Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADR347C41139120970.0
KLLA0E15290g40781760.23
ADL163W44247760.23
AFL214C40698750.26
Kwal_33.1409939481710.90
KLLA0E14850g39639691.4
CAGL0G01903g60870646.1
YBR046C (ZTA1)33488646.1
Kwal_8.58063868646.3
KLLA0E00418g181616110.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADR347C
         (403 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADR347C [2088] [Homologous to NOHBY] (1317376..1318611) [1236 bp...   812   0.0  
KLLA0E15290g 1355166..1356389 similar to sp|P46959 Saccharomyces...    34   0.23 
ADL163W [1578] [Homologous to ScYOL125W - SH] complement(403971....    34   0.23 
AFL214C [2981] [Homologous to ScYJL125C (GCD14) - SH] (35516..36...    33   0.26 
Kwal_33.14099                                                          32   0.90 
KLLA0E14850g 1324910..1326100 gi|1172907|sp|P41767|RF1M_KLULA Kl...    31   1.4  
CAGL0G01903g 170682..172508 similar to sp|P36150 Saccharomyces c...    29   6.1  
YBR046C (ZTA1) [237] chr2 complement(330467..331471) Zeta-crysta...    29   6.1  
Kwal_8.580                                                             29   6.3  
KLLA0E00418g 36083..36628 no similarity, hypothetical start            28   10.0 

>ADR347C [2088] [Homologous to NOHBY] (1317376..1318611) [1236 bp,
           411 aa]
          Length = 411

 Score =  812 bits (2097), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/391 (100%), Positives = 391/391 (100%)

Query: 1   MSLLWRFERKALKWFRQRRCLHTIGENDLVMVRSLSRPDESYHLSKPLESGKVVHTARGT 60
           MSLLWRFERKALKWFRQRRCLHTIGENDLVMVRSLSRPDESYHLSKPLESGKVVHTARGT
Sbjct: 1   MSLLWRFERKALKWFRQRRCLHTIGENDLVMVRSLSRPDESYHLSKPLESGKVVHTARGT 60

Query: 61  ILHEQIIGKEWRTLVEAGQANGAKNTYKYMLCKPTLEEYIVNRRREAQPIYPLDASLIVE 120
           ILHEQIIGKEWRTLVEAGQANGAKNTYKYMLCKPTLEEYIVNRRREAQPIYPLDASLIVE
Sbjct: 61  ILHEQIIGKEWRTLVEAGQANGAKNTYKYMLCKPTLEEYIVNRRREAQPIYPLDASLIVE 120

Query: 121 LADIAADYPEMVDAGDSLQPMSLESYLRETDRSDKLPVMLPKQLEGKGQLDRHIATQQHS 180
           LADIAADYPEMVDAGDSLQPMSLESYLRETDRSDKLPVMLPKQLEGKGQLDRHIATQQHS
Sbjct: 121 LADIAADYPEMVDAGDSLQPMSLESYLRETDRSDKLPVMLPKQLEGKGQLDRHIATQQHS 180

Query: 181 AFNSLGCVGKRITKQRPLQYLECGTGHGSLTLYIAKALHAANAFYDGKDDRTRGAILHSL 240
           AFNSLGCVGKRITKQRPLQYLECGTGHGSLTLYIAKALHAANAFYDGKDDRTRGAILHSL
Sbjct: 181 AFNSLGCVGKRITKQRPLQYLECGTGHGSLTLYIAKALHAANAFYDGKDDRTRGAILHSL 240

Query: 241 DRNEKHLKVGMENVKQFRKGLYWADVEFHLESNGPNGWLESPAAEYYGGRLGRSDNRGFL 300
           DRNEKHLKVGMENVKQFRKGLYWADVEFHLESNGPNGWLESPAAEYYGGRLGRSDNRGFL
Sbjct: 241 DRNEKHLKVGMENVKQFRKGLYWADVEFHLESNGPNGWLESPAAEYYGGRLGRSDNRGFL 300

Query: 301 DGAFLDLPSPEDHLAKLSDCMAINAPIIVFTPSIMQIWDCVERVKAEGLRLSLITVYELT 360
           DGAFLDLPSPEDHLAKLSDCMAINAPIIVFTPSIMQIWDCVERVKAEGLRLSLITVYELT
Sbjct: 301 DGAFLDLPSPEDHLAKLSDCMAINAPIIVFTPSIMQIWDCVERVKAEGLRLSLITVYELT 360

Query: 361 AGSGGGGMRQWDLRRSLIKETGKSGMVVRPK 391
           AGSGGGGMRQWDLRRSLIKETGKSGMVVRPK
Sbjct: 361 AGSGGGGMRQWDLRRSLIKETGKSGMVVRPK 391

>KLLA0E15290g 1355166..1356389 similar to sp|P46959 Saccharomyces
           cerevisiae YJL125c GCD14 translational repressor of GCN4
           singleton, start by similarity
          Length = 407

 Score = 33.9 bits (76), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 11/81 (13%)

Query: 301 DGAFLDLPSPEDHLAKLSDCMAINAPI--IVFTPSIMQIWDCVERVKAEGLRLSLITVYE 358
           D  FLDLP+P D +  L+  ++    +    F+P I Q+   +E ++ EG +   +   E
Sbjct: 198 DCIFLDLPAPWDAIPNLTSVISKEKKVNLCCFSPCIEQVDKTLEALEEEGWQ--DVQTVE 255

Query: 359 LTAGSGGGGMRQWDLRRSLIK 379
           +         RQ++ RR +++
Sbjct: 256 IQG-------RQYEARRQMVR 269

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 51/100 (51%), Gaps = 9/100 (9%)

Query: 23  TIGENDLVMVRSLSRPDESYHLSKPL--ESGKVVHTARGTILHEQIIGKEWRTLVEAGQA 80
           TI E DLV+   LSR +      KP+  ++G+V +T  G   H  +IGK + + + A + 
Sbjct: 10  TIKEGDLVLA-WLSRDN-----LKPITVKAGEVFNTRYGAFSHSDMIGKPFGSQI-AIRT 62

Query: 81  NGAKNTYKYMLCKPTLEEYIVNRRREAQPIYPLDASLIVE 120
            G+       + +PT E + ++     Q +Y  D+S I++
Sbjct: 63  KGSNRFGFIHVLQPTPELWSISLPHRTQIVYTPDSSYIMQ 102

>ADL163W [1578] [Homologous to ScYOL125W - SH]
           complement(403971..405299) [1329 bp, 442 aa]
          Length = 442

 Score = 33.9 bits (76), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%)

Query: 171 DRHIATQQHSAFNSLGCVGKRITKQRPLQYLECGTGHGSLTLYIAKA 217
           +R  A QQ S    L   G  +  +RP+ Y+E G G G L+ YI +A
Sbjct: 164 NRKHALQQSSLIQHLREAGLWVAPERPVAYVEFGCGRGELSRYINQA 210

>AFL214C [2981] [Homologous to ScYJL125C (GCD14) - SH]
           (35516..36736) [1221 bp, 406 aa]
          Length = 406

 Score = 33.5 bits (75), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 52/98 (53%), Gaps = 7/98 (7%)

Query: 24  IGENDLVMVRSLSRPDESYHLSKPLESGKVVHTARGTILHEQIIGKEWRTLVEAGQANGA 83
           I E DLV+V  +SR +        ++SG+V +T  G+  H+ I+G+ + + +  G     
Sbjct: 11  IAEGDLVLVW-ISRGNVK---QLRIKSGEVFNTRYGSFAHDDIVGRPYGSQI--GVRTKG 64

Query: 84  KNTYKYM-LCKPTLEEYIVNRRREAQPIYPLDASLIVE 120
            N + ++ + +PT E + ++     Q +Y  D+S I++
Sbjct: 65  SNRFGFIHVLQPTPELWTLSLPHRTQIVYTPDSSYIMQ 102

>Kwal_33.14099
          Length = 394

 Score = 32.0 bits (71), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 11/81 (13%)

Query: 301 DGAFLDLPSPEDHLAKLSDCMAINAPI--IVFTPSIMQIWDCVERVKAEGLRLSLITVYE 358
           D  FLDLP+P D +  L   ++  + +    F+P I Q+   +E ++  G      T  E
Sbjct: 201 DVIFLDLPAPWDAIPHLDQVISQESKVSLCCFSPCIEQVDKTLEALEKHGW-----TDME 255

Query: 359 LTAGSGGGGMRQWDLRRSLIK 379
           +    G    RQ++ RR +++
Sbjct: 256 MVEIQG----RQYESRRQMVR 272

>KLLA0E14850g 1324910..1326100 gi|1172907|sp|P41767|RF1M_KLULA
           Kluyveromyces lactis Peptide chain release factor 1,
           mitochondrial precursor (MRF-1), start by similarity
          Length = 396

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 101 VNRRREAQPIYPLDASLIVEL-ADIAADYPEMVDAGDSL 138
           VN+ +E Q I  LD SL  E  ADIAA  P++   GDSL
Sbjct: 85  VNQYKELQEILELDPSLREEAEADIAALLPDLNKTGDSL 123

>CAGL0G01903g 170682..172508 similar to sp|P36150 Saccharomyces
           cerevisiae YKR069w MET1 siroheme synthase, hypothetical
           start
          Length = 608

 Score = 29.3 bits (64), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 32/70 (45%), Gaps = 5/70 (7%)

Query: 291 LGRSDNRGFLDGAFLDLPSPEDHLAK--LSDCMAINAPIIVFTPSIMQIWDCVERV---K 345
           LGR+     +D  F++LP  EDH  K     C+ +  PI  F       ++ +      K
Sbjct: 99  LGRAVTAKVVDRVFVNLPLEEDHKVKYIYEQCVRLRIPINTFHRPEYSTFNMIPTYVDPK 158

Query: 346 AEGLRLSLIT 355
             GL++++ T
Sbjct: 159 GSGLQIAVTT 168

>YBR046C (ZTA1) [237] chr2 complement(330467..331471)
           Zeta-crystallin homolog, has similarity to E. coli
           quinone oxidoreductase and human zeta-crystallin which
           has quinone oxidoreductase activity [1005 bp, 334 aa]
          Length = 334

 Score = 29.3 bits (64), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 36/88 (40%), Gaps = 6/88 (6%)

Query: 143 LESYLRETDRSDKLPVMLPKQL------EGKGQLDRHIATQQHSAFNSLGCVGKRITKQR 196
           +ESY R+     + P +L ++       +GKG  +  +  Q     NS      +I+ Q 
Sbjct: 50  IESYFRKGIYPCEKPYVLGREASGTVVAKGKGVTNFEVGDQVAYISNSTFAQYSKISSQG 109

Query: 197 PLQYLECGTGHGSLTLYIAKALHAANAF 224
           P+  L  GT    L LY A  L    A 
Sbjct: 110 PVMKLPKGTSDEELKLYAAGLLQVLTAL 137

>Kwal_8.580
          Length = 638

 Score = 29.3 bits (64), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 4/68 (5%)

Query: 85  NTYKYMLCK-PTLEEYIVNRRREAQPIYPLDASLIVELADIAADYPEMVDAGDSL--QPM 141
           N +K M  K  TLE Y        +P +P    + V LAD+ + YP + +A   L     
Sbjct: 207 NKFKQMEFKLSTLESYFTAFLERMEPFFPTFRDIRVSLADV-SQYPNLSEARRFLLSSIF 265

Query: 142 SLESYLRE 149
           + ES LR+
Sbjct: 266 AFESALRD 273

>KLLA0E00418g 36083..36628 no similarity, hypothetical start
          Length = 181

 Score = 28.1 bits (61), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 28/61 (45%)

Query: 225 YDGKDDRTRGAILHSLDRNEKHLKVGMENVKQFRKGLYWADVEFHLESNGPNGWLESPAA 284
           Y   D R RGA+      ++  LK G +N+K+  + L       HL +N    W E+  +
Sbjct: 26  YSINDMRIRGALAELQKNSQLILKNGDKNLKEMHRYLIAFGNNSHLGANEAQVWFEAHHS 85

Query: 285 E 285
           E
Sbjct: 86  E 86

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.136    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,907,944
Number of extensions: 553730
Number of successful extensions: 1238
Number of sequences better than 10.0: 13
Number of HSP's gapped: 1258
Number of HSP's successfully gapped: 14
Length of query: 403
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 299
Effective length of database: 12,995,837
Effective search space: 3885755263
Effective search space used: 3885755263
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)