGKSTLAVPCESPICSLYSLWPCGDPGGQKDTRVGYRTSSRDSVRMSRIVTD 60
           MECASNPRTGKSTLAVPCESPICSLYSLWPCGDPGGQKDTRVGYRTSSRDSVRMSRIVTD
Sbjct: 1   MECASNPRTGKSTLAVPCESPICSLYSLWPCGDPGGQKDTRVGYRTSSRDSVRMSRIVTD 60

Query: 61  LAMLEGVLSGATSAERLVLLRIFAQYEGIEPSAQERAAPLLCFRTIPYFGTATEEVRTYR 120
           LAMLEGVLSGATSAERLVLLRIFAQYEGIEPSAQERAAPLLCFRTIPYFGTATEEVRTYR
Sbjct: 61  LAMLEGVLSGATSAERLVLLRIFAQYEGIEPSAQERAAPLLCFRTIPYFGTATEEVRTYR 120

Query: 121 LAIDEKTYYARFIERLPPYQGDILDLRCGVIHGEVEIMHIDVVSMRELARLRSFLATEDG 180
           LAIDEKTYYARFIERLPPYQGDILDLRCGVIHGEVEIMHIDVVSMRELARLRSFLATEDG
Sbjct: 121 LAIDEKTYYARFIERLPPYQGDILDLRCGVIHGEVEIMHIDVVSMRELARLRSFLATEDG 180

Query: 181 QQFMKLT 187
           QQFMKLT
Sbjct: 181 QQFMKLT 187

>KLLA0E09394g 836226..836648 no similarity, hypothetical start
          Length = 140

 Score = 84.7 bits (208), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 71/133 (53%), Gaps = 6/133 (4%)

Query: 54  MSRIVTDLAMLEGVLSGATSAERLVLLRIFAQYEGIEPSAQERAAPLLCFRTIPYFGTAT 113
           MS+I+TDL  + G +    + + L+ LRIFAQ++ I  S +      L F  +P F   T
Sbjct: 1   MSKIITDLDTIAGKIE-EYAGDTLLRLRIFAQFQDISHSHERTDGIYLHFSNVPDFNAET 59

Query: 114 EEVRTYRLAIDEKTYYARFIERLP---PYQGDILDLRCGVIHGE--VEIMHIDVVSMREL 168
              R+Y   IDE  Y   FI       P++GDILD+RC     +  VEIMH+ V+S+ +L
Sbjct: 60  NRERSYYFLIDETIYDEAFINTKSGERPHKGDILDMRCCYRKYDKVVEIMHLKVISIADL 119

Query: 169 ARLRSFLATEDGQ 181
             LR FLA  D  
Sbjct: 120 DSLREFLAKADDD 132

>Scas_533.4d
          Length = 171

 Score = 45.8 bits (107), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 70/161 (43%), Gaps = 28/161 (17%)

Query: 54  MSRIVTDLAMLEGVLSGATSAERLVL------LRIFAQYEGIEPSAQERAAPLLC---FR 104
           MS++V D+  L  VL       + +        R+ AQ   I+P   E     LC     
Sbjct: 1   MSQLVVDICKLNQVLLNLNERSKEIFTNSSRRFRVVAQLLDIQPYDDEENEGFLCKLIVG 60

Query: 105 TIPYFG----------TATEEVRTYRLAIDEKTYYARF---IERLPPYQGDILDL----- 146
            +P F           T  + VR   L + E  Y + F        P   D +DL     
Sbjct: 61  NLPDFHAQILDDVAHFTQVKNVR-LELYVSESLYRSTFDINCSNRTPELYDAVDLTVAIW 119

Query: 147 RCGVIHGEVEIMHIDVVSMRELARLRSFLATEDGQQFMKLT 187
             G I+ + E++ I+++++ E+ +LR F+A+  GQ+F++L+
Sbjct: 120 NNGFINIKCEVIDIEILNLEEVNQLREFIASPMGQEFLQLS 160

>Kwal_27.11839
          Length = 798

 Score = 31.2 bits (69), Expect = 0.46,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 36/79 (45%), Gaps = 11/79 (13%)

Query: 81  RIFAQ---YEGIEPSAQERAAPLLCFRTIPYFGTATEEVRTYRLAIDEKTYYARFIERLP 137
           R+ AQ   +E +   AQER +P+     +P++    +  R      DE   Y R +  +P
Sbjct: 692 RVLAQEGRFEDLYKFAQERKSPI---GYLPFYRYCLKHNRK-----DEAIPYVRLLSGIP 743

Query: 138 PYQGDILDLRCGVIHGEVE 156
           P     + L+CG  H  ++
Sbjct: 744 PATRVEMYLKCGSYHDAIK 762

>YJR003C (YJR003C) [2904] chr10 complement(440908..442527) Protein
           of unknown function [1620 bp, 539 aa]
          Length = 539

 Score = 29.3 bits (64), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 48  SRDSVRMSRIVTDLAMLEGVLSGATSAERLVLLRIFAQY-EGIEPSAQERA 97
           SRD    +R++ D A+ E ++SG T+A+++    + AQY E +E    ++ 
Sbjct: 479 SRDDADFARVIFDGALGEKLISGPTAAKKIK--NLLAQYGEALETKTSKQV 527

>AFR198W [3390] [Homologous to ScYKL134C - SH]
           complement(797451..799781) [2331 bp, 776 aa]
          Length = 776

 Score = 28.9 bits (63), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 3/69 (4%)

Query: 55  SRIVTDLAMLEGVLSGATSAERLVLLRIFAQYEGIEPSAQERAAPLLCFRTIPYFGTATE 114
           +R VTD   L  +L    + +R VLLRI + Y   EP  +E    L  F+    F   TE
Sbjct: 588 TRCVTDFVELPSILMEHFAKDRRVLLRISSNYATGEPIPEEL---LSAFQEQNNFLKNTE 644

Query: 115 EVRTYRLAI 123
                ++++
Sbjct: 645 TFSQIKMSM 653

>Kwal_23.5705
          Length = 1228

 Score = 28.5 bits (62), Expect = 3.9,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 46/107 (42%), Gaps = 12/107 (11%)

Query: 64   LEGVLSGATSAERLVLLRIFAQYEGIEPS----AQERAAPLLCFRTIPYFGTATEEVRTY 119
            L  VLSG    E    L+I ++Y   +      AQE+A  LL  +TI   G AT ++ T 
Sbjct: 988  LRAVLSGGKYKENDDSLKITSEYCNFKKDCAHHAQEQAIHLLLCKTINDMGNATGQILT- 1046

Query: 120  RLAIDEKTYYARFIERLPPY------QGDILDLRCGVIHGEVEIMHI 160
             +A   + Y + F   +P +       GD L L      G   I+ +
Sbjct: 1047 -MATVLQVYESAFDVFIPEFGIEKRVHGDQLPLTKAEYDGNNRILEL 1092

>Scas_678.29
          Length = 1245

 Score = 27.3 bits (59), Expect = 9.2,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 40/80 (50%), Gaps = 6/80 (7%)

Query: 64   LEGVLSGATSAERLVLLRIFAQYEGIEP----SAQERAAPLLCFRTIPYFGTATEEVRTY 119
            L+ ++ G   +E +  L+I ++Y   +      AQE+A  LL  +TI   G AT ++ T 
Sbjct: 1007 LKSIIRGVPYSEDIDSLKITSEYCNFKKDCAYQAQEQAVHLLLCKTINDMGNATGQLLT- 1065

Query: 120  RLAIDEKTYYARFIERLPPY 139
             +A   + Y + F   +P +
Sbjct: 1066 -MATVLQVYESSFDVFIPEF 1084

>CAGL0D02618g 268327..269073 similar to sp|Q12462 Saccharomyces
           cerevisiae YOL147c PMP27 peroxisomal membrane protein -
           peroxin, start by similarity
          Length = 248

 Score = 26.9 bits (58), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 19/31 (61%)

Query: 40  TRVGYRTSSRDSVRMSRIVTDLAMLEGVLSG 70
             +GY +SS DS+ ++ +VT L  LE +  G
Sbjct: 216 NNLGYLSSSEDSIGLAGVVTSLLGLEDLWKG 246

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.137    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,484,148
Number of extensions: 201357
Number of successful extensions: 371
Number of sequences better than 10.0: 10
Number of HSP's gapped: 369
Number of HSP's successfully gapped: 10
Length of query: 187
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 91
Effective length of database: 13,272,781
Effective search space: 1207823071
Effective search space used: 1207823071
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 58 (26.9 bits)