Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADR345C1581558171e-114
KLLA0E09438g1631595583e-74
Sklu_1938.41641625314e-70
YLR008C (PAM18)1681595263e-69
CAGL0J00935g1531234956e-65
Scas_590.71581504923e-64
Kwal_33.152981711654533e-58
Scas_716.461441341761e-16
YNL328C (MDJ2)146661732e-16
CAGL0D02552g143811733e-16
AGR393W142651708e-16
Sklu_2034.5142651646e-15
Kwal_55.22136145641602e-14
KLLA0E02024g146631551e-13
YNL064C (YDJ1)40935631.9
AEL042C54763622.4
Kwal_33.1386057833622.6
KLLA0C02981g16229602.8
YDR287W29235604.0
Kwal_47.1890311334584.8
Kwal_34.1619055647605.3
CAGL0G02783g49087595.6
Kwal_55.20976146832596.5
Sklu_2109.465873589.4
Kwal_14.117428439579.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADR345C
         (155 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADR345C [2086] [Homologous to ScYLR008C - SH] (1315746..1316222)...   319   e-114
KLLA0E09438g 838259..838750 similar to sgd|S0003998 Saccharomyce...   219   3e-74
Sklu_1938.4 YLR008C, Contig c1938 6198-6692 reverse complement        209   4e-70
YLR008C (PAM18) [3426] chr12 complement(165576..166082) Protein ...   207   3e-69
CAGL0J00935g complement(95878..96339) highly similar to tr|Q0791...   195   6e-65
Scas_590.7                                                            194   3e-64
Kwal_33.15298                                                         179   3e-58
Scas_716.46                                                            72   1e-16
YNL328C (MDJ2) [4287] chr14 complement(22834..23274) Protein inv...    71   2e-16
CAGL0D02552g 261991..262422 similar to sp|P42834 Saccharomyces c...    71   3e-16
AGR393W [4704] [Homologous to ScYNL328C (MDJ2) - SH] complement(...    70   8e-16
Sklu_2034.5 YNL328C, Contig c2034 7065-7493 reverse complement         68   6e-15
Kwal_55.22136                                                          66   2e-14
KLLA0E02024g complement(191062..191502) similar to sp|P42834 Sac...    64   1e-13
YNL064C (YDJ1) [4526] chr14 complement(505866..507095) Protein i...    29   1.9  
AEL042C [2464] [Homologous to ScYOL156W (HXT11) - SH] (557191..5...    28   2.4  
Kwal_33.13860                                                          28   2.6  
KLLA0C02981g 268669..269157 similar to sp|P47138 Saccharomyces c...    28   2.8  
YDR287W (YDR287W) [1116] chr4 (1035987..1036865) Inositol monoph...    28   4.0  
Kwal_47.18903                                                          27   4.8  
Kwal_34.16190                                                          28   5.3  
CAGL0G02783g 256580..258052 similar to sp|P40486 Saccharomyces c...    27   5.6  
Kwal_55.20976                                                          27   6.5  
Sklu_2109.4 YOR254C, Contig c2109 4786-6762                            27   9.4  
Kwal_14.1174                                                           27   9.6  

>ADR345C [2086] [Homologous to ScYLR008C - SH] (1315746..1316222)
           [477 bp, 158 aa]
          Length = 158

 Score =  319 bits (817), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 155/155 (100%), Positives = 155/155 (100%)

Query: 1   MAPPTIEIPQLPIPGEDNSAHPAQQIRLEQAAVPQQKRGMDLYFDKVVDFVGEHPVVGGI 60
           MAPPTIEIPQLPIPGEDNSAHPAQQIRLEQAAVPQQKRGMDLYFDKVVDFVGEHPVVGGI
Sbjct: 1   MAPPTIEIPQLPIPGEDNSAHPAQQIRLEQAAVPQQKRGMDLYFDKVVDFVGEHPVVGGI 60

Query: 61  GGFVALYAAAGLWRAVSIRMNGGKEATKFLKGGFDPKMNTKEALAILNLTESTLTKKRVK 120
           GGFVALYAAAGLWRAVSIRMNGGKEATKFLKGGFDPKMNTKEALAILNLTESTLTKKRVK
Sbjct: 61  GGFVALYAAAGLWRAVSIRMNGGKEATKFLKGGFDPKMNTKEALAILNLTESTLTKKRVK 120

Query: 121 DVHRKIMLANHPDKGGSPYLATKINEAKDFLEKRG 155
           DVHRKIMLANHPDKGGSPYLATKINEAKDFLEKRG
Sbjct: 121 DVHRKIMLANHPDKGGSPYLATKINEAKDFLEKRG 155

>KLLA0E09438g 838259..838750 similar to sgd|S0003998 Saccharomyces
           cerevisiae YLR008c, start by similarity
          Length = 163

 Score =  219 bits (558), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 103/159 (64%), Positives = 128/159 (80%), Gaps = 5/159 (3%)

Query: 1   MAPPTIEIPQLPIPGEDNSAHPAQQIRLEQAA-----VPQQKRGMDLYFDKVVDFVGEHP 55
           MA   IE+PQLPIPGEDNS    +Q+ +   A     +PQQK GMDLYFD+ +D++G+HP
Sbjct: 1   MAQQNIEVPQLPIPGEDNSNRVPEQVVIGHPAAGVPPIPQQKSGMDLYFDQALDYMGDHP 60

Query: 56  VVGGIGGFVALYAAAGLWRAVSIRMNGGKEATKFLKGGFDPKMNTKEALAILNLTESTLT 115
           V+ G+GGF ALY AAG +++VS R+ G  +  K+LKGGFDPKMN KEALAILNL E+ L+
Sbjct: 61  VLTGVGGFFALYFAAGAYKSVSKRLGGSSQGVKYLKGGFDPKMNAKEALAILNLNETNLS 120

Query: 116 KKRVKDVHRKIMLANHPDKGGSPYLATKINEAKDFLEKR 154
           KK++K+VHR+IMLANHPDKGGSPYLATKINEAKDFLEK+
Sbjct: 121 KKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKK 159

>Sklu_1938.4 YLR008C, Contig c1938 6198-6692 reverse complement
          Length = 164

 Score =  209 bits (531), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 105/162 (64%), Positives = 122/162 (75%), Gaps = 8/162 (4%)

Query: 1   MAPPT-IEIPQLPIPGEDNSAHPAQQIRLEQAA------VPQQKRGMDLYFDKVVDFVGE 53
           MAPPT  ++PQLPIPG DNS    + + L  A        P Q  GMDLYFD+ +D +G+
Sbjct: 1   MAPPTQFDVPQLPIPGADNS-RLQEPVALSNATPITTNPAPSQPSGMDLYFDQALDVMGQ 59

Query: 54  HPVVGGIGGFVALYAAAGLWRAVSIRMNGGKEATKFLKGGFDPKMNTKEALAILNLTEST 113
           HPV+ GIGGF  LY  AG +R+VS ++ G   A KFLKGGFDPKMN  EAL ILNL EST
Sbjct: 60  HPVLTGIGGFFTLYFLAGAYRSVSTKLGGNTGAAKFLKGGFDPKMNAGEALQILNLNEST 119

Query: 114 LTKKRVKDVHRKIMLANHPDKGGSPYLATKINEAKDFLEKRG 155
           LTKK++K+VHR+IMLANHPDKGGSPYLATKINEAKDFLEKRG
Sbjct: 120 LTKKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKRG 161

>YLR008C (PAM18) [3426] chr12 complement(165576..166082) Protein
           containing a DnaJ domain, which are part of chaperone
           (protein folding) system that mediates interaction with
           heat shock proteins, has high similarity to C. albicans
           Orf6.3647p [507 bp, 168 aa]
          Length = 168

 Score =  207 bits (526), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 123/159 (77%), Gaps = 11/159 (6%)

Query: 5   TIEIPQLPIPGEDNSAHPAQQIRLEQAAV--------PQQKRGMDLYFDKVVDFVGEHPV 56
           +IE PQLPIPG+ N +     + ++ A V          QK GMDLYFD+ ++++GEHPV
Sbjct: 10  SIEAPQLPIPGQTNGS---ANVTVDGAGVNVGIQNGSQGQKTGMDLYFDQALNYMGEHPV 66

Query: 57  VGGIGGFVALYAAAGLWRAVSIRMNGGKEATKFLKGGFDPKMNTKEALAILNLTESTLTK 116
           + G G F+ LY  AG ++++S  +NGGK  T FLKGGFDPKMN+KEAL ILNLTE+TLTK
Sbjct: 67  ITGFGAFLTLYFTAGAYKSISKGLNGGKSTTAFLKGGFDPKMNSKEALQILNLTENTLTK 126

Query: 117 KRVKDVHRKIMLANHPDKGGSPYLATKINEAKDFLEKRG 155
           K++K+VHRKIMLANHPDKGGSP+LATKINEAKDFLEKRG
Sbjct: 127 KKLKEVHRKIMLANHPDKGGSPFLATKINEAKDFLEKRG 165

>CAGL0J00935g complement(95878..96339) highly similar to tr|Q07914
           Saccharomyces cerevisiae YLR008c, start by similarity
          Length = 153

 Score =  195 bits (495), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 88/123 (71%), Positives = 105/123 (85%)

Query: 33  VPQQKRGMDLYFDKVVDFVGEHPVVGGIGGFVALYAAAGLWRAVSIRMNGGKEATKFLKG 92
            P  K+GMDLYFD  + ++GEHPV+ G+GGF+ALY  AG+++ V  R+NGGK AT+FLKG
Sbjct: 27  APGSKQGMDLYFDNALQYMGEHPVLAGVGGFLALYVGAGVYKGVQTRLNGGKAATQFLKG 86

Query: 93  GFDPKMNTKEALAILNLTESTLTKKRVKDVHRKIMLANHPDKGGSPYLATKINEAKDFLE 152
           GFDPKMN KEAL ILNL E+ LT K++K+VHRKIMLANHPDKGGSPYLATKINEAKDFLE
Sbjct: 87  GFDPKMNAKEALQILNLKENNLTTKKLKEVHRKIMLANHPDKGGSPYLATKINEAKDFLE 146

Query: 153 KRG 155
           K+G
Sbjct: 147 KKG 149

>Scas_590.7
          Length = 158

 Score =  194 bits (492), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 113/150 (75%), Gaps = 5/150 (3%)

Query: 5   TIEIPQLPIPGEDNSAHPAQQIRLEQAAVPQQKRGMDLYFDKVVDFVGEHPVVGGIGGFV 64
           T+E+PQL IPGE  S  P   I    +     K GMDLYFD+ + ++G HPV+ G+  F+
Sbjct: 10  TLEVPQLAIPGEA-SGSPTMTISQPTST----KNGMDLYFDEAMQYMGRHPVMTGVAAFL 64

Query: 65  ALYAAAGLWRAVSIRMNGGKEATKFLKGGFDPKMNTKEALAILNLTESTLTKKRVKDVHR 124
            LYAAAG ++++S ++NGGK    FLKGGFD KMN KEAL ILNLTE+ L  K++K+VHR
Sbjct: 65  TLYAAAGTYKSISTKLNGGKATATFLKGGFDAKMNQKEALQILNLTENKLNMKKLKEVHR 124

Query: 125 KIMLANHPDKGGSPYLATKINEAKDFLEKR 154
           KIMLANHPDKGGSPYLATKINEAKDFLEK+
Sbjct: 125 KIMLANHPDKGGSPYLATKINEAKDFLEKK 154

>Kwal_33.15298
          Length = 171

 Score =  179 bits (453), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 90/165 (54%), Positives = 115/165 (69%), Gaps = 15/165 (9%)

Query: 6   IEIPQLPIPGE------DNSAHP---------AQQIRLEQAAVPQQKRGMDLYFDKVVDF 50
           IE PQLPIPG+       +S  P           ++  + A    +K GMD  FD  + F
Sbjct: 4   IEAPQLPIPGQAGVDTNTSSQEPVWSGAGGAEGAEMVGKIANASNEKGGMDQAFDDALAF 63

Query: 51  VGEHPVVGGIGGFVALYAAAGLWRAVSIRMNGGKEATKFLKGGFDPKMNTKEALAILNLT 110
           +G+HPV+ G GGF+ LY AAG +++VS  + GG   T++ KGGFDPKMN KEA+ ILNL 
Sbjct: 64  MGQHPVLSGFGGFLGLYFAAGAFKSVSRALGGGAATTQYAKGGFDPKMNVKEAMQILNLN 123

Query: 111 ESTLTKKRVKDVHRKIMLANHPDKGGSPYLATKINEAKDFLEKRG 155
           E++L +K++K+VHR+IMLANHPDKGGSPYLATKINEAKDFLEKRG
Sbjct: 124 ENSLNRKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKRG 168

>Scas_716.46
          Length = 144

 Score = 72.4 bits (176), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 73/134 (54%), Gaps = 35/134 (26%)

Query: 55  PVVGGIG-GFVALYAAAGL-----WRAVS----IRMNGGK------------EATKF--- 89
           P++ G+G  FVA+   +GL     +++++     RMNG +            ++TK    
Sbjct: 4   PLILGVGVTFVAVTIRSGLRAWIVYKSLTPIMIARMNGIRITRSEINYTNKFQSTKLSNE 63

Query: 90  -------LKGGFDPKMNTKEALAILNLTESTLTK---KRVKDVHRKIMLANHPDKGGSPY 139
                   +GGF P M   EA+ IL+++   + K   K +K  HR  M+ NHPDKGGSPY
Sbjct: 64  LKTKLDQFQGGFYPTMTESEAILILDISSKDIKKLDEKLLKRKHRGAMILNHPDKGGSPY 123

Query: 140 LATKINEAKDFLEK 153
           LATKINEA++ LE+
Sbjct: 124 LATKINEAREVLER 137

>YNL328C (MDJ2) [4287] chr14 complement(22834..23274) Protein
           involved in import and folding of mitochondrial
           proteins, has similarity to E. coli DnaJ and other
           DnaJ-like proteins, function partially overlaps that of
           Mdj1p [441 bp, 146 aa]
          Length = 146

 Score = 71.2 bits (173), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 48/66 (72%), Gaps = 3/66 (4%)

Query: 91  KGGFDPKMNTKEALAILNLTE---STLTKKRVKDVHRKIMLANHPDKGGSPYLATKINEA 147
           +GGF P+M   EAL IL+++    + L +K +K  HRK M+ NHPD+GGSPY+A KINEA
Sbjct: 74  QGGFAPRMTEPEALLILDISAREINHLDEKLLKKKHRKAMVRNHPDRGGSPYMAAKINEA 133

Query: 148 KDFLEK 153
           K+ LE+
Sbjct: 134 KEVLER 139

>CAGL0D02552g 261991..262422 similar to sp|P42834 Saccharomyces
           cerevisiae YNL328c MDJ2 heat shock protein - chaperone,
           start by similarity
          Length = 143

 Score = 71.2 bits (173), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 42/81 (51%), Positives = 51/81 (62%), Gaps = 4/81 (4%)

Query: 77  SIRMNGG-KEATKFLKGGFDPKMNTKEALAILNLTES---TLTKKRVKDVHRKIMLANHP 132
           S R+N G K      +GGF   M+  EAL ILN+T+    +L    +K  HR  ML NHP
Sbjct: 57  SDRLNPGLKMQLNKWEGGFYHPMSESEALMILNITQKEIMSLNAPLLKKKHRLAMLKNHP 116

Query: 133 DKGGSPYLATKINEAKDFLEK 153
           DKGGSPYL+ KINEAK+ LEK
Sbjct: 117 DKGGSPYLSAKINEAKELLEK 137

>AGR393W [4704] [Homologous to ScYNL328C (MDJ2) - SH]
           complement(1451330..1451758) [429 bp, 142 aa]
          Length = 142

 Score = 70.1 bits (170), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 44/65 (67%), Gaps = 3/65 (4%)

Query: 92  GGFDPKMNTKEALAILNLTES---TLTKKRVKDVHRKIMLANHPDKGGSPYLATKINEAK 148
           GGF  +MN  EA+ IL +T      L +  +K  HR+ ML NHPDKGGSPY+A KINEA+
Sbjct: 73  GGFYKRMNEVEAMLILQITGDEIKLLDRNMLKKKHRRAMLLNHPDKGGSPYVAMKINEAR 132

Query: 149 DFLEK 153
           D +E+
Sbjct: 133 DVMEQ 137

>Sklu_2034.5 YNL328C, Contig c2034 7065-7493 reverse complement
          Length = 142

 Score = 67.8 bits (164), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 42/65 (64%), Gaps = 3/65 (4%)

Query: 92  GGFDPKMNTKEALAILNLTEST---LTKKRVKDVHRKIMLANHPDKGGSPYLATKINEAK 148
           GGF  +M   EAL IL ++      L    +K  HR+ ML NHPDKGGSPYLA KINEA+
Sbjct: 70  GGFYSRMTETEALLILGISSEEIEHLNATMLKRKHRRAMLQNHPDKGGSPYLAMKINEAR 129

Query: 149 DFLEK 153
           + LE+
Sbjct: 130 ETLER 134

>Kwal_55.22136
          Length = 145

 Score = 66.2 bits (160), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 42/64 (65%), Gaps = 3/64 (4%)

Query: 92  GGFDPKMNTKEALAILNLTES---TLTKKRVKDVHRKIMLANHPDKGGSPYLATKINEAK 148
           GGF  KM   EAL IL ++ S    L +  +K  HR+ ++ NHPD+GGSPYLA KINEA+
Sbjct: 75  GGFSSKMTDSEALLILGISGSEVAALDENLLKRKHRQAIVHNHPDRGGSPYLALKINEAR 134

Query: 149 DFLE 152
           D L 
Sbjct: 135 DILS 138

>KLLA0E02024g complement(191062..191502) similar to sp|P42834
           Saccharomyces cerevisiae YNL328c MDJ2 heat shock protein
           - chaperone singleton, start by similarity
          Length = 146

 Score = 64.3 bits (155), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 44/63 (69%), Gaps = 3/63 (4%)

Query: 92  GGFDPKMNTKEALAILNLTE---STLTKKRVKDVHRKIMLANHPDKGGSPYLATKINEAK 148
           GGF  KM+  EAL IL ++      L ++ ++  HR+ M+ NHPDKGGSP++A+KIN+A+
Sbjct: 73  GGFYDKMSETEALLILGISAREIEALDERLLRQKHRRAMIMNHPDKGGSPFIASKINQAR 132

Query: 149 DFL 151
           D L
Sbjct: 133 DLL 135

>YNL064C (YDJ1) [4526] chr14 complement(505866..507095) Protein
           involved in protein import into mitochondria and ER,
           homolog of E. coli DnaJ [1230 bp, 409 aa]
          Length = 409

 Score = 28.9 bits (63), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 17/35 (48%)

Query: 113 TLTKKRVKDVHRKIMLANHPDKGGSPYLATKINEA 147
           T T   +K  +RK  L  HPDK  S   A K  EA
Sbjct: 16  TATDVEIKKAYRKCALKYHPDKNPSEEAAEKFKEA 50

>AEL042C [2464] [Homologous to ScYOL156W (HXT11) - SH]
           (557191..558834) [1644 bp, 547 aa]
          Length = 547

 Score = 28.5 bits (62), Expect = 2.4,   Method: Composition-based stats.
 Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 2/63 (3%)

Query: 47  VVDFVGEHPV--VGGIGGFVALYAAAGLWRAVSIRMNGGKEATKFLKGGFDPKMNTKEAL 104
           +VD  G  PV  +GG+  F  LYA AG+    S+    G E    ++    P+ ++    
Sbjct: 335 LVDRAGRRPVLIIGGVLMFTWLYAVAGILATYSVPRPNGVEGNTTVRIEIPPERSSAAKA 394

Query: 105 AIL 107
            I+
Sbjct: 395 VIV 397

>Kwal_33.13860
          Length = 578

 Score = 28.5 bits (62), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 105 AILNLTESTLTKKRVKDVHRKIMLANHPDKGGS 137
           ++L LT S  T+ ++K  +RKI +A HPDK  S
Sbjct: 15  SMLGLT-SDATEAQIKKAYRKIAMAIHPDKNKS 46

>KLLA0C02981g 268669..269157 similar to sp|P47138 Saccharomyces
           cerevisiae YJR097w singleton, start by similarity
          Length = 162

 Score = 27.7 bits (60), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 16/29 (55%)

Query: 111 ESTLTKKRVKDVHRKIMLANHPDKGGSPY 139
           ES  +   +K  +R ++L  HPDK G  Y
Sbjct: 12  ESDASNIEIKRAYRAMLLETHPDKSGLNY 40

>YDR287W (YDR287W) [1116] chr4 (1035987..1036865) Inositol
           monophosphatase, catalyzes hydrolysis of
           inositol-1-phosphate, involved in the inositol cycle of
           calcium signaling [879 bp, 292 aa]
          Length = 292

 Score = 27.7 bits (60), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 4/35 (11%)

Query: 78  IRMNGGKEATKFLKGGFDPKMNTKEALAILNLTES 112
           I + GG E T+  +G FD KMNT + L    L+ES
Sbjct: 164 IALEGGSERTEGSQGNFDKKMNTYKNL----LSES 194

>Kwal_47.18903
          Length = 113

 Score = 26.9 bits (58), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 18/34 (52%), Gaps = 3/34 (8%)

Query: 66 LYAAAGLWRAVSIRMN-GGKEATKF--LKGGFDP 96
           YAAAGLW +VS R   GG     F  L GGF  
Sbjct: 3  FYAAAGLWASVSHRRTAGGLWIMAFYVLVGGFQA 36

>Kwal_34.16190
          Length = 556

 Score = 27.7 bits (60), Expect = 5.3,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 47  VVDFVGEHPV--VGGIGGFVALYAAAGLWRAVSIRMNGGKEATKFLK 91
           +VD VG  PV  VGGI  F+ L+  AGL    ++    G E  + ++
Sbjct: 336 LVDKVGRRPVLIVGGIFMFIWLFVVAGLLANYTVPSPNGFEGDETVR 382

>CAGL0G02783g 256580..258052 similar to sp|P40486 Saccharomyces
           cerevisiae YIL104c, start by similarity
          Length = 490

 Score = 27.3 bits (59), Expect = 5.6,   Method: Composition-based stats.
 Identities = 28/87 (32%), Positives = 38/87 (43%), Gaps = 10/87 (11%)

Query: 78  IRMNGGKEATKFL-KGGFDPKMNTKEALAI--------LNLTESTLTKKRVKDVHRKIML 128
           I+ N   E T  L K GFD + N    ++I        LN  E+T    R+K+   K  L
Sbjct: 150 IKQNVSSEPTLSLNKYGFDAQYNGLIGVSIPNGNDINELNDPENTTENDRIKERLSKENL 209

Query: 129 ANHPDKGGSPYLATKINEAKDFLEKRG 155
              PD   S Y+ +K    +D LE  G
Sbjct: 210 KFDPDYYVSEYMVSKYGSEED-LEVNG 235

>Kwal_55.20976
          Length = 1468

 Score = 27.3 bits (59), Expect = 6.5,   Method: Composition-based stats.
 Identities = 13/32 (40%), Positives = 15/32 (46%)

Query: 4    PTIEIPQLPIPGEDNSAHPAQQIRLEQAAVPQ 35
            P   +PQ PIP       P  Q  + QA VPQ
Sbjct: 1307 PQAPVPQAPIPQAPVPQAPVPQAPIPQAPVPQ 1338

>Sklu_2109.4 YOR254C, Contig c2109 4786-6762
          Length = 658

 Score = 26.9 bits (58), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 12/73 (16%)

Query: 65  ALYAAAGLWRAVSIRMN--GGKEATKFLKGG-FDPKMNTKEALAILNLTESTLTKKRVKD 121
           +L+   G W  VS+ +   G  +A K    G FDP         +L +  S  T K V+ 
Sbjct: 84  SLFTILG-WILVSVLIQRIGSNDAIKEAASGLFDP-------YTLLGVATSA-TDKEVRS 134

Query: 122 VHRKIMLANHPDK 134
            +RK+ +  HPDK
Sbjct: 135 AYRKLSVKFHPDK 147

>Kwal_14.1174
          Length = 284

 Score = 26.6 bits (57), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 24/39 (61%), Gaps = 4/39 (10%)

Query: 96  PKMNTKEALAILNLTESTLTKKRVKDVHRKIMLANHPDK 134
           P +N  E L +    E+++++ +++  +RK ML  HPDK
Sbjct: 9   PDLNPYEELQV----ETSVSEAQLRKSYRKRMLLYHPDK 43

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.136    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,974,416
Number of extensions: 191000
Number of successful extensions: 638
Number of sequences better than 10.0: 28
Number of HSP's gapped: 625
Number of HSP's successfully gapped: 28
Length of query: 155
Length of database: 16,596,109
Length adjustment: 93
Effective length of query: 62
Effective length of database: 13,376,635
Effective search space: 829351370
Effective search space used: 829351370
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 57 (26.6 bits)