Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADR051C1819178690900.0
Sklu_2124.11830179560940.0
Kwal_27.119511869179559870.0
YBR208C (DUR1,2)1835179158960.0
KLLA0E08107g1829179658800.0
Scas_721.401834180155900.0
CAGL0M05533g1834180354340.0
YBR218C (PYC2)11804617132e-76
CAGL0K06787g11754617079e-76
YGL062W (PYC1)11784617033e-75
Kwal_14.180311744617024e-75
AAR162C11714846891e-73
KLLA0C05764g11734726793e-72
CAGL0F06941g11804806775e-72
Scas_686.1711764616759e-72
Scas_563.1212164466313e-66
Sklu_1458.111324386178e-65
KLLA0F06072g22315086151e-63
Scas_720.7422315086033e-62
YMR207C (HFA1)21234705981e-61
AAR071W22315085962e-61
YNR016C (ACC1)22335085952e-61
Kwal_23.615722305085846e-60
CAGL0L10780g22335085837e-60
ABR140C4631992491e-21
KLLA0A09845g4691742279e-19
CAGL0M13585g4671732232e-18
Kwal_23.42494651852197e-18
Scas_684.254821802172e-17
YMR293C4641872038e-16
Kwal_56.222955831961672e-11
Sklu_2417.115911951611e-10
Sklu_2417.105911951611e-10
Sklu_1884.25461411521e-09
YDR242W (AMD2)5492881502e-09
Scas_721.665731511459e-09
Kwal_34.157245562571262e-06
KLLA0B08800g5703791208e-06
Sklu_2072.34501411172e-05
Scas_582.4*21933121163e-05
YJL130C (URA2)22143121155e-05
CAGL0L05676g22113121146e-05
Sklu_2331.122203121065e-04
Sklu_2136.36171301000.002
KLLA0E15444g2228312990.003
ACR263C2240312980.005
Kwal_27.10438569273970.005
Kwal_33.140612221312960.007
KLLA0F03190g1117181940.011
KLLA0D12628g578394910.021
YJR109C (CPA2)1118195890.042
KLLA0C09735g78487840.19
YKL162C40252820.22
Sklu_2258.5580178820.24
ABR157W1113203800.53
CAGL0C04917g1113207790.63
Kwal_55.197831121181790.73
Sklu_2413.41122203771.2
KLLA0B13651g46422751.6
Kwal_27.12376749151751.9
Scas_691.191117203751.9
AER169C762123751.9
ACR210C56575732.8
Sklu_2071.346481723.7
YKL143W (LTV1)46398699.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADR051C
         (1786 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH] (796213..8...  3506   0.0  
Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement         2352   0.0  
Kwal_27.11951                                                        2310   0.0  
YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea amid...  2275   0.0  
KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharo...  2269   0.0  
Scas_721.40                                                          2157   0.0  
CAGL0M05533g complement(588667..594171) similar to sp|P32528 Sac...  2097   0.0  
YBR218C (PYC2) [399] chr2 complement(658664..662206) Pyruvate ca...   279   2e-76
CAGL0K06787g complement(659290..662817) highly similar to sp|P32...   276   9e-76
YGL062W (PYC1) [1917] chr7 (385197..388733) Pyruvate carboxylase...   275   3e-75
Kwal_14.1803                                                          275   4e-75
AAR162C [350] [Homologous to ScYGL062W (PYC1) - SH; ScYBR218C (P...   270   1e-73
KLLA0C05764g complement(512470..515991) highly similar to sp|P32...   266   3e-72
CAGL0F06941g 679960..683502 highly similar to sp|P11154 Saccharo...   265   5e-72
Scas_686.17                                                           264   9e-72
Scas_563.12                                                           247   3e-66
Sklu_1458.1 YGL062W, Contig c1458 155-3553 reverse complement         242   8e-65
KLLA0F06072g 583276..589971 highly similar to sp|Q00955 Saccharo...   241   1e-63
Scas_720.74                                                           236   3e-62
YMR207C (HFA1) [4163] chr13 complement(677192..683563) Protein w...   234   1e-61
AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C (H...   234   2e-61
YNR016C (ACC1) [4599] chr14 complement(654672..661373) Acetyl-Co...   233   2e-61
Kwal_23.6157                                                          229   6e-60
CAGL0L10780g complement(1149588..1156289) highly similar to sp|Q...   229   7e-60
ABR140C [732] [Homologous to ScYMR293C - SH] (662185..663576) [1...   100   1e-21
KLLA0A09845g complement(862467..863876) similar to sp|Q03557 Sac...    92   9e-19
CAGL0M13585g complement(1335488..1336891) similar to sp|Q03557 S...    91   2e-18
Kwal_23.4249                                                           89   7e-18
Scas_684.25                                                            88   2e-17
YMR293C (YMR293C) [4247] chr13 complement(855398..856792) Protei...    83   8e-16
Kwal_56.22295                                                          69   2e-11
Sklu_2417.11 , Contig c2417 20071-21846                                67   1e-10
Sklu_2417.10 , Contig c2417 20071-21846                                67   1e-10
Sklu_1884.2 YDR242W, Contig c1884 1484-3124 reverse complement         63   1e-09
YDR242W (AMD2) [1076] chr4 (946799..948448) Protein with similar...    62   2e-09
Scas_721.66                                                            60   9e-09
Kwal_34.15724                                                          53   2e-06
KLLA0B08800g complement(772732..774444) similar to ca|CA4426|CaA...    51   8e-06
Sklu_2072.3 , Contig c2072 3010-4362 reverse complement                50   2e-05
Scas_582.4*                                                            49   3e-05
YJL130C (URA2) [2788] chr10 complement(165641..172285) Multifunc...    49   5e-05
CAGL0L05676g 619734..626369 highly similar to sp|P07259 Saccharo...    49   6e-05
Sklu_2331.1 YJL130C, Contig c2331 2029-8691                            45   5e-04
Sklu_2136.3 , Contig c2136 3336-5189 reverse complement                43   0.002
KLLA0E15444g 1370741..1377427 highly similar to sp|P07259 Saccha...    43   0.003
ACR263C [1310] [Homologous to ScYJL130C (URA2) - SH] (827830..83...    42   0.005
Kwal_27.10438                                                          42   0.005
Kwal_33.14061                                                          42   0.007
KLLA0F03190g complement(296883..300236) highly similar to sp|P03...    41   0.011
KLLA0D12628g 1071637..1073373 weakly similar to sp|P22580 Saccha...    40   0.021
YJR109C (CPA2) [3001] chr10 complement(629500..632856) Carbamoyl...    39   0.042
KLLA0C09735g 841867..844221 similar to sgd|S0005782 Saccharomyce...    37   0.19 
YKL162C (YKL162C) [3108] chr11 complement(147635..148843) Protei...    36   0.22 
Sklu_2258.5 YML054C, Contig c2258 8274-10016 reverse complement        36   0.24 
ABR157W [750] [Homologous to ScYJR109C (CPA2) - SH] complement(6...    35   0.53 
CAGL0C04917g 457506..460847 highly similar to sp|P03965 Saccharo...    35   0.63 
Kwal_55.19783                                                          35   0.73 
Sklu_2413.4 YJR109C, Contig c2413 10886-14254                          34   1.2  
KLLA0B13651g complement(1196688..1198082) weakly similar to sp|P...    33   1.6  
Kwal_27.12376                                                          33   1.9  
Scas_691.19                                                            33   1.9  
AER169C [2672] [Homologous to ScYBR080C (SEC18) - SH] (951174..9...    33   1.9  
ACR210C [1257] [Homologous to ScYOR128C (ADE2) - SH] (714549..71...    33   2.8  
Sklu_2071.3 YPL101W, Contig c2071 2749-4143                            32   3.7  
YKL143W (LTV1) [3124] chr11 (176786..178177) Protein that may pl...    31   9.3  

>ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH]
            (796213..801672) [5460 bp, 1819 aa]
          Length = 1819

 Score = 3506 bits (9090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1723/1786 (96%), Positives = 1723/1786 (96%)

Query: 1    MTDHSSTVGWTSQQWREFXXXXXXXXXXXXXXXXXXXXXXXGAAWISVASDEHIEHQWRV 60
            MTDHSSTVGWTSQQWREF                       GAAWISVASDEHIEHQWRV
Sbjct: 1    MTDHSSTVGWTSQQWREFHRRASADASLARLLALAHAERDAGAAWISVASDEHIEHQWRV 60

Query: 61   LQSRGDRQRLPLYGVPVAVKDNIDVRGLATTAACPSFAYTAAQDATAVRLLRDAGAVILG 120
            LQSRGDRQRLPLYGVPVAVKDNIDVRGLATTAACPSFAYTAAQDATAVRLLRDAGAVILG
Sbjct: 61   LQSRGDRQRLPLYGVPVAVKDNIDVRGLATTAACPSFAYTAAQDATAVRLLRDAGAVILG 120

Query: 121  KTNMDQFATGLVGTRSPYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLTLGTDTAGSGR 180
            KTNMDQFATGLVGTRSPY                             PLTLGTDTAGSGR
Sbjct: 121  KTNMDQFATGLVGTRSPYGSVASAFSSAHAAGGSSSGSAVVVARGAVPLTLGTDTAGSGR 180

Query: 181  VPAALNNLVGVKPTRGTVSCTGVVPACRSLDCVSVFARDVADAHRCLRILARPDGSDPYS 240
            VPAALNNLVGVKPTRGTVSCTGVVPACRSLDCVSVFARDVADAHRCLRILARPDGSDPYS
Sbjct: 181  VPAALNNLVGVKPTRGTVSCTGVVPACRSLDCVSVFARDVADAHRCLRILARPDGSDPYS 240

Query: 241  RPSPADAPRRLSTCPVVGVPREPEWFGESQNAKLFATACQRMRATGARVVKVDPQPLLDL 300
            RPSPADAPRRLSTCPVVGVPREPEWFGESQNAKLFATACQRMRATGARVVKVDPQPLLDL
Sbjct: 241  RPSPADAPRRLSTCPVVGVPREPEWFGESQNAKLFATACQRMRATGARVVKVDPQPLLDL 300

Query: 301  GRSLYEGPWVAERYAAMRAFYSGQPPRDTLDPTVTGIITSAGGYSAADVFDHGLRRQKLV 360
            GRSLYEGPWVAERYAAMRAFYSGQPPRDTLDPTVTGIITSAGGYSAADVFDHGLRRQKLV
Sbjct: 301  GRSLYEGPWVAERYAAMRAFYSGQPPRDTLDPTVTGIITSAGGYSAADVFDHGLRRQKLV 360

Query: 361  AAIEAELAGVDALLVPTCPLNPTLAAIAAEPLLVNARQGMWTNFVNLADLAAVAIPAGFR 420
            AAIEAELAGVDALLVPTCPLNPTLAAIAAEPLLVNARQGMWTNFVNLADLAAVAIPAGFR
Sbjct: 361  AAIEAELAGVDALLVPTCPLNPTLAAIAAEPLLVNARQGMWTNFVNLADLAAVAIPAGFR 420

Query: 421  RDGLPQGVTLVGRKFSDXXXXXXXXXXXRVEDAEPRRCGALPAGQALCEDEVVSGSEERD 480
            RDGLPQGVTLVGRKFSD           RVEDAEPRRCGALPAGQALCEDEVVSGSEERD
Sbjct: 421  RDGLPQGVTLVGRKFSDLALLELGSRLLRVEDAEPRRCGALPAGQALCEDEVVSGSEERD 480

Query: 481  STVLLAVVGAHLRGLALHWQLDEVQAEFVREARTAPSYRLYALPKTGPVLKPALRRVCAG 540
            STVLLAVVGAHLRGLALHWQLDEVQAEFVREARTAPSYRLYALPKTGPVLKPALRRVCAG
Sbjct: 481  STVLLAVVGAHLRGLALHWQLDEVQAEFVREARTAPSYRLYALPKTGPVLKPALRRVCAG 540

Query: 541  KGAAIELEAYSVPEATFGRFVAMVPAPLAIGSVELESGEYIKSFVCEEDGYIQDGTVDIT 600
            KGAAIELEAYSVPEATFGRFVAMVPAPLAIGSVELESGEYIKSFVCEEDGYIQDGTVDIT
Sbjct: 541  KGAAIELEAYSVPEATFGRFVAMVPAPLAIGSVELESGEYIKSFVCEEDGYIQDGTVDIT 600

Query: 601  HLGGFRRYVEHLRRQRDVDKPFDTVLVANRGEIAVRIIRTLKRLGIRSVAVYSDPDRHSQ 660
            HLGGFRRYVEHLRRQRDVDKPFDTVLVANRGEIAVRIIRTLKRLGIRSVAVYSDPDRHSQ
Sbjct: 601  HLGGFRRYVEHLRRQRDVDKPFDTVLVANRGEIAVRIIRTLKRLGIRSVAVYSDPDRHSQ 660

Query: 661  HVRDADVAVALGGSSAAETYLDIDKILAAAKKTDTQAIIPGYGFLSENATFAERCGAEGI 720
            HVRDADVAVALGGSSAAETYLDIDKILAAAKKTDTQAIIPGYGFLSENATFAERCGAEGI
Sbjct: 661  HVRDADVAVALGGSSAAETYLDIDKILAAAKKTDTQAIIPGYGFLSENATFAERCGAEGI 720

Query: 721  VFVGPSGDSIRKLGLKHWARELAASAGVPLTKGTGLLQSASAALEAGEEIGYPLMVKSTA 780
            VFVGPSGDSIRKLGLKHWARELAASAGVPLTKGTGLLQSASAALEAGEEIGYPLMVKSTA
Sbjct: 721  VFVGPSGDSIRKLGLKHWARELAASAGVPLTKGTGLLQSASAALEAGEEIGYPLMVKSTA 780

Query: 781  GGGGIGLQRVDSAAELAAAFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGDGHGRT 840
            GGGGIGLQRVDSAAELAAAFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGDGHGRT
Sbjct: 781  GGGGIGLQRVDSAAELAAAFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGDGHGRT 840

Query: 841  VALGERDCSLQRRNQKIIEETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQ 900
            VALGERDCSLQRRNQKIIEETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQ
Sbjct: 841  VALGERDCSLQRRNQKIIEETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQ 900

Query: 901  KDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMLRIAANTPPDFDAGVEIEGVSMEARVYV 960
            KDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMLRIAANTPPDFDAGVEIEGVSMEARVYV
Sbjct: 901  KDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMLRIAANTPPDFDAGVEIEGVSMEARVYV 960

Query: 961  ENPVKGFTPSPGLLTEVVFPSWARVDTWILKGTRVAAEYDPTLAKIIVHGKDREDAVSKL 1020
            ENPVKGFTPSPGLLTEVVFPSWARVDTWILKGTRVAAEYDPTLAKIIVHGKDREDAVSKL
Sbjct: 961  ENPVKGFTPSPGLLTEVVFPSWARVDTWILKGTRVAAEYDPTLAKIIVHGKDREDAVSKL 1020

Query: 1021 LLALSETRIAGCMTNLDYLKSIASSEEFRKASVFTRLLNDFEYTPTAFEVKIPGAYTTIQ 1080
            LLALSETRIAGCMTNLDYLKSIASSEEFRKASVFTRLLNDFEYTPTAFEVKIPGAYTTIQ
Sbjct: 1021 LLALSETRIAGCMTNLDYLKSIASSEEFRKASVFTRLLNDFEYTPTAFEVKIPGAYTTIQ 1080

Query: 1081 DYPGRVGYWRIGVPPSGPMDSYSFRLANRVVGNDSKAAALEITLNGPELKFHSDAVIAVT 1140
            DYPGRVGYWRIGVPPSGPMDSYSFRLANRVVGNDSKAAALEITLNGPELKFHSDAVIAVT
Sbjct: 1081 DYPGRVGYWRIGVPPSGPMDSYSFRLANRVVGNDSKAAALEITLNGPELKFHSDAVIAVT 1140

Query: 1141 GGAVPVTLNGKPVLQYVPLTLEKGDVLKIGKLESGSRAYLAVRGGIDVPEFLGSRSTFAM 1200
            GGAVPVTLNGKPVLQYVPLTLEKGDVLKIGKLESGSRAYLAVRGGIDVPEFLGSRSTFAM
Sbjct: 1141 GGAVPVTLNGKPVLQYVPLTLEKGDVLKIGKLESGSRAYLAVRGGIDVPEFLGSRSTFAM 1200

Query: 1201 GGIGGHNGRVLAPGDVLFINKDSSVAVGDTVTIPSGLQPVIPRESWKIGLVCGPHGSPDF 1260
            GGIGGHNGRVLAPGDVLFINKDSSVAVGDTVTIPSGLQPVIPRESWKIGLVCGPHGSPDF
Sbjct: 1201 GGIGGHNGRVLAPGDVLFINKDSSVAVGDTVTIPSGLQPVIPRESWKIGLVCGPHGSPDF 1260

Query: 1261 FKREALEEFFSSPWKVHYNSNRFGIRLIGPKPKWARSDGGEAGLHPSNTHDYVYSVGAIN 1320
            FKREALEEFFSSPWKVHYNSNRFGIRLIGPKPKWARSDGGEAGLHPSNTHDYVYSVGAIN
Sbjct: 1261 FKREALEEFFSSPWKVHYNSNRFGIRLIGPKPKWARSDGGEAGLHPSNTHDYVYSVGAIN 1320

Query: 1321 FTGDEPVIIAAEGPSLGGFVCAAVVPEAELWKVGQLKPGDTIKFVPISVDTARALKRSQD 1380
            FTGDEPVIIAAEGPSLGGFVCAAVVPEAELWKVGQLKPGDTIKFVPISVDTARALKRSQD
Sbjct: 1321 FTGDEPVIIAAEGPSLGGFVCAAVVPEAELWKVGQLKPGDTIKFVPISVDTARALKRSQD 1380

Query: 1381 AAVDALDILSSIKLDDSMVLPSYQDPVLLRLAKRSGLCPKVTFRQSGDRYILIEYGENEM 1440
            AAVDALDILSSIKLDDSMVLPSYQDPVLLRLAKRSGLCPKVTFRQSGDRYILIEYGENEM
Sbjct: 1381 AAVDALDILSSIKLDDSMVLPSYQDPVLLRLAKRSGLCPKVTFRQSGDRYILIEYGENEM 1440

Query: 1441 DINISYRIKQLQEMVTKNKVTGIVEMSQGIRSLLVEYNGYTISQEDLLSVLSAYELEINF 1500
            DINISYRIKQLQEMVTKNKVTGIVEMSQGIRSLLVEYNGYTISQEDLLSVLSAYELEINF
Sbjct: 1441 DINISYRIKQLQEMVTKNKVTGIVEMSQGIRSLLVEYNGYTISQEDLLSVLSAYELEINF 1500

Query: 1501 DVDWKVKAKLFRLPMAFEDSKTLEAVRRYQETIRSDAPWLPSNADFVANVNGITRADVRD 1560
            DVDWKVKAKLFRLPMAFEDSKTLEAVRRYQETIRSDAPWLPSNADFVANVNGITRADVRD
Sbjct: 1501 DVDWKVKAKLFRLPMAFEDSKTLEAVRRYQETIRSDAPWLPSNADFVANVNGITRADVRD 1560

Query: 1561 LLYSATFMVLGLGDVFLGAPCAVPLDPRQRLLGTKYNPSRTYTPNGVVGIGGMYMCIYCT 1620
            LLYSATFMVLGLGDVFLGAPCAVPLDPRQRLLGTKYNPSRTYTPNGVVGIGGMYMCIYCT
Sbjct: 1561 LLYSATFMVLGLGDVFLGAPCAVPLDPRQRLLGTKYNPSRTYTPNGVVGIGGMYMCIYCT 1620

Query: 1621 DSPGGYQLMGRTIPIWNRLQLGEAWKDHPWLLTPFDQVEFYPVSEERINELTEEVENGTF 1680
            DSPGGYQLMGRTIPIWNRLQLGEAWKDHPWLLTPFDQVEFYPVSEERINELTEEVENGTF
Sbjct: 1621 DSPGGYQLMGRTIPIWNRLQLGEAWKDHPWLLTPFDQVEFYPVSEERINELTEEVENGTF 1680

Query: 1681 ELEVKETVFDNGAYNRWLEDNRESIQAFKEGQSGERAAEFARLIKVANSDLETAVRKEAE 1740
            ELEVKETVFDNGAYNRWLEDNRESIQAFKEGQSGERAAEFARLIKVANSDLETAVRKEAE
Sbjct: 1681 ELEVKETVFDNGAYNRWLEDNRESIQAFKEGQSGERAAEFARLIKVANSDLETAVRKEAE 1740

Query: 1741 PVEYPEDAHMVYSEYAGRFWKQVVSVGDKVKEGDKLVIIEAMKTEM 1786
            PVEYPEDAHMVYSEYAGRFWKQVVSVGDKVKEGDKLVIIEAMKTEM
Sbjct: 1741 PVEYPEDAHMVYSEYAGRFWKQVVSVGDKVKEGDKLVIIEAMKTEM 1786

>Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement
          Length = 1830

 Score = 2352 bits (6094), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1120/1795 (62%), Positives = 1385/1795 (77%), Gaps = 15/1795 (0%)

Query: 7    TVGWTSQQWREFXXXXXXXXXXXXXXXXXXXXXXX--GAAWISVASDEHIEHQWRVLQSR 64
            T+GW++Q W +F                           AWIS+ ++ ++ HQW+VLQS+
Sbjct: 5    TLGWSAQDWIDFHGKSTPEHSYNTLLSLLKSQKSAPEDPAWISLINEANLAHQWKVLQSK 64

Query: 65   GDRQRLPLYGVPVAVKDNIDVRGLATTAACPSFAYTAAQDATAVRLLRDAGAVILGKTNM 124
             ++Q+LPLYGVP+AVKDNID +G  TTAACP+F Y  + D+T V LL+DAGA+++GKTN+
Sbjct: 65   ANKQQLPLYGVPIAVKDNIDSKGSPTTAACPAFEYNPSADSTVVALLKDAGAIVIGKTNL 124

Query: 125  DQFATGLVGTRSPYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLTLGTDTAGSGRVPAA 184
            DQFATGLVGTRSPY                             P+ LGTDTAGSGRVPAA
Sbjct: 125  DQFATGLVGTRSPYGKTPCVFSDKHVSGGSSAGSASAVGRGIVPIALGTDTAGSGRVPAA 184

Query: 185  LNNLVGVKPTRGTVSCTGVVPACRSLDCVSVFARDVADAHRCLRILARPD-GSDPYSRPS 243
            LNNL+G+KPT+G  SC+GVVPAC+SLDCVSVFA +++DA RC +++A+PD  +D YSRP 
Sbjct: 185  LNNLIGLKPTKGLFSCSGVVPACKSLDCVSVFAMNLSDAERCFKVMAKPDLENDEYSRPL 244

Query: 244  PADAPRRLSTCPVVGVPREPEWFGESQNAKLFATACQRMRATGARVVKVDPQPLLDLGRS 303
            P++  ++      + +P+E  W+GE++N KL+A A + ++  GA +V +D +PLL L R 
Sbjct: 245  PSNPLQKYPKNVTIAIPKEVPWYGETENPKLYAKAIENLKVAGASIVTIDFEPLLALARC 304

Query: 304  LYEGPWVAERYAAMRAFYSGQPPRDTLDPTVTGIITSAGGYSAADVFDHGLRRQKLVAAI 363
            LYEG WVAERY A + F++  PP  +LDPTVT II +A  Y AAD F +  +RQ ++  +
Sbjct: 305  LYEGAWVAERYEATKDFFATNPPESSLDPTVTSIIKTATKYDAADSFRYEYQRQGILQKV 364

Query: 364  EAELAGVDALLVPTCPLNPTLAAIAAEPLLVNARQGMWTNFVNLADLAAVAIPAGFRRDG 423
            +  L  +D L VPTCPLNPT   +AAEP+LVN+RQG WTNFVNLAD+AA+A+PAGFR DG
Sbjct: 365  DQTLKDIDVLCVPTCPLNPTFEEVAAEPVLVNSRQGTWTNFVNLADMAALAVPAGFRPDG 424

Query: 424  LPQGVTLVGRKFSDXXXXXXXXXXXRVEDAEPRRC-GALPAGQALCEDEVVSGSE-ERDS 481
            LPQGVTL+G+KF+D           +V   +  R  G     Q   +D+ + G +   + 
Sbjct: 425  LPQGVTLIGKKFTDFALLELANRYFKVAFPQGSRTFGKFIDRQVTTKDDELRGPDISPED 484

Query: 482  TVLLAVVGAHLRGLALHWQLDEVQAEFVREARTAPSYRLYALPKTGPVLKPALRRVCAGK 541
            +V LAVVGAHL+GL L+WQL++V A ++   +T+ +Y+LYALPKTGP+LKP LRRV    
Sbjct: 485  SVKLAVVGAHLKGLPLYWQLEKVNATYLGSPKTSKNYKLYALPKTGPILKPGLRRVGEET 544

Query: 542  GAAIELEAYSVPEATFGRFVAMVPAPLAIGSVELESGEYIKSFVCEEDGYIQDGTVDITH 601
            G+ I+LE YSVP+  FG F++MVP PL IGSVELESGE++KSF+CEE GY Q GTVDIT 
Sbjct: 545  GSQIQLEVYSVPKENFGEFISMVPEPLGIGSVELESGEWVKSFICEEFGYTQKGTVDITK 604

Query: 602  LGGFRRYVEHLRRQR-DVDKPFDTVLVANRGEIAVRIIRTLKRLGIRSVAVYSDPDRHSQ 660
             GGF++Y++ L+++   V KPF+TVL+ANRGEIAVRII+TLK+L IRSVAVYSDPD++SQ
Sbjct: 605  YGGFKKYIDFLKQEEAKVKKPFETVLIANRGEIAVRIIKTLKKLNIRSVAVYSDPDKYSQ 664

Query: 661  HVRDADVAVALGGSSAAETYLDIDKILAAAKKTDTQAIIPGYGFLSENATFAERCGAEGI 720
            HV DAD+ VAL G +AAETYLDIDKI+ AAK T+ QAIIPGYGFLSENA FA++C  EGI
Sbjct: 665  HVIDADLGVALNGRTAAETYLDIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCVEEGI 724

Query: 721  VFVGPSGDSIRKLGLKHWARELAASAGVPLTKGTGLLQSASAALEAGEEIGYPLMVKSTA 780
            VFVGPSG++IRKLGLKH ARE+A  AGVPL  G+GL+ SA  A E   ++ YP+MVKSTA
Sbjct: 725  VFVGPSGEAIRKLGLKHSAREIAEKAGVPLVPGSGLVTSAKEAKEIANKLEYPVMVKSTA 784

Query: 781  GGGGIGLQRVDSAAELAAAFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGDGHGRT 840
            GGGGIGLQ+VDS  E+   FE VQ QG+ YF DSGVFLE F+  ARHVE+Q+MGDG+G+ 
Sbjct: 785  GGGGIGLQKVDSENEIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGYGKA 844

Query: 841  VALGERDCSLQRRNQKIIEETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQ 900
            +A+GERDCSLQRRNQKIIEETPAPNL   TR KMRQAA+ L S +KYKCAGTVEF+YDE+
Sbjct: 845  IAIGERDCSLQRRNQKIIEETPAPNLGETTRTKMRQAAESLGSLLKYKCAGTVEFIYDER 904

Query: 901  KDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMLRIAANTPPDFD-AGVEIEGVSMEARVY 959
            +DEFYFLEVN RLQVEHPITEMVTGLDLVEWMLRIAA+  PDF+ A + + G S+EAR+Y
Sbjct: 905  RDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAADDAPDFESANIVVTGASIEARLY 964

Query: 960  VENPVKGFTPSPGLLTEVVFPSWARVDTWILKGTRVAAEYDPTLAKIIVHGKDREDAVSK 1019
             ENP K F PSPGLLT+V FP WARVDTW+ KGT V+AEYDPTLAKIIVHGKDR DA+ K
Sbjct: 965  AENPAKDFRPSPGLLTDVHFPEWARVDTWVSKGTTVSAEYDPTLAKIIVHGKDRNDAIMK 1024

Query: 1020 LLLALSETRIAGCMTNLDYLKSIASSEEFRKASVFTRLLNDFEYTPTAFEVKIPGAYTTI 1079
            +  AL+ET + GC+TN+DYL+SIASSE F+ A V T++L+ ++Y P AFEV  PGAYTT+
Sbjct: 1025 MNKALNETVVYGCITNIDYLRSIASSEMFKTAKVATKILDSYDYKPCAFEVTSPGAYTTV 1084

Query: 1080 QDYPGRVGYWRIGVPPSGPMDSYSFRLANRVVGNDSKAAALEITLNGPELKFHSDAVIAV 1139
            QDYPGRVGYWRIGVPPSGPMD+YSFRLANR+VGN  KA A+E+TLNGP++ FH++ +IA+
Sbjct: 1085 QDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGNHYKAPAIELTLNGPKILFHTETIIAI 1144

Query: 1140 TGGAVPVTLNGKPVLQYVPLTLEKGDVLKIGKLESGSRAYLAVRGGIDVPEFLGSRSTFA 1199
            +GG    +LN KP+ Q  P+ + +GD L IGKL  G RAYLA+RGGIDVPE+LGSRSTFA
Sbjct: 1145 SGGIAACSLNDKPIEQNKPIQVNRGDHLAIGKLSVGCRAYLAIRGGIDVPEYLGSRSTFA 1204

Query: 1200 MGGIGGHNGRVLAPGDVLFINKD---SSVAVG---DTVTIPSGLQPVIPRES-WKIGLVC 1252
            +G +GG+NGRVL  GDVLF+N+    SS   G   +    P+ L P I  +  W IG+ C
Sbjct: 1205 LGNMGGYNGRVLKLGDVLFLNQPELASSSLPGPAYEPQAPPANLLPKISDDKEWTIGVTC 1264

Query: 1253 GPHGSPDFFKREALEEFFSSPWKVHYNSNRFGIRLIGPKPKWARSDGGEAGLHPSNTHDY 1312
            GPHGSPDFFK E++EEFFS  WKVHYNSNRFG+RLIGPKPKWAR DGGE GLHPSN HDY
Sbjct: 1265 GPHGSPDFFKPESVEEFFSEKWKVHYNSNRFGVRLIGPKPKWARKDGGEGGLHPSNAHDY 1324

Query: 1313 VYSVGAINFTGDEPVIIAAEGPSLGGFVCAAVVPEAELWKVGQLKPGDTIKFVPISVDTA 1372
            VYS+GAINFTGDEPVII ++GPSLGGFVC AVVPEAELWKVGQ+KPGD+I+FVPIS   A
Sbjct: 1325 VYSLGAINFTGDEPVIITSDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFVPISYQVA 1384

Query: 1373 RALKRSQDAAVDALDILSSIKLDDSMVLPSYQDPVLLRLAKRSGLCPKVTFRQSGDRYIL 1432
            R LK SQDAA++ L+      L   ++LP+Y+DPVL++L K+S L PKVT+RQ+GDRYIL
Sbjct: 1385 RQLKESQDAAIETLEDGKLQTLTSDLILPTYEDPVLVQLPKKSNLSPKVTYRQAGDRYIL 1444

Query: 1433 IEYGENEMDINISYRIKQLQEMVTKNKVTGIVEMSQGIRSLLVEYNGYTISQEDLLSVLS 1492
            +EYGEN+MD+NI+YRI QL  +V K+K  GIVEMSQG+RS+L+EY+GY ISQ  LL  L 
Sbjct: 1445 VEYGENQMDLNIAYRINQLINLVGKHKTVGIVEMSQGVRSVLIEYDGYKISQGALLDTLV 1504

Query: 1493 AYELEINFDVDWKVKAKLFRLPMAFEDSKTLEAVRRYQETIRSDAPWLPSNADFVANVNG 1552
            AYE EI FD +W +K+K+F+LP+AFEDSKTLE V RYQETIRS APWLP+N DFVA VN 
Sbjct: 1505 AYESEIQFDKNWSIKSKIFKLPLAFEDSKTLECVTRYQETIRSKAPWLPNNVDFVAEVND 1564

Query: 1553 ITRADVRDLLYSATFMVLGLGDVFLGAPCAVPLDPRQRLLGTKYNPSRTYTPNGVVGIGG 1612
            IT  DV ++LYSA F+VLGLGDVFLGAPCAVPLDPR R LG+KYNPSRTYT NGVVGIGG
Sbjct: 1565 ITHKDVENMLYSARFLVLGLGDVFLGAPCAVPLDPRHRFLGSKYNPSRTYTKNGVVGIGG 1624

Query: 1613 MYMCIYCTDSPGGYQLMGRTIPIWNRLQLGEAWKDHPWLLTPFDQVEFYPVSEERINELT 1672
            MYMCIY  DSPGGYQL+GRTIPIW++L+LG   ++HPWLLTPFDQVEFYPVSEE ++  T
Sbjct: 1625 MYMCIYAMDSPGGYQLVGRTIPIWDKLKLGSHSQEHPWLLTPFDQVEFYPVSEEELDRFT 1684

Query: 1673 EEVENGTFELEVKETVFDNGAYNRWLEDNRESIQAFKEGQSGERAAEFARLIKVANSDLE 1732
            E+ ENG F ++V+E+VFD+  Y +W+ +N ESI  F++ Q G +A EFARLI+VAN +LE
Sbjct: 1685 EDCENGKFPVQVEESVFDHKNYLKWINENIESITEFQKSQGGAKADEFARLIQVANQELE 1744

Query: 1733 TA-VRKEAEPVEYPEDAHMVYSEYAGRFWKQVVSVGDKVKEGDKLVIIEAMKTEM 1786
            ++   K A   EYPEDA MVYSEY+GRFWK +VS GD V +GD LVI+EAMKTEM
Sbjct: 1745 SSTTNKSAVEEEYPEDAEMVYSEYSGRFWKPMVSAGDTVTKGDGLVIVEAMKTEM 1799

>Kwal_27.11951
          Length = 1869

 Score = 2310 bits (5987), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1109/1795 (61%), Positives = 1371/1795 (76%), Gaps = 14/1795 (0%)

Query: 6    STVGWTSQQWREFXXXXXXXXXXXXXXXX--XXXXXXXGAAWISVASDEHIEHQWRVLQS 63
            +T+GW+ Q W  F                           AWIS+ S EH+EHQWR+LQS
Sbjct: 44   NTLGWSVQDWLGFHAEATPEASLAALSALIGAQKSAPEDPAWISLVSQEHLEHQWRILQS 103

Query: 64   RGDRQRLPLYGVPVAVKDNIDVRGLATTAACPSFAYTAAQDATAVRLLRDAGAVILGKTN 123
            +GD++ LPLYGVP+AVKDNID  G  TTAACP FAYT + D+T V LLRDAGA+++GKTN
Sbjct: 104  KGDKKELPLYGVPIAVKDNIDATGCETTAACPEFAYTPSNDSTVVALLRDAGAIVIGKTN 163

Query: 124  MDQFATGLVGTRSPYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLTLGTDTAGSGRVPA 183
            +DQFATGLVGTRSPY                             PL LGTDTAGSGRVPA
Sbjct: 164  LDQFATGLVGTRSPYGKTPCVFSNEHVSGGSSAGSASVVGRGIVPLALGTDTAGSGRVPA 223

Query: 184  ALNNLVGVKPTRGTVSCTGVVPACRSLDCVSVFARDVADAHRCLRILARPDG-SDPYSRP 242
            ALNNL+G+KP++G  SC+GVVPAC+SLDCVS+FA ++ DA RC +++A+PD   D YSR 
Sbjct: 224  ALNNLIGLKPSKGVFSCSGVVPACKSLDCVSIFALNLGDAERCFKVMAQPDTEKDEYSRA 283

Query: 243  SPADAPRRLSTCPVVGVPREPEWFGESQNAKLFATACQRMRATGARVVKVDPQPLLDLGR 302
             PA+  ++ +    + VP +  W+ E++N   +A A + ++ TGA+VV+VD +PLL+L R
Sbjct: 284  MPANPLQKYAKDATIAVPTKLPWYDETENFVHYAAAIENLKKTGAKVVEVDFEPLLELAR 343

Query: 303  SLYEGPWVAERYAAMRAFYSGQPPRDTLDPTVTGIITSAGGYSAADVFDHGLRRQKLVAA 362
             LYEG WVAERY A R F++  P   +LDPTVT II     Y AAD F +  +RQ ++  
Sbjct: 344  CLYEGAWVAERYEATRDFFAKNPSESSLDPTVTKIIKGGANYDAADAFRYEYKRQGILQK 403

Query: 363  IEAELAGVDALLVPTCPLNPTLAAIAAEPLLVNARQGMWTNFVNLADLAAVAIPAGFRRD 422
            +   L  +D L VPTCP NPT A + A P+ +N+RQG WTNFVNLADLAA+A+P GFR D
Sbjct: 404  VSKLLETIDVLCVPTCPHNPTFAQLEAMPVEMNSRQGTWTNFVNLADLAALAVPCGFRSD 463

Query: 423  GLPQGVTLVGRKFSDXXXXXXXXXXXRVE-DAEPRRCGALPAGQALCEDEVVSGSEERDS 481
            GLP G+TL+G+ F+D           ++      R  G         +D +       + 
Sbjct: 464  GLPTGITLIGKTFTDYALLELANRYFQIAFPNNSRTYGKFLETPITTQDNLQGPPFSTED 523

Query: 482  TVLLAVVGAHLRGLALHWQLDEVQAEFVREARTAPSYRLYALPKTGPVLKPALRRVCAGK 541
            ++ LAVVGAHL+GL LHWQL++V A+++   +T+P+YRLYALPKTGPVLKP LRRV +  
Sbjct: 524  SIKLAVVGAHLKGLPLHWQLEKVNAQYIGSPKTSPNYRLYALPKTGPVLKPGLRRVDSEG 583

Query: 542  GAAIELEAYSVPEATFGRFVAMVPAPLAIGSVELESGEYIKSFVCEEDGYIQDGTVDITH 601
            GA I+LE YSVP+  FG F++MVP PL IGSVELESGE++KSF+CEE GY QDGT DIT 
Sbjct: 584  GAQIQLEVYSVPKDQFGTFISMVPEPLGIGSVELESGEWVKSFICEEFGYTQDGTKDITE 643

Query: 602  LGGFRRYVEHL-RRQRDVDKPFDTVLVANRGEIAVRIIRTLKRLGIRSVAVYSDPDRHSQ 660
            LG F+ YV+ L R + +  KPF+TVLVANRGEIAVRII+TLK+L I+SVAVYSDPD++SQ
Sbjct: 644  LGSFKTYVDQLAREESEKKKPFETVLVANRGEIAVRIIKTLKKLKIKSVAVYSDPDKYSQ 703

Query: 661  HVRDADVAVALGGSSAAETYLDIDKILAAAKKTDTQAIIPGYGFLSENATFAERCGAEGI 720
            HV DADVAVAL G +AAETYLDIDKI+AAAK+T T+AIIPGYGFLSENA F++RC +EGI
Sbjct: 704  HVTDADVAVALKGRTAAETYLDIDKIIAAAKETGTEAIIPGYGFLSENADFSDRCASEGI 763

Query: 721  VFVGPSGDSIRKLGLKHWARELAASAGVPLTKGTGLLQSASAALEAGEEIGYPLMVKSTA 780
            VFVGP+GD+IRKLGLKH ARE+A  AGVPL  G+GL+++   A E  + + YP+MVKSTA
Sbjct: 764  VFVGPAGDAIRKLGLKHSAREIAEKAGVPLVPGSGLVKTPQEAREIAKALEYPVMVKSTA 823

Query: 781  GGGGIGLQRVDSAAELAAAFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGDGHGRT 840
            GGGGIGLQ+VDS  ++   FE VQ QG+ YF DSGVFLE F+  ARHVE+Q+MGDG G+ 
Sbjct: 824  GGGGIGLQKVDSEEDIERVFETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGKGKA 883

Query: 841  VALGERDCSLQRRNQKIIEETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQ 900
            +A+GERDCSLQRRNQK+IEETPAPNL   TR +MR+A++ L S +KY+CAGTVEF+YDE+
Sbjct: 884  IAIGERDCSLQRRNQKVIEETPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIYDER 943

Query: 901  KDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMLRIAANTPPDFDA-GVEIEGVSMEARVY 959
            +DEFYFLEVN RLQVEHPITEMVTGLDLVEWML IAA TPPDFDA  + + G S+EAR+Y
Sbjct: 944  RDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLLIAAGTPPDFDATKITVTGASIEARLY 1003

Query: 960  VENPVKGFTPSPGLLTEVVFPSWARVDTWILKGTRVAAEYDPTLAKIIVHGKDREDAVSK 1019
             ENPVK F PSPG LT+V FP WARVDTW+ KGT ++AEYDPTLAKIIVHGKDR++A+ K
Sbjct: 1004 AENPVKDFRPSPGQLTDVSFPEWARVDTWVSKGTTISAEYDPTLAKIIVHGKDRDEAIQK 1063

Query: 1020 LLLALSETRIAGCMTNLDYLKSIASSEEFRKASVFTRLLNDFEYTPTAFEVKIPGAYTTI 1079
            L  AL+ET I GC+TN+DYL+SIASSE F+ A V T++L+ ++Y P+AFE+  PGAYTT+
Sbjct: 1064 LNQALNETSIYGCITNIDYLRSIASSEMFKTAKVATKVLDSYDYRPSAFEITSPGAYTTV 1123

Query: 1080 QDYPGRVGYWRIGVPPSGPMDSYSFRLANRVVGNDSKAAALEITLNGPELKFHSDAVIAV 1139
            QDYPGRV +WRIGVPPSGPMDSYSFRLANR+VGN  KA A+EITLNGP+L FH+DAVIA+
Sbjct: 1124 QDYPGRVRHWRIGVPPSGPMDSYSFRLANRIVGNHYKAPAIEITLNGPKLLFHTDAVIAI 1183

Query: 1140 TGGAVPVTLNGKPVLQYVPLTLEKGDVLKIGKLESGSRAYLAVRGGIDVPEFLGSRSTFA 1199
            TG   P T+NG  V Q  PL+++KGD L +GKL  G RAYLA+RGGIDVPE+LGSRSTFA
Sbjct: 1184 TGAKAPCTINGSDVSQNKPLSVKKGDQLTVGKLSDGCRAYLAIRGGIDVPEYLGSRSTFA 1243

Query: 1200 MGGIGGHNGRVLAPGDVLFINKDSSVAVG------DTVTIPSGLQPVIP-RESWKIGLVC 1252
            +G +GG+NGRVL  GDVLF+N+    + G      D    P+ L P I   + WKIG+ C
Sbjct: 1244 LGNMGGYNGRVLKLGDVLFLNQPELPSSGIPAPVYDPSEPPASLLPAISGSKEWKIGVTC 1303

Query: 1253 GPHGSPDFFKREALEEFFSSPWKVHYNSNRFGIRLIGPKPKWARSDGGEAGLHPSNTHDY 1312
            GPHGSPDFFK E++EEFFS  WKVHYNSNRFG+RLIGPKPKWAR DGGE GLHPSN HDY
Sbjct: 1304 GPHGSPDFFKPESVEEFFSEQWKVHYNSNRFGVRLIGPKPKWARKDGGEGGLHPSNAHDY 1363

Query: 1313 VYSVGAINFTGDEPVIIAAEGPSLGGFVCAAVVPEAELWKVGQLKPGDTIKFVPISVDTA 1372
            VYS+GAINFTGDEPVII A+GPSLGGFVC AVVPE ELWKVGQ+KPGD I+FVP+S +TA
Sbjct: 1364 VYSLGAINFTGDEPVIITADGPSLGGFVCQAVVPEGELWKVGQVKPGDLIQFVPVSYETA 1423

Query: 1373 RALKRSQDAAVDALDILSSIKLDDSMVLPSYQDPVLLRLAKRSGLCPKVTFRQSGDRYIL 1432
            R LK SQD A++  +  S   L   +VLP+ ++PVL +L + S   PKVT+RQ+GDRY+L
Sbjct: 1424 RVLKESQDQAIETFENGSLRTLTSELVLPAAENPVLAQLPRYSEFSPKVTYRQAGDRYVL 1483

Query: 1433 IEYGENEMDINISYRIKQLQEMVTKNKVTGIVEMSQGIRSLLVEYNGYTISQEDLLSVLS 1492
            +EYGENEMD+NISYR+ +L  +V KNK  GIVEMSQG+RS+LVE++GY ISQ+ LL  L 
Sbjct: 1484 VEYGENEMDLNISYRVNRLINLVEKNKTIGIVEMSQGVRSVLVEFDGYKISQKALLETLI 1543

Query: 1493 AYELEINFDVDWKVKAKLFRLPMAFEDSKTLEAVRRYQETIRSDAPWLPSNADFVANVNG 1552
            AYE EI FD +W +K+K+F+LP+AFEDS+TLE V+RYQETIRS APWLP+N DF+A+VNG
Sbjct: 1544 AYEGEIKFDRNWSIKSKVFKLPLAFEDSETLECVKRYQETIRSKAPWLPNNVDFIADVNG 1603

Query: 1553 ITRADVRDLLYSATFMVLGLGDVFLGAPCAVPLDPRQRLLGTKYNPSRTYTPNGVVGIGG 1612
            I+ +DV D+LY A F+VLGLGDVFLGAPCAVPL+P  R LG+KYNPSRTYT NG VGIGG
Sbjct: 1604 ISHSDVEDMLYQARFLVLGLGDVFLGAPCAVPLNPTHRFLGSKYNPSRTYTKNGTVGIGG 1663

Query: 1613 MYMCIYCTDSPGGYQLMGRTIPIWNRLQLGEAWKDHPWLLTPFDQVEFYPVSEERINELT 1672
            MYMCIY  DSPGGYQL+GRTIPIW++LQLG     HPWLLTPFDQVE+Y V+E+ +N+ T
Sbjct: 1664 MYMCIYAMDSPGGYQLVGRTIPIWDKLQLGAHSSQHPWLLTPFDQVEYYQVTEDELNKFT 1723

Query: 1673 EEVENGTFELEVKETVFDNGAYNRWLEDNRESIQAFKEGQSGERAAEFARLIKVANSDLE 1732
            EE ENG F ++V+E+ FD+G Y +W++ N E I+ F+  Q+GE+A EFA+LI+ +N++LE
Sbjct: 1724 EECENGQFPVQVEESTFDHGEYLKWIDANSEIIKEFQNKQNGEKAEEFAKLIQESNAELE 1783

Query: 1733 TAVRKE-AEPVEYPEDAHMVYSEYAGRFWKQVVSVGDKVKEGDKLVIIEAMKTEM 1786
             A   + A   E+PEDA MVYSEY+GRFWK +VSVGD VK GD L+++EAMKTEM
Sbjct: 1784 KAPDSQGAVEEEFPEDAEMVYSEYSGRFWKPLVSVGDVVKAGDGLIVVEAMKTEM 1838

>YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea
            amidolyase, contains urea carboxylase and allophanate
            hydrolase activities fused together in a single
            polypeptide [5508 bp, 1835 aa]
          Length = 1835

 Score = 2275 bits (5896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1081/1791 (60%), Positives = 1367/1791 (76%), Gaps = 12/1791 (0%)

Query: 7    TVGWTSQQWREFXXXXXXXXXXXXXXXXXXXXXXX--GAAWISVASDEHIEHQWRVLQSR 64
            ++GW+ Q W +F                           AWIS+ S E++ HQ+++L+SR
Sbjct: 12   SLGWSIQDWIDFHKSSSSQASLRLLESLLDSQNVAPVDNAWISLISKENLLHQFQILKSR 71

Query: 65   GDRQRLPLYGVPVAVKDNIDVRGLATTAACPSFAYTAAQDATAVRLLRDAGAVILGKTNM 124
             +++ LPLYGVP+AVKDNIDVRGL TTAACPSFAY  ++D+  V LLR+AGA+I+GKTN+
Sbjct: 72   ENKETLPLYGVPIAVKDNIDVRGLPTTAACPSFAYEPSKDSKVVELLRNAGAIIVGKTNL 131

Query: 125  DQFATGLVGTRSPYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLTLGTDTAGSGRVPAA 184
            DQFATGLVGTRSPY                             P+ LGTDTAGSGRVPAA
Sbjct: 132  DQFATGLVGTRSPYGKTPCAFSKEHVSGGSSAGSASVVARGIVPIALGTDTAGSGRVPAA 191

Query: 185  LNNLVGVKPTRGTVSCTGVVPACRSLDCVSVFARDVADAHRCLRILARPD-GSDPYSRPS 243
            LNNL+G+KPT+G  SC GVVPAC+SLDCVS+FA +++DA RC RI+ +PD  +D YSRP 
Sbjct: 192  LNNLIGLKPTKGVFSCQGVVPACKSLDCVSIFALNLSDAERCFRIMCQPDPDNDEYSRPY 251

Query: 244  PADAPRRLSTCPVVGVPREPEWFGESQNAKLFATACQRMRATGARVVKVDPQPLLDLGRS 303
             ++  ++ S+   + +P+   W+GE++N  LF+ A + +  TGA V+++D +PLL+L R 
Sbjct: 252  VSNPLKKFSSNVTIAIPKNIPWYGETKNPVLFSNAVENLSRTGANVIEIDFEPLLELARC 311

Query: 304  LYEGPWVAERYAAMRAFYSGQPPRDTLDPTVTGIITSAGGYSAADVFDHGLRRQKLVAAI 363
            LYEG WVAERY A+++F   +PP+++LDPTV  II  A  YSA D F    +RQ ++  +
Sbjct: 312  LYEGTWVAERYQAIQSFLDSKPPKESLDPTVISIIEGAKKYSAVDCFSFEYKRQGILQKV 371

Query: 364  EAELAGVDALLVPTCPLNPTLAAIAAEPLLVNARQGMWTNFVNLADLAAVAIPAGFRRDG 423
               L  VD L VPTCPLNPT+  +A EP+LVN+RQG WTNFVNLADLAA+A+PAGFR DG
Sbjct: 372  RRLLESVDVLCVPTCPLNPTMQQVADEPVLVNSRQGTWTNFVNLADLAALAVPAGFRDDG 431

Query: 424  LPQGVTLVGRKFSDXXXXXXXXXXXR-VEDAEPRRCGALPAGQAL-CEDEVVSGSEERDS 481
            LP G+TL+G+KF+D           + +     R  G   +       D++V    +  +
Sbjct: 432  LPNGITLIGKKFTDYALLELANRYFQNIFPNGSRTYGTFTSSSVKPANDQLVGPDYDPST 491

Query: 482  TVLLAVVGAHLRGLALHWQLDEVQAEFVREARTAPSYRLYALPKTGPVLKPALRRVCAGK 541
            ++ LAVVGAHL+GL LHWQL++V A ++   +T+ +Y+L+ALPK GPVLKP LRRV    
Sbjct: 492  SIKLAVVGAHLKGLPLHWQLEKVNATYLCTTKTSKAYQLFALPKNGPVLKPGLRRVQDSN 551

Query: 542  GAAIELEAYSVPEATFGRFVAMVPAPLAIGSVELESGEYIKSFVCEEDGYIQDGTVDITH 601
            G+ IELE YSVP+  FG F++MVP PL IGSVELESGE+IKSF+CEE GY   GTVDIT 
Sbjct: 552  GSQIELEVYSVPKELFGAFISMVPEPLGIGSVELESGEWIKSFICEESGYKAKGTVDITK 611

Query: 602  LGGFRRYVEHLRRQRDVDKP-FDTVLVANRGEIAVRIIRTLKRLGIRSVAVYSDPDRHSQ 660
             GGFR Y E L+++    K  FDTVL+ANRGEIAVRII+TLK+LGIRSVAVYSDPD++SQ
Sbjct: 612  YGGFRAYFEMLKKKESQKKKLFDTVLIANRGEIAVRIIKTLKKLGIRSVAVYSDPDKYSQ 671

Query: 661  HVRDADVAVALGGSSAAETYLDIDKILAAAKKTDTQAIIPGYGFLSENATFAERCGAEGI 720
            HV DADV+V L G++AA+TYLD++KI+ AAK+T+ QAIIPGYGFLSENA F++ C + GI
Sbjct: 672  HVTDADVSVPLHGTTAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSDACTSAGI 731

Query: 721  VFVGPSGDSIRKLGLKHWARELAASAGVPLTKGTGLLQSASAALEAGEEIGYPLMVKSTA 780
             FVGPSGD IR LGLKH AR++A  AGVPL  G+ L+ S   A +   E+ YP+MVKSTA
Sbjct: 732  TFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPGSLLITSVEEAKKVAAELEYPVMVKSTA 791

Query: 781  GGGGIGLQRVDSAAELAAAFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGDGHGRT 840
            GGGGIGLQ+VDS  ++   FE V+ QGE +F D+GVFLE FI  ARHVEVQ+MGDG G+ 
Sbjct: 792  GGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQLMGDGFGKA 851

Query: 841  VALGERDCSLQRRNQKIIEETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQ 900
            +ALGERDCSLQRRNQK+IEETPAPNLP  TR  +R+AA+ L S + YKCAGTVEF+YDE+
Sbjct: 852  IALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLNYKCAGTVEFIYDEK 911

Query: 901  KDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMLRIAANTPPDFDA-GVEIEGVSMEARVY 959
            KDEFYFLEVNTRLQVEHPITEMVTGLDLVEWM+RIAAN  PDFD+  VE+ GVSMEAR+Y
Sbjct: 912  KDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAPDFDSTKVEVNGVSMEARLY 971

Query: 960  VENPVKGFTPSPGLLTEVVFPSWARVDTWILKGTRVAAEYDPTLAKIIVHGKDREDAVSK 1019
             ENP+K F PSPGLL +V FP WARVDTW+ KGT ++ EYDPTLAKIIVHGKDR+DA+SK
Sbjct: 972  AENPLKNFRPSPGLLVDVKFPDWARVDTWVKKGTNISPEYDPTLAKIIVHGKDRDDAISK 1031

Query: 1020 LLLALSETRIAGCMTNLDYLKSIASSEEFRKASVFTRLLNDFEYTPTAFEVKIPGAYTTI 1079
            L  AL ET++ GC+TN+DYLKSI +S+ F KA V T +LN ++Y PTA E+ +PGA+T+I
Sbjct: 1032 LNQALEETKVYGCITNIDYLKSIITSDFFAKAKVSTNILNSYQYEPTAIEITLPGAHTSI 1091

Query: 1080 QDYPGRVGYWRIGVPPSGPMDSYSFRLANRVVGNDSKAAALEITLNGPELKFHSDAVIAV 1139
            QDYPGRVGYWRIGVPPSGPMD+YSFRLANR+VGND +  A+E+TL GP + FH + VIA+
Sbjct: 1092 QDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGNDYRTPAIEVTLTGPSIVFHCETVIAI 1151

Query: 1140 TGGAVPVTLNGKPVLQYVPLTLEKGDVLKIGKLESGSRAYLAVRGGIDVPEFLGSRSTFA 1199
            TGG    TL+G+ + Q+ P+ +++G  L IGKL SG RAYL +RGGIDVP++LGS STF 
Sbjct: 1152 TGGTALCTLDGQEIPQHKPVEVKRGSTLSIGKLTSGCRAYLGIRGGIDVPKYLGSYSTFT 1211

Query: 1200 MGGIGGHNGRVLAPGDVLFI--NKDSSVAVGDTVTIPSGLQPVIPR-ESWKIGLVCGPHG 1256
            +G +GG+NGRVL  GDVLF+  N+++         IP  L P I   + W+IG+ CGPHG
Sbjct: 1212 LGNVGGYNGRVLKLGDVLFLPSNEENKSVECLPQNIPQSLIPQISETKEWRIGVTCGPHG 1271

Query: 1257 SPDFFKREALEEFFSSPWKVHYNSNRFGIRLIGPKPKWARSDGGEAGLHPSNTHDYVYSV 1316
            SPDFFK E++EEFFS  WKVHYNSNRFG+RLIGPKPKWARS+GGE G+HPSNTHDYVYS+
Sbjct: 1272 SPDFFKPESIEEFFSEKWKVHYNSNRFGVRLIGPKPKWARSNGGEGGMHPSNTHDYVYSL 1331

Query: 1317 GAINFTGDEPVIIAAEGPSLGGFVCAAVVPEAELWKVGQLKPGDTIKFVPISVDTARALK 1376
            GAINFTGDEPVII  +GPSLGGFVC AVVPEAELWKVGQ+KPGD+I+FVP+S +++R+LK
Sbjct: 1332 GAINFTGDEPVIITCDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFVPLSYESSRSLK 1391

Query: 1377 RSQDAAVDALDILSSIKLDDSMVLPSYQDPVLLRLAKRSGLCPKVTFRQSGDRYILIEYG 1436
             SQD A+ +LD     +LD   +LPS++ P+L ++ K + L PKV +RQ+GDRY+L+EYG
Sbjct: 1392 ESQDVAIKSLDGTKLRRLDSVSILPSFETPILAQMEKVNELSPKVVYRQAGDRYVLVEYG 1451

Query: 1437 ENEMDINISYRIKQLQEMVTKNKVTGIVEMSQGIRSLLVEYNGYTISQEDLLSVLSAYEL 1496
            +NEM+ NISYRI+ L  +V KNK  GIVEMSQG+RS+L+E++GY ++Q++LL VL AYE 
Sbjct: 1452 DNEMNFNISYRIECLISLVKKNKTIGIVEMSQGVRSVLIEFDGYKVTQKELLKVLVAYET 1511

Query: 1497 EINFDVDWKVKAKLFRLPMAFEDSKTLEAVRRYQETIRSDAPWLPSNADFVANVNGITRA 1556
            EI FD +WK+ + + RLPMAFEDSKTL  V+RYQETIRS APWLP+N DF+ANVNGI+R 
Sbjct: 1512 EIQFDENWKITSNIIRLPMAFEDSKTLACVQRYQETIRSSAPWLPNNVDFIANVNGISRN 1571

Query: 1557 DVRDLLYSATFMVLGLGDVFLGAPCAVPLDPRQRLLGTKYNPSRTYTPNGVVGIGGMYMC 1616
            +V D+LYSA FMVLGLGDVFLG+PCAVPLDPR R LG+KYNPSRTYT  G VGIGGMYMC
Sbjct: 1572 EVYDMLYSARFMVLGLGDVFLGSPCAVPLDPRHRFLGSKYNPSRTYTERGAVGIGGMYMC 1631

Query: 1617 IYCTDSPGGYQLMGRTIPIWNRLQLGEAWKDHPWLLTPFDQVEFYPVSEERINELTEEVE 1676
            IY  +SPGGYQL+GRTIPIW++L L  A  + PWL+ PFDQVEFYPVSEE ++++TE+ +
Sbjct: 1632 IYAANSPGGYQLVGRTIPIWDKLCLA-ASSEVPWLMNPFDQVEFYPVSEEDLDKMTEDCD 1690

Query: 1677 NGTFELEVKETVFDNGAYNRWLEDNRESIQAFKEGQSGERAAEFARLIKVANSDLETAVR 1736
            NG +++ ++++VFD+  Y RW+  N++SI AF+EGQ GERA EFA+LI+ ANS+L+ +V 
Sbjct: 1691 NGVYKVNIEKSVFDHQEYLRWINANKDSITAFQEGQLGERAEEFAKLIQNANSELKESVT 1750

Query: 1737 -KEAEPVEYPEDAHMVYSEYAGRFWKQVVSVGDKVKEGDKLVIIEAMKTEM 1786
             K  E  ++PE A +VYSEY+GRFWK + SVGD ++ G  L+IIEAMK EM
Sbjct: 1751 VKPDEEEDFPEGAEIVYSEYSGRFWKSIASVGDVIEAGQGLLIIEAMKAEM 1801

>KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharomyces
            cerevisiae YBR208c DUR1_2 urea amidolyase, start by
            similarity
          Length = 1829

 Score = 2269 bits (5880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1096/1796 (61%), Positives = 1351/1796 (75%), Gaps = 15/1796 (0%)

Query: 6    STVGWTSQQWREFXXXXXXXXXXXXXXXXXXXXXXX--GAAWISVASDEHIEHQWRVLQS 63
            ST+GW+ Q W  F                           AWIS+   E + HQW +LQS
Sbjct: 3    STLGWSVQDWLSFHSKSTPTKSLELLENLLKSQKPAPEDPAWISLIPVEDLHHQWNILQS 62

Query: 64   RGDRQRLPLYGVPVAVKDNIDVRGLATTAACPSFAYTAAQDATAVRLLRDAGAVILGKTN 123
            + +++ LPLYGVP+AVKDNID +GL TTAACPS+ Y   +D+  V LLRDAGAV++GKTN
Sbjct: 63   KSNKEELPLYGVPIAVKDNIDYKGLPTTAACPSYLYQPTRDSYVVELLRDAGAVVIGKTN 122

Query: 124  MDQFATGLVGTRSPYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLTLGTDTAGSGRVPA 183
            +DQFATGLVGTRSPY                             PL+LGTDTAGSGRVPA
Sbjct: 123  LDQFATGLVGTRSPYGKTPCVFNDKYVSGGSSAGSASVVGRGIVPLSLGTDTAGSGRVPA 182

Query: 184  ALNNLVGVKPTRGTVSCTGVVPACRSLDCVSVFARDVADAHRCLRILARPDG-SDPYSRP 242
            ALNNL+G+KPT+G  SC GVVPAC+SLDCVSVFA +++DA    +++ +PD   D YSR 
Sbjct: 183  ALNNLIGLKPTKGAFSCRGVVPACKSLDCVSVFALNLSDAEIAFKVMNKPDLLEDEYSRE 242

Query: 243  SPADAPRRLSTCPVVGVPREPEWFGESQNAKLFATACQRMRATGARVVKVDPQPLLDLGR 302
             P +   +      + +P+E  WFGE++N KL+  A   ++ TGA++V VD +PLL+L R
Sbjct: 243  FPKNPISQYPKDLTIAIPKEVPWFGETENPKLYTKAVASLKNTGAKIVVVDFEPLLELAR 302

Query: 303  SLYEGPWVAERYAAMRAFYSGQPPRDTLDPTVTGIITSAGGYSAADVFDHGLRRQKLVAA 362
             LYEG WVAERY A R F +  PP  +LD TV  II  A  + AAD F    +RQ ++  
Sbjct: 303  CLYEGAWVAERYCATRDFLATNPPESSLDETVVNIIKGAVKFDAADAFKFEYKRQGILQK 362

Query: 363  IEAELAGVDALLVPTCPLNPTLAAIAAEPLLVNARQGMWTNFVNLADLAAVAIPAGFRRD 422
            +   L  +D L VPTCPLNP L  +A EP+LVN+RQG WTNFVNLADLAA+A+P+GFR D
Sbjct: 363  VNLLLKDIDVLCVPTCPLNPKLEEVAQEPVLVNSRQGTWTNFVNLADLAALAVPSGFRSD 422

Query: 423  GLPQGVTLVGRKFSDXXXXXXXXXXXRVE-DAEPRRCGALPAGQALCEDEVVSGSEERDS 481
            GLP G+TL+G+KFSD            V      R  G     +   EDE+   S++  +
Sbjct: 423  GLPNGITLIGKKFSDYALLDLAKRFFSVAFPNNSRTYGKFVDRRITVEDELDGPSKDTLN 482

Query: 482  TVLLAVVGAHLRGLALHWQLDEVQAEFVREARTAPSYRLYALPKTGPVLKPALRRVCAGK 541
             V LAVVGAHL+GL LHWQL +  A ++   +T+ +Y+LYALPK GPVLKP LRRV  G 
Sbjct: 483  GVKLAVVGAHLKGLPLHWQLQKCNATYLSSPKTSNNYKLYALPKVGPVLKPGLRRVNDGT 542

Query: 542  GAAIELEAYSVPEATFGRFVAMVPAPLAIGSVELESGEYIKSFVCEEDGYIQDGTVDITH 601
            G+ I+LE YSVP   FG F+AMVP PL IGSVELESGE++KSF+CEE GY Q GTVDIT 
Sbjct: 543  GSQIQLEVYSVPYDRFGDFIAMVPEPLGIGSVELESGEWVKSFICEEFGYTQQGTVDITK 602

Query: 602  LGGFRRYVEHLR-RQRDVDKPFDTVLVANRGEIAVRIIRTLKRLGIRSVAVYSDPDRHSQ 660
             GGF+ Y+EH++  +    KPF+TVL+ANRGEIAVRI++TLKR+GI+SVAVYSDPD++SQ
Sbjct: 603  FGGFKPYIEHIQVTEAQKKKPFETVLIANRGEIAVRIMKTLKRMGIKSVAVYSDPDKYSQ 662

Query: 661  HVRDADVAVALGGSSAAETYLDIDKILAAAKKTDTQAIIPGYGFLSENATFAERCGAEGI 720
            HV DAD +VAL G +AAETYLDIDKI+ AAKKT  QAIIPGYGFLSENA F++RC  E I
Sbjct: 663  HVTDADFSVALHGRTAAETYLDIDKIINAAKKTGAQAIIPGYGFLSENADFSDRCSQENI 722

Query: 721  VFVGPSGDSIRKLGLKHWARELAASAGVPLTKGTGLLQSASAALEAGEEIGYPLMVKSTA 780
            VFVGPSGD+IRKLGLKH ARE+A  A VPL  G+GL++ A  A E  +++ YP+MVKSTA
Sbjct: 723  VFVGPSGDAIRKLGLKHSAREIAERAKVPLVPGSGLIKDAKEAKEVAKKLEYPVMVKSTA 782

Query: 781  GGGGIGLQRVDSAAELAAAFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGDGHGRT 840
            GGGGIGLQ+VDS  ++   FE VQ QG+ YF D+GVF+E F+  ARHVE+Q+MGDG G+ 
Sbjct: 783  GGGGIGLQKVDSEDDIERVFETVQHQGKSYFGDAGVFMERFVNNARHVEIQMMGDGFGKA 842

Query: 841  VALGERDCSLQRRNQKIIEETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQ 900
            +A+GERDCSLQRRNQK+IEETPAPNLP  TR KMR A++RL S +KYKCAGTVEF+YDEQ
Sbjct: 843  IAIGERDCSLQRRNQKVIEETPAPNLPEATRAKMRAASERLGSLLKYKCAGTVEFIYDEQ 902

Query: 901  KDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMLRIAANTPPDFD-AGVEIEGVSMEARVY 959
            +DEFYFLEVN RLQVEHPITEMVTGLDLVEWMLRIAAN  PDFD   +E+ G S+EAR+Y
Sbjct: 903  RDEFYFLEVNARLQVEHPITEMVTGLDLVEWMLRIAANDSPDFDNTKIEVSGASIEARLY 962

Query: 960  VENPVKGFTPSPGLLTEVVFPSWARVDTWILKGTRVAAEYDPTLAKIIVHGKDREDAVSK 1019
             ENPVK F PSPG LT V FPSWARVDTW+ KGT V+AEYDPTLAKIIVHGKDR DA+ K
Sbjct: 963  AENPVKDFRPSPGQLTSVSFPSWARVDTWVKKGTNVSAEYDPTLAKIIVHGKDRNDAIMK 1022

Query: 1020 LLLALSETRIAGCMTNLDYLKSIASSEEFRKASVFTRLLNDFEYTPTAFEVKIPGAYTTI 1079
            L  AL+ET + GC+TN+DYL+SIASS+ F++A V T++L+ F+Y P AFEV  PGA T++
Sbjct: 1023 LNQALNETAVYGCITNIDYLRSIASSKMFKEAKVATKVLDSFDYKPCAFEVLAPGANTSV 1082

Query: 1080 QDYPGRVGYWRIGVPPSGPMDSYSFRLANRVVGNDSKAAALEITLNGPELKFHSDAVIAV 1139
            QDYPGR GYWRIGVPPSGPMDSYSFRLANRVVGN+SK+ ALEITLNGP+L FH++ VIAV
Sbjct: 1083 QDYPGRTGYWRIGVPPSGPMDSYSFRLANRVVGNNSKSPALEITLNGPKLLFHTETVIAV 1142

Query: 1140 TGGAVPVTLNGKPVLQYVPLTLEKGDVLKIGKLESGSRAYLAVRGGIDVPEFLGSRSTFA 1199
            +GG V  TLN   + Q  P+ +++GD+L +GK+  G RAYL++RGGIDVPE+LGSRSTFA
Sbjct: 1143 SGGTVSCTLNDAQIAQNEPIEVKRGDILSVGKVTVGCRAYLSIRGGIDVPEYLGSRSTFA 1202

Query: 1200 MGGIGGHNGRVLAPGDVLFINKD----SSVAVGD--TVTIPSGLQPVIP-RESWKIGLVC 1252
            MG +GG+NGR+L  GDVLF+N+     SS+   D      P  L P +   + WKIG+ C
Sbjct: 1203 MGNMGGYNGRILKLGDVLFLNQPELSVSSLPAPDFEPQAAPKSLLPTLSTNKDWKIGVTC 1262

Query: 1253 GPHGSPDFFKREALEEFFSSPWKVHYNSNRFGIRLIGPKPKWARSDGGEAGLHPSNTHDY 1312
            GPHGS D FK E +E+FF+  WKVHYNSNRFG+RLIGPKPKWARSDGGEAGLHPSN HDY
Sbjct: 1263 GPHGSIDLFKEEYIEQFFNDKWKVHYNSNRFGVRLIGPKPKWARSDGGEAGLHPSNAHDY 1322

Query: 1313 VYSVGAINFTGDEPVIIAAEGPSLGGFVCAAVVPEAELWKVGQLKPGDTIKFVPISVDTA 1372
            VYS+GAINFTGDEPVII  +GPSLGGFVC AVV EAELWKVGQL PGDTI+FVP+S   A
Sbjct: 1323 VYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVAEAELWKVGQLTPGDTIQFVPLSYGVA 1382

Query: 1373 RALKRSQDAAVDALDILSSIKLDDSMVLPSYQDPVLLRLAKRSGLCPKVTFRQSGDRYIL 1432
            R LK SQD ++D  +  S ++L D  +LP Y++P+L  L K+S L PKVT+RQ+GDRYIL
Sbjct: 1383 RQLKESQDKSIDNFEEGSLLELSDDKILPKYENPILAVLPKKSDLSPKVTYRQAGDRYIL 1442

Query: 1433 IEYGENEMDINISYRIKQLQEMVTKNKVTGIVEMSQGIRSLLVEYNGYTISQEDLLSVLS 1492
            +EYGE E D+NI YRI +L   V +++  GIVEMSQG+RS+L+E++G  I+Q+ LL  L 
Sbjct: 1443 VEYGELEFDLNICYRINRLIHQVERHQTVGIVEMSQGVRSVLIEFDGSKINQKALLKCLI 1502

Query: 1493 AYELEINFDVDWKVKAKLFRLPMAFEDSKTLEAVRRYQETIRSDAPWLPSNADFVANVNG 1552
            AYE EI FD +W VK+K+F+LPMAFEDSKTL+ V RY+ETIRS+APWLP+N DF+A+VN 
Sbjct: 1503 AYESEIQFDKNWNVKSKIFKLPMAFEDSKTLDCVTRYRETIRSEAPWLPNNVDFIADVND 1562

Query: 1553 ITRADVRDLLYSATFMVLGLGDVFLGAPCAVPLDPRQRLLGTKYNPSRTYTPNGVVGIGG 1612
            I R DV+++LYSA FMVLGLGDVFLG+PCAVPLDPR R LGTKYNPSRTYT  GVVGIGG
Sbjct: 1563 IDRNDVKNMLYSAKFMVLGLGDVFLGSPCAVPLDPRHRYLGTKYNPSRTYTARGVVGIGG 1622

Query: 1613 MYMCIYCTD-SPGGYQLMGRTIPIWNRLQLGEAWKDHPWLLTPFDQVEFYPVSEERINEL 1671
            MYMCIY  + SPGGYQL+GRTI  W++L +G+   DHPWLLTPFDQVEFYPV+EE +  +
Sbjct: 1623 MYMCIYNAEGSPGGYQLVGRTITAWDKLVIGDHPIDHPWLLTPFDQVEFYPVTEEELEVI 1682

Query: 1672 TEEVENGTFELEVKETVFDNGAYNRWLEDNRESIQAFKEGQSGERAAEFARLIKVANSDL 1731
             E+ +NG F+++V+E++FD+  Y  W+ +N +SI AF+E Q GE+A EFARLI+VAN++L
Sbjct: 1683 IEDNDNGKFKIDVEESIFDHKEYLAWINENIDSIVAFQEAQGGEKADEFARLIQVANAEL 1742

Query: 1732 ETAVRKEAEPV-EYPEDAHMVYSEYAGRFWKQVVSVGDKVKEGDKLVIIEAMKTEM 1786
            + +   + + V EYP+DA ++YSEY GRFWK V +VGD V+ GD ++IIEAMKTEM
Sbjct: 1743 KKSGDDKPQDVEEYPDDAELLYSEYTGRFWKPVAAVGDHVEAGDGVIIIEAMKTEM 1798

>Scas_721.40
          Length = 1834

 Score = 2157 bits (5590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1042/1801 (57%), Positives = 1321/1801 (73%), Gaps = 17/1801 (0%)

Query: 1    MTDH--SSTVGWTSQQWREFXXXXXXXXXXXXXXXXXXXXXX--XGAAWISVASDEHIEH 56
            MT++    T+GW+ + W EF                           AW+S+ S + ++ 
Sbjct: 1    MTNNIAKKTLGWSIKDWIEFHQSVTADESFKQLQYLVECQQIAPTDPAWLSLCSADTLKK 60

Query: 57   QWRVLQSRGDRQRLPLYGVPVAVKDNIDVRGLATTAACPSFAYTAAQDATAVRLLRDAGA 116
            QW++LQ R  ++ LPLYGVPVA+KDNID RG  TTAACPSF Y   +D+  V+LLR+AGA
Sbjct: 61   QWQILQHRSGKESLPLYGVPVAIKDNIDARGFPTTAACPSFLYEPEKDSKVVKLLRNAGA 120

Query: 117  VILGKTNMDQFATGLVGTRSPYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLTLGTDTA 176
            +I+GKTN+DQFATGLVGTRSPY                             P+ LGTDTA
Sbjct: 121  IIIGKTNLDQFATGLVGTRSPYGKTPCVFSDKHVSGGSSAGSASVVARGIVPIALGTDTA 180

Query: 177  GSGRVPAALNNLVGVKPTRGTVSCTGVVPACRSLDCVSVFARDVADAHRCLRILARPD-G 235
            GSGRVPAALNNL+G+KPT+GT SC GVVPAC+SLDCVSVF+ +++DA  C +IL   D  
Sbjct: 181  GSGRVPAALNNLIGLKPTKGTFSCQGVVPACKSLDCVSVFSLNLSDAECCFKILCESDLE 240

Query: 236  SDPYSRPSPADAPRRLSTCPVVGVPREPEWFGESQNAKLFATACQRMRATGARVVKVDPQ 295
            +D YSR  P    R+ S    +G+P++  W+GE +N  L+  A +++  +GA + K+D +
Sbjct: 241  NDEYSRTYPRSPLRKFSDSVTIGIPKDLLWYGEEENPVLYDNAIKQLEKSGANITKIDFE 300

Query: 296  PLLDLGRSLYEGPWVAERYAAMRAFYSGQPPRDTLDPTVTGIITSAGGYSAADVFDHGLR 355
            PLL+L R LYEGPWVAERY+A++ F    P     D  V  II SA  +SA D F    +
Sbjct: 301  PLLELARCLYEGPWVAERYSAVKDFLQKNPSSKGFDHVVKSIIDSAKKFSAVDAFQFEYK 360

Query: 356  RQKLVAAIEAELAGVDALLVPTCPLNPTLAAIAAEPLLVNARQGMWTNFVNLADLAAVAI 415
            RQ L+  I+  L  +DAL VPTCPLNPT   ++ EP+LVN+RQG WTNFVNLAD+AA+AI
Sbjct: 361  RQGLLQKIDKLLENIDALCVPTCPLNPTFEDVSNEPILVNSRQGTWTNFVNLADMAALAI 420

Query: 416  PAGFRRDGLPQGVTLVGRKFSDXXXXXXXXXXXRVE-DAEPRRCGALPAGQALCEDEVVS 474
            P+GFR DGLP G+TL+G+KF+D           ++      R  G    G  + +D+V  
Sbjct: 421  PSGFRSDGLPTGITLIGKKFTDFALLDLAQMYFQIAYPNNSRTFGIFTEGVEINDDKVSG 480

Query: 475  GSEERDSTVLLAVVGAHLRGLALHWQLDEVQAEFVREARTAPSYRLYALPKTGPVLKPAL 534
                   ++ LAVVGAHL+GL LHWQL++V A F+   +T+ +Y LYALP+TGP+LKP L
Sbjct: 481  PVISSSDSIKLAVVGAHLKGLPLHWQLEKVNATFISSTKTSKNYELYALPRTGPILKPGL 540

Query: 535  RRVCAGKGAAIELEAYSVPEATFGRFVAMVPAPLAIGSVELESGEYIKSFVCEEDGYIQD 594
            RRV   +G AI++E YS+P   FG F++MVP PL IGSVELE+GE++KSF+CEE GY   
Sbjct: 541  RRVNE-EGFAIQVETYSIPVENFGTFISMVPEPLGIGSVELENGEWVKSFICEESGYTAK 599

Query: 595  GTVDITHLGGFRRYVEHLRRQRDVDKPFDTVLVANRGEIAVRIIRTLKRLGIRSVAVYSD 654
            G+V+IT  GGF+ Y++ L       KPF TVLVANRGEIAVRII+TLK++ I+SVA++S 
Sbjct: 600  GSVNITKYGGFKTYLKFLETNTKTKKPFTTVLVANRGEIAVRIIKTLKKMEIQSVAIFST 659

Query: 655  PDRHSQHVRDADVAVALGGSSAAETYLDIDKILAAAKKTDTQAIIPGYGFLSENATFAER 714
            PDR+SQHV DAD+ V L G SAA+TYL+I+KI+ AAKKT  QAIIPGYGFLSENA F+ER
Sbjct: 660  PDRYSQHVIDADLTVDLKGVSAADTYLNIEKIIDAAKKTGAQAIIPGYGFLSENADFSER 719

Query: 715  CGAEGIVFVGPSGDSIRKLGLKHWARELAASAGVPLTKGTGLLQSASAALEAGEEIGYPL 774
            C AEGI FVGPSGD +R LGLKH ARE+A  A VPL  G+ L+ +A  A E   ++ YP+
Sbjct: 720  CDAEGITFVGPSGDVMRGLGLKHSAREIAKKANVPLVPGSSLITTAHEAKEIAAKLEYPI 779

Query: 775  MVKSTAGGGGIGLQRVDSAAELAAAFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMG 834
            MVKSTAGGGGIGLQ+V+S  ++   FE V+ QG  YF DSGVF+E FI  ARHVEVQIMG
Sbjct: 780  MVKSTAGGGGIGLQKVESEDDIERIFETVKHQGAAYFGDSGVFMERFIENARHVEVQIMG 839

Query: 835  DGHGRTVALGERDCSLQRRNQKIIEETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVE 894
            DG G  +A+GERDCSLQRRNQKIIEETPAPNLP  TRQK+R+AAQRL S +KYKCAGTVE
Sbjct: 840  DGLGNALAIGERDCSLQRRNQKIIEETPAPNLPETTRQKLREAAQRLGSLLKYKCAGTVE 899

Query: 895  FMYDEQKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMLRIAANTPPDFDA-GVEIEGVS 953
            F+YDE +DEFYFLEVNTRLQVEHPITEMVTG+DLVEWML IAA+  PDF+   +++ GV+
Sbjct: 900  FIYDEIRDEFYFLEVNTRLQVEHPITEMVTGIDLVEWMLVIAADMAPDFNQLKIDVNGVA 959

Query: 954  MEARVYVENPVKGFTPSPGLLTEVVFPSWARVDTWILKGTRVAAEYDPTLAKIIVHGKDR 1013
            MEAR+Y ENPV  F PSPG L EV FP WAR+DTW+ KGT V  EYDPTLAKIIVHGKDR
Sbjct: 960  MEARLYAENPVHDFKPSPGQLVEVEFPKWARIDTWVSKGTIVTPEYDPTLAKIIVHGKDR 1019

Query: 1014 EDAVSKLLLALSETRIAGCMTNLDYLKSIASSEEFRKASVFTRLLNDFEYTPTAFEVKIP 1073
             DA+ KL  AL ET+++GC+TN+DYL+SI+SSE FR A V T +LN ++Y P+A E+ +P
Sbjct: 1020 HDALEKLNKALVETKVSGCITNIDYLRSISSSEMFRDAKVSTNILNSYDYKPSAMEIILP 1079

Query: 1074 GAYTTIQDYPGRVGYWRIGVPPSGPMDSYSFRLANRVVGNDSKAAALEITLNGPELKFHS 1133
            G++T+IQDYPGR G WRIGVPPSGPMD++SFRLAN++VGN+ KA A EITLNGP + FH 
Sbjct: 1080 GSHTSIQDYPGRKGCWRIGVPPSGPMDAFSFRLANKIVGNNHKAPAFEITLNGPTILFHI 1139

Query: 1134 DAVIAVTGGAVPVTLNGKPVLQYVPLTLEKGDVLKIGKLESGSRAYLAVRGGIDVPEFLG 1193
            DA+I +TGGA    LN   + Q+ P+ +  GD L IGKL +G RAYLA+RGG+DVPE+LG
Sbjct: 1140 DAIIGITGGACVCQLNNTQIEQFKPIHVTSGDKLSIGKLLTGCRAYLAIRGGVDVPEYLG 1199

Query: 1194 SRSTFAMGGIGGHNGRVLAPGDVLFINKDS---SVAVGDTVT---IPSGLQPVIPRE-SW 1246
            S+STF +G  GG++GR L  GD LFI+++     V  G   +   +   L P +P +  W
Sbjct: 1200 SKSTFTLGNFGGYSGRCLKMGDTLFIDQNKLNKYVLPGHNYSDQPLSYSLLPDMPTDKQW 1259

Query: 1247 KIGLVCGPHGSPDFFKREALEEFFSSPWKVHYNSNRFGIRLIGPKPKWARSDGGEAGLHP 1306
            KIG++CGPHGSPDFFK E ++ FFS  WKVHYNSNRFG+RL GPKP WAR DGGE GLHP
Sbjct: 1260 KIGVLCGPHGSPDFFKPEYVDSFFSEKWKVHYNSNRFGVRLSGPKPVWARKDGGEGGLHP 1319

Query: 1307 SNTHDYVYSVGAINFTGDEPVIIAAEGPSLGGFVCAAVVPEAELWKVGQLKPGDTIKFVP 1366
            SN HDYVYS+GAINFTGDEPVI+  +GPSLGGFVC AVV E+ELWKVGQ+KPGD I+FVP
Sbjct: 1320 SNAHDYVYSLGAINFTGDEPVIVTCDGPSLGGFVCHAVVAESELWKVGQVKPGDYIQFVP 1379

Query: 1367 ISVDTARALKRSQDAAVDALDILSSIKLDDSMVLPSYQDPVLLRLAKRSGLCPKVTFRQS 1426
            IS ++AR L +SQD A++ L+  S   LDD + LP+ +DPVL  L +R G+ P++T+RQ+
Sbjct: 1380 ISFESARELMKSQDVAINTLEPKSLKTLDDIITLPTPEDPVLRLLPERPGISPRITYRQA 1439

Query: 1427 GDRYILIEYGENEMDINISYRIKQLQEMVTKNKVTGIVEMSQGIRSLLVEYNGYTISQED 1486
            GDRYIL+EYGEN MD+NI YRI  L  +V      GIVEMSQG+RS+L+E++ Y ISQ  
Sbjct: 1440 GDRYILVEYGENIMDLNICYRIHSLIGLVDDYNTAGIVEMSQGVRSVLIEFDPYVISQTQ 1499

Query: 1487 LLSVLSAYELEINFDVDWKVKAKLFRLPMAFEDSKTLEAVRRYQETIRSDAPWLPSNADF 1546
            LL++L AYE E+ +  +W V +K+ RLPMAFEDSKT+  V RYQETIRS APWLP+NADF
Sbjct: 1500 LLTLLLAYEEELPYTENWTVNSKVIRLPMAFEDSKTMACVARYQETIRSSAPWLPNNADF 1559

Query: 1547 VANVNGITRADVRDLLYSATFMVLGLGDVFLGAPCAVPLDPRQRLLGTKYNPSRTYTPNG 1606
            VAN+NGIT  DV DL+YSA FMVLGLGDVFLG+PCAVPLDPR RLLG+KYNPSRT+T  G
Sbjct: 1560 VANINGITHKDVYDLVYSARFMVLGLGDVFLGSPCAVPLDPRHRLLGSKYNPSRTFTERG 1619

Query: 1607 VVGIGGMYMCIYCTDSPGGYQLMGRTIPIWNRLQLGEAWKDHPWLLTPFDQVEFYPVSEE 1666
             VG+GGM+MCIY   SPGGYQLMGRTIPIW++L L  +  + PWLL PFDQ+EFYPVSE+
Sbjct: 1620 AVGLGGMFMCIYAASSPGGYQLMGRTIPIWDKLLLLSS-SEQPWLLNPFDQIEFYPVSEK 1678

Query: 1667 RINELTEEVENGTFELEVKETVFDNGAYNRWLEDNRESIQAFKEGQSGERAAEFARLIKV 1726
             ++ LT++ + G + ++ ++  F++  Y +W+++N +SI  F+  Q GE A +FA+LI++
Sbjct: 1679 ELDRLTDDFDYGKYIVDSRKEKFNHMDYLKWVDENSKSITEFQLLQEGENAEKFAKLIEL 1738

Query: 1727 ANSDLETAVRKEAEPV-EYPEDAHMVYSEYAGRFWKQVVSVGDKVKEGDKLVIIEAMKTE 1785
            +N++L+     E + V +YPE++ M+YSEY+GRFWK +V+ G+ VK G  L+IIEAMKTE
Sbjct: 1739 SNAELDENDEIEKDQVNDYPENSVMIYSEYSGRFWKPLVTEGEFVKSGQGLIIIEAMKTE 1798

Query: 1786 M 1786
            M
Sbjct: 1799 M 1799

>CAGL0M05533g complement(588667..594171) similar to sp|P32528
            Saccharomyces cerevisiae YBR208c DUR1 urea amidolyase,
            hypothetical start
          Length = 1834

 Score = 2097 bits (5434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1014/1803 (56%), Positives = 1308/1803 (72%), Gaps = 23/1803 (1%)

Query: 2    TDHSSTVGWTSQQWREFXXXXXXXXXXXXXXXXXXXXXXX--GAAWISVASDEHIEHQWR 59
            T+   ++GW+ Q W +F                           AWISVA++  +E QW+
Sbjct: 4    TNICPSIGWSIQDWIDFHFKSTPKDSYESLLELVKNQRIAPEDPAWISVATESLLEQQWQ 63

Query: 60   VLQSRGDRQRLPLYGVPVAVKDNIDVRGLATTAACPSFAYTAAQDATAVRLLRDAGAVIL 119
            +LQSR ++++LPLYGVP+AVKDNID +G  TTAACPSF+Y   +D+T V LL+ AGA+I+
Sbjct: 64   LLQSRHEKEKLPLYGVPIAVKDNIDAKGFPTTAACPSFSYMPTRDSTVVELLKQAGAIII 123

Query: 120  GKTNMDQFATGLVGTRSPYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLTLGTDTAGSG 179
            GKTN+DQFATGLVGTRSPY                             P+ LGTDTAGSG
Sbjct: 124  GKTNLDQFATGLVGTRSPYGRTPCVFSDKHVSGGSSAGSASVVARGIVPIALGTDTAGSG 183

Query: 180  RVPAALNNLVGVKPTRGTVSCTGVVPACRSLDCVSVFARDVADAHRCLRILARPD-GSDP 238
            RVPAALNN++G+KPTRG  SC+GVVPAC+SLDCVSVF+ +++DA +CL+I+ + D  +D 
Sbjct: 184  RVPAALNNIIGLKPTRGIFSCSGVVPACKSLDCVSVFSMNLSDAEKCLKIMTKLDIENDE 243

Query: 239  YSRPSPADAPRRLSTCPVVGVPREPEWFGESQNAKLFATACQRMRATGARVVKVDPQPLL 298
            YSR  PA+  +  +    V +P+   W+GE +N  L+  A    +  GA++  +D +PLL
Sbjct: 244  YSRSFPANPLQSFNKNLTVAIPKNVMWYGEKENPLLYDRAIDNFKQLGAQIKIIDFEPLL 303

Query: 299  DLGRSLYEGPWVAERYAAMRAFYSGQPPRDTLDPTVTGIITSAGGYSAADVFDHGLRRQK 358
            +L R LYEG WVAERYAA R F    P + TLDP V GII SA  + AAD F++  +RQ 
Sbjct: 304  ELARCLYEGTWVAERYAATRKFLETSPQQSTLDPVVYGIIKSATKFDAADAFEYEYKRQG 363

Query: 359  LVAAIEAELAGVDALLVPTCPLNPTLAAIAAEPLLVNARQGMWTNFVNLADLAAVAIPAG 418
            ++  +E  L  +D L VPTCPLNP+   +  EP+LVN+RQG WTNFVNLADL+A+AIP G
Sbjct: 364  ILRKVEVLLQDIDVLCVPTCPLNPSFEEVDKEPILVNSRQGTWTNFVNLADLSALAIPVG 423

Query: 419  FRRDGLPQGVTLVGRKFSDXXXXXXXXXXXRVEDAEPRRCGALPAGQAL-----CEDEVV 473
            FR DGLP GVTL+ +KF D               A+    G  P G  L      +D+ +
Sbjct: 424  FRSDGLPNGVTLIAKKFEDYALLQLAKRFL----AQLYPSGTRPYGMFLDRYVGLKDDSL 479

Query: 474  SGS-EERDSTVLLAVVGAHLRGLALHWQLDEVQAEFVREARTAPSYRLYALPKTGPVLKP 532
             G     D +++LAVVGAHLRGL LHWQL++V A F+   +TA  Y LYALPK GPVLKP
Sbjct: 480  EGPIVSSDDSIVLAVVGAHLRGLPLHWQLEKVNATFICSTKTAKKYELYALPKNGPVLKP 539

Query: 533  ALRRVCAGKGAAIELEAYSVPEATFGRFVAMVPAPLAIGSVELESGEYIKSFVCEEDGYI 592
             LRR+ +G G+ IELE YSVP+  FG F++ VP PL IGSVELE+G+++KSF+CEE GY 
Sbjct: 540  GLRRITSGTGSQIELELYSVPKEKFGEFISFVPEPLGIGSVELENGKWVKSFICEESGYN 599

Query: 593  QDGTVDITHLGGFRRYVEHLRRQRDVDK-PFDTVLVANRGEIAVRIIRTLKRLGIRSVAV 651
              G++DI+H GGFR Y+E +    +  K  F TVLVANRGEIAVRII+TLK + I+S+A+
Sbjct: 600  STGSIDISHYGGFRAYIESIIPSNESKKGHFKTVLVANRGEIAVRIIKTLKSMQIKSLAI 659

Query: 652  YSDPDRHSQHVRDADVAVALGGSSAAETYLDIDKILAAAKKTDTQAIIPGYGFLSENATF 711
            YS  D++SQHV D D+A AL G +  ETYL ++KI++ AKK D  AIIPGYGFLSENA+F
Sbjct: 660  YSATDKYSQHVLDVDMAQALDGHTVEETYLHVEKIISIAKKYDVDAIIPGYGFLSENASF 719

Query: 712  AERCGAEGIVFVGPSGDSIRKLGLKHWARELAASAGVPLTKGTGLLQSASAALEAGEEIG 771
            A+RC  EGI F+GP G++IRKLGLKH ARE+A SAGVPL  G+ L+++A  A    + IG
Sbjct: 720  ADRCEQEGIQFIGPRGETIRKLGLKHSAREVAKSAGVPLVPGSPLVKNADEAFTIAKNIG 779

Query: 772  YPLMVKSTAGGGGIGLQRVDSAAELAAAFEQVQRQGELYFTDSGVFLESFIARARHVEVQ 831
            YP+MVKSTAGGGGIGLQ+VD+  ++  AFE V+ QG  YF DSGVF+E FI  ARHVEVQ
Sbjct: 780  YPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQ 839

Query: 832  IMGDGHGRTVALGERDCSLQRRNQKIIEETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAG 891
            IMGDG G+T+ALGERDCSLQRRNQK+IEETPAPNLP  TRQKM  AA+RL + + Y+ AG
Sbjct: 840  IMGDGKGKTLALGERDCSLQRRNQKVIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAG 899

Query: 892  TVEFMYDEQKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMLRIAANTPPDFDA-GVEIE 950
            TVEF+YDEQ+D+FYFLEVNTRLQVEHPITEMVTGLDLVEWM++I+A   P  D   +   
Sbjct: 900  TVEFIYDEQRDQFYFLEVNTRLQVEHPITEMVTGLDLVEWMIKISAGVMPSLDEFNISQN 959

Query: 951  GVSMEARVYVENPVKGFTPSPGLLTEVVFPSWARVDTWILKGTRVAAEYDPTLAKIIVHG 1010
            G S+E RVY ENP+K F PSPG L +V FP+  RVDTW+ KGT+++ E+DPTLAKIIVHG
Sbjct: 960  GASIEVRVYAENPLKDFRPSPGELVDVQFPNDCRVDTWVKKGTKISPEFDPTLAKIIVHG 1019

Query: 1011 KDREDAVSKLLLALSETRIAGCMTNLDYLKSIASSEEFRKASVFTRLLNDFEYTPTAFEV 1070
            KDR +A+ K+  AL+ET+I GC+TN+DYLKS+ SSE FR A + T  LN +EY+P+A E+
Sbjct: 1020 KDRNEAILKMKKALNETKIYGCVTNVDYLKSLISSEMFRNAQLSTNYLNTYEYSPSAVEI 1079

Query: 1071 KIPGAYTTIQDYPGRVGYWRIGVPPSGPMDSYSFRLANRVVGNDSKAAALEITLNGPELK 1130
              PGA TTIQDYPGRV YWRIGVPP GPMD+YSFRLANR+VGND +   +EITL GP +K
Sbjct: 1080 IEPGALTTIQDYPGRVNYWRIGVPPCGPMDNYSFRLANRIVGNDERTPGIEITLTGPTIK 1139

Query: 1131 FHSDAVIAVTGGAVPVTLNGKPVLQYVPLTLEKGDVLKIGKLESGSRAYLAVRGGIDVPE 1190
            F+SD+++++ GG V   L+ K +  + P++++ G VL IGK+  GSRAYLA+RGGIDVP+
Sbjct: 1140 FYSDSLVSIAGGEVCCKLDEKKIPMFEPISVKTGSVLSIGKIVKGSRAYLAIRGGIDVPK 1199

Query: 1191 FLGSRSTFAMGGIGGHNGRVLAPGDVLFINK--DSSVAVGDTVTIPSG----LQPVIPRE 1244
            ++GS STF MG +GG NGR L  GDVL + +  DS   +      P      ++P IP +
Sbjct: 1200 YMGSFSTFTMGNLGGFNGRALKRGDVLSLPQQFDSEHGIPSPCFSPEKAPIYVRPDIPND 1259

Query: 1245 S-WKIGLVCGPHGSPDFFKREALEEFFSSPWKVHYNSNRFGIRLIGPKPKWARSDGGEAG 1303
              W IG++ GPHG+PD F+ E + EFF S WKVHYNSNRFG+RLIGPKPKW+R+DGGE G
Sbjct: 1260 GVWTIGVLAGPHGAPDIFESEGMMEFFKSEWKVHYNSNRFGVRLIGPKPKWSRTDGGEGG 1319

Query: 1304 LHPSNTHDYVYSVGAINFTGDEPVIIAAEGPSLGGFVCAAVVPEAELWKVGQLKPGDTIK 1363
            LHPSNTHDYVYS+GAINFTGDEPVII  +GPSLGGFVC AVV EAE+WKVGQLKPGDTI 
Sbjct: 1320 LHPSNTHDYVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVSEAEMWKVGQLKPGDTIN 1379

Query: 1364 FVPISVDTARALKRSQDAAVDALDILSSIKLDDSMVLPSYQDPVLLRLAKRSGLCPKVTF 1423
            F PI   +AR LK +QD  ++ +   +  KL D  +L S +DP+L +   +    PKV +
Sbjct: 1380 FTPIDWQSARNLKENQDVIINDMSSCALQKLSDQPLLKSPEDPILFQKDGQELQSPKVVY 1439

Query: 1424 RQSGDRYILIEYGENEMDINISYRIKQLQEMVTKNKVTGIVEMSQGIRSLLVEYNGYTIS 1483
            RQ+GDRYILIEYG++  ++N+ YRIK L +++++    GI EMSQG+RS+LVEY+GY IS
Sbjct: 1440 RQAGDRYILIEYGDDIFELNLCYRIKSLIDIISQRNTKGIKEMSQGVRSVLVEYDGYEIS 1499

Query: 1484 QEDLLSVLSAYELEINFDVDWKVKAKLFRLPMAFEDSKTLEAVRRYQETIRSDAPWLPSN 1543
            Q++LL  L AYE ++  + +W VK+++FRLPMAFED +TL  V+RYQETIRS APWLP+N
Sbjct: 1500 QKELLKTLIAYEEQLPQEKNWSVKSRIFRLPMAFEDKETLACVKRYQETIRSKAPWLPNN 1559

Query: 1544 ADFVANVNGITRADVRDLLYSATFMVLGLGDVFLGAPCAVPLDPRQRLLGTKYNPSRTYT 1603
             DFVA VN +T  D+R L+Y+  +MVLG+GDVFLG+PCA+PLDPR RLLG+KYNPSRT+T
Sbjct: 1560 VDFVAEVNNLTHDDIRQLIYTTRYMVLGVGDVFLGSPCAIPLDPRNRLLGSKYNPSRTFT 1619

Query: 1604 PNGVVGIGGMYMCIYCTDSPGGYQLMGRTIPIWNRLQLGEAWKDHPWLLTPFDQVEFYPV 1663
              GVVGIGG YMCIY  DSPGGYQL+GRTIPIW+RL L ++ KD PWLL+PFDQ+EFYPV
Sbjct: 1620 KRGVVGIGGSYMCIYAADSPGGYQLVGRTIPIWDRLML-QSKKDEPWLLSPFDQIEFYPV 1678

Query: 1664 SEERINELTEEVENGTFELEVKETVFDNGAYNRWLEDNRESIQAFKEGQSGERAAEFARL 1723
            SEE+I+E T+E +NG ++++V + VFD+G+Y +W++DN E+I+  +  Q G+  ++FA+ 
Sbjct: 1679 SEEQIDEYTDEWDNGNYKIDVDDVVFDHGSYLKWVQDNIEAIEEHQRAQRGDNYSKFAQK 1738

Query: 1724 IKVANSDLETAVRKEAEPVEYPEDAHMVYSEYAGRFWKQVVSVGDKVKEGDKLVIIEAMK 1783
            I+ AN+DL+    +  E     +D   ++SEYAGRFWK +V +G  +++   + +IEAMK
Sbjct: 1739 IQEANADLKQTTTEVIEQNILEDDCEYIFSEYAGRFWKPIVEIGASIEKDQGVAVIEAMK 1798

Query: 1784 TEM 1786
            TEM
Sbjct: 1799 TEM 1801

>YBR218C (PYC2) [399] chr2 complement(658664..662206) Pyruvate
            carboxylase 2 [3543 bp, 1180 aa]
          Length = 1180

 Score =  279 bits (713), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 172/461 (37%), Positives = 256/461 (55%), Gaps = 19/461 (4%)

Query: 623  DTVLVANRGEIAVRIIRTLKRLGIRSVAVYSDPDRHSQHVRDADVAVALGGS---SAAET 679
            + +LVANRGEI +RI R+   L +R++A+YS  DR S H   AD A  +G     +    
Sbjct: 21   NKILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRLSMHRLKADEAYVIGEEGQYTPVGA 80

Query: 680  YLDIDKILAAAKKTDTQAIIPGYGFLSENATFAERCGAEGIVFVGPSGDSIRKLGLKHWA 739
            YL +D+I+  AKK     I PGYGFLSEN+ FA++    GI ++GP  + I  +G K  A
Sbjct: 81   YLAMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKAGITWIGPPAEVIDSVGDKVSA 140

Query: 740  RELAASAGVPLTKGT-GLLQSASAALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAELAA 798
            R LAA A VP   GT G +++   AL+   E GYP+++K+  GGGG G++ V    ++A 
Sbjct: 141  RHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKAAFGGGGRGMRVVREGDDVAD 200

Query: 799  AFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGDGHGRTVALGERDCSLQRRNQKII 858
            AF++   +    F +   F+E F+ + +H+EVQ++ D HG  V L ERDCS+QRR+QK++
Sbjct: 201  AFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVV 260

Query: 859  EETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFLEVNTRLQVEHP 918
            E  PA  LP   R  +   A +L     Y+ AGT EF+ D Q +  YF+E+N R+QVEH 
Sbjct: 261  EVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVDNQ-NRHYFIEINPRIQVEHT 319

Query: 919  ITEMVTGLDLVEWMLRIAANTPPD----FDAGVEIEGVSMEARVYVENPVKGFTPSPGLL 974
            ITE +TG+D+V   ++IAA             +   G S++ R+  E+P K F P  G L
Sbjct: 320  ITEEITGIDIVSAQIQIAAGATLTQLGLLQDKITTRGFSIQCRITTEDPSKNFQPDTGRL 379

Query: 975  TEVVFPSWA----RVDTW-ILKGTRVAAEYDPTLAKIIVHGKDREDAVSKLLLALSETRI 1029
               V+ S      R+D      G  ++  YD  L K    G   E    K++ AL E RI
Sbjct: 380  E--VYRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRI 437

Query: 1030 AGCMTNLDYLKSIASSEEFRKASVFTRLLNDFEYTPTAFEV 1070
             G  TN+ +L ++ ++  F + + +T  ++D   TP  F++
Sbjct: 438  RGVKTNIPFLLTLLTNPVFIEGTYWTTFIDD---TPQLFQM 475

 Score = 35.4 bits (80), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 3/78 (3%)

Query: 1712 QSGERAAEF---ARLIKVANSDLETAVRKEAEPVEYPEDAHMVYSEYAGRFWKQVVSVGD 1768
            ++G+R   F     L K+  +D    ++  A+P     D H + +  AG   +  V  G 
Sbjct: 1062 KTGQREVYFELNGELRKIRVADKSQNIQSVAKPKADVHDTHQIGAPMAGVIIEVKVHKGS 1121

Query: 1769 KVKEGDKLVIIEAMKTEM 1786
             VK+G+ + ++ AMK EM
Sbjct: 1122 LVKKGESIAVLSAMKMEM 1139

>CAGL0K06787g complement(659290..662817) highly similar to sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2 Pyruvate
            carboxylase 2, start by similarity
          Length = 1175

 Score =  276 bits (707), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 176/461 (38%), Positives = 253/461 (54%), Gaps = 19/461 (4%)

Query: 623  DTVLVANRGEIAVRIIRTLKRLGIRSVAVYSDPDRHSQHVRDADVAVALGGS---SAAET 679
            + +LVANRGEI +RI R+   L +R+VA+YS  DR S H   AD A  +G     +    
Sbjct: 21   NKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADEAYVIGKEGEYTPVGA 80

Query: 680  YLDIDKILAAAKKTDTQAIIPGYGFLSENATFAERCGAEGIVFVGPSGDSIRKLGLKHWA 739
            YL ID+I+  AKK     I PGYGFLSENA FA++    GI ++GP  + I  +G K  A
Sbjct: 81   YLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAGITWIGPPPEVIESVGDKVSA 140

Query: 740  RELAASAGVPLTKGT-GLLQSASAALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAELAA 798
            R LAA A VP   GT G +++   A +   + GYP+++K+  GGGG G++ V    ++A 
Sbjct: 141  RNLAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKAAYGGGGRGMRVVREGDDVAD 200

Query: 799  AFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGDGHGRTVALGERDCSLQRRNQKII 858
            AF++ + +    F +   F+E F+ + +H+EVQ++ D HG  V L ERDCS+QRR+QK++
Sbjct: 201  AFQRAKSEAITAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVV 260

Query: 859  EETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFLEVNTRLQVEHP 918
            E  PA  LP   R  +   A RL     Y+ AGT EF+ D Q +  YF+E+N R+QVEH 
Sbjct: 261  EVAPAKTLPREVRDSILTDAVRLAKEAGYRNAGTAEFLVDNQ-NRHYFIEINPRIQVEHT 319

Query: 919  ITEMVTGLDLVEWMLRIAANTP-PD---FDAGVEIEGVSMEARVYVENPVKGFTPSPGLL 974
            ITE +TG+DLV   ++IAA    P        +   G +++ R+  E+P K F P  G L
Sbjct: 320  ITEEITGIDLVSAQIQIAAGASLPQLGLLQDRITTRGFAIQCRITTEDPAKNFQPDTGRL 379

Query: 975  TEVVFPSWA----RVDTWI-LKGTRVAAEYDPTLAKIIVHGKDREDAVSKLLLALSETRI 1029
               V+ S      R+D      G  ++  YD  L K    G   E    K+L AL E RI
Sbjct: 380  E--VYRSAGGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRI 437

Query: 1030 AGCMTNLDYLKSIASSEEFRKASVFTRLLNDFEYTPTAFEV 1070
             G  TN+ +L ++ +   F     +T  ++D   TP  F +
Sbjct: 438  RGVKTNIPFLLTLLTHPVFISGDYWTTFIDD---TPQLFHM 475

>YGL062W (PYC1) [1917] chr7 (385197..388733) Pyruvate carboxylase 1,
            catalyzes conversion of pyruvate to oxaloacetate in the
            gluconeogenesis pathway [3537 bp, 1178 aa]
          Length = 1178

 Score =  275 bits (703), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 174/461 (37%), Positives = 261/461 (56%), Gaps = 19/461 (4%)

Query: 623  DTVLVANRGEIAVRIIRTLKRLGIRSVAVYSDPDRHSQHVRDADVAVALG---GSSAAET 679
            + +LVANRGEI +RI RT   L +++VA+YS  DR S H + AD A  +G     +    
Sbjct: 20   NKILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLSTHKQKADEAYVIGEVGQYTPVGA 79

Query: 680  YLDIDKILAAAKKTDTQAIIPGYGFLSENATFAERCGAEGIVFVGPSGDSIRKLGLKHWA 739
            YL ID+I++ A+K     I PGYGFLSEN+ FA++    GI ++GP  + I  +G K  A
Sbjct: 80   YLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGITWIGPPAEVIDSVGDKVSA 139

Query: 740  RELAASAGVPLTKGT-GLLQSASAALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAELAA 798
            R LAA A VP   GT G +++   AL+   E GYP+++K+  GGGG G++ V    ++A 
Sbjct: 140  RNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAAFGGGGRGMRVVREGDDVAD 199

Query: 799  AFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGDGHGRTVALGERDCSLQRRNQKII 858
            AF++   +    F +   F+E F+ + +H+EVQ++ D HG  V L ERDCS+QRR+QK++
Sbjct: 200  AFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVV 259

Query: 859  EETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFLEVNTRLQVEHP 918
            E  PA  LP   R  +   A +L     Y+ AGT EF+ D Q +  YF+E+N R+QVEH 
Sbjct: 260  EVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQ-NRHYFIEINPRIQVEHT 318

Query: 919  ITEMVTGLDLVEWMLRIAANTP-PD---FDAGVEIEGVSMEARVYVENPVKGFTPSPGLL 974
            ITE +TG+D+V   ++IAA    P    F   +   G +++ R+  E+P K F P  G +
Sbjct: 319  ITEEITGIDIVAAQIQIAAGASLPQLGLFQDKITTRGFAIQCRITTEDPAKNFQPDTGRI 378

Query: 975  TEVVFPS----WARVDTW-ILKGTRVAAEYDPTLAKIIVHGKDREDAVSKLLLALSETRI 1029
               V+ S      R+D      GT ++  YD  L K    G   E    K++ AL E RI
Sbjct: 379  E--VYRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRI 436

Query: 1030 AGCMTNLDYLKSIASSEEFRKASVFTRLLNDFEYTPTAFEV 1070
             G  TN+ +L ++ ++  F + + +T  ++D   TP  F++
Sbjct: 437  RGVKTNIPFLLTLLTNPVFIEGTYWTTFIDD---TPQLFQM 474

>Kwal_14.1803
          Length = 1174

 Score =  275 bits (702), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 175/461 (37%), Positives = 259/461 (56%), Gaps = 19/461 (4%)

Query: 623  DTVLVANRGEIAVRIIRTLKRLGIRSVAVYSDPDRHSQHVRDADVAVALGGS---SAAET 679
            + +LVANRGEI +RI R+   L +++VA+YS  DR S H   AD A  +G     +    
Sbjct: 18   NKILVANRGEIPIRIFRSAHELSMKTVAIYSHEDRLSMHRLKADEAYMIGKQGKYTPVGA 77

Query: 680  YLDIDKILAAAKKTDTQAIIPGYGFLSENATFAERCGAEGIVFVGPSGDSIRKLGLKHWA 739
            YL ID+IL  AK+ +   I PGYGFLSEN+ FA +    GI ++GPS + I  +G K  A
Sbjct: 78   YLAIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEAGITWIGPSAEVIDSVGDKVSA 137

Query: 740  RELAASAGVPLTKGT-GLLQSASAALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAELAA 798
            R LAA A VP+  GT G + S   A     E GYP+++K+  GGGG G++ V    ++A 
Sbjct: 138  RNLAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIKAAFGGGGRGMRVVREGDDIAD 197

Query: 799  AFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGDGHGRTVALGERDCSLQRRNQKII 858
            AF++   + +  F +   F+E F+ + +H+EVQ++ DG+G  V L ERDCS+QRR+QK++
Sbjct: 198  AFQRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGYGNVVHLFERDCSVQRRHQKVV 257

Query: 859  EETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFLEVNTRLQVEHP 918
            E  PA  LP   R  +   A +L S   YK AGT EF+ D+Q +  YF+E+N R+QVEH 
Sbjct: 258  EVAPAKTLPKDVRDAILTDAVKLASVANYKNAGTAEFLVDDQ-NRHYFIEINPRIQVEHT 316

Query: 919  ITEMVTGLDLVEWMLRIAANTPPD----FDAGVEIEGVSMEARVYVENPVKGFTPSPGLL 974
            ITE +TG+D+V   ++IAA             +   G +++ R+  E+P K F P  G +
Sbjct: 317  ITEEITGIDIVAAQIQIAAGASLQQLGLLQDRITTRGFAIQCRITTEDPAKNFQPDTGRI 376

Query: 975  TEVVFPSWA----RVDTW-ILKGTRVAAEYDPTLAKIIVHGKDREDAVSKLLLALSETRI 1029
               V+ S      R+D      G+ ++  YD  L K    G   E    K+L AL E RI
Sbjct: 377  E--VYRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRI 434

Query: 1030 AGCMTNLDYLKSIASSEEFRKASVFTRLLNDFEYTPTAFEV 1070
             G  TN+ +L ++ ++  F   + +T  ++D   TP  F++
Sbjct: 435  RGVKTNIPFLLTLLTNPVFIDGTYWTTFIDD---TPELFKM 472

>AAR162C [350] [Homologous to ScYGL062W (PYC1) - SH; ScYBR218C (PYC2)
            - SH] (634067..637582) [3516 bp, 1171 aa]
          Length = 1171

 Score =  270 bits (689), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 183/484 (37%), Positives = 262/484 (54%), Gaps = 26/484 (5%)

Query: 600  THLGGFRRYVEHLRRQRDVDKPFDTVLVANRGEIAVRIIRTLKRLGIRSVAVYSDPDRHS 659
            + L GFRR+   L  +       + VLVANRGEI +RI RT   L + +VAVYS  DR S
Sbjct: 3    SQLAGFRRHSNLLGEK-------NKVLVANRGEIPIRIFRTAHELSMATVAVYSYEDRLS 55

Query: 660  QHVRDADVAVALGGS---SAAETYLDIDKILAAAKKTDTQAIIPGYGFLSENATFAERCG 716
             H + AD A  +G     +    YL ID+IL  A+  D   I PGYGFLSENA FA +  
Sbjct: 56   MHRQKADEAYMIGREGQYTPVGAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAKVE 115

Query: 717  AEGIVFVGPSGDSIRKLGLKHWARELAASAGVPLTKGT-GLLQSASAALEAGEEIGYPLM 775
              GI ++GP    I  +G K  AR LAA A VP   GT G + S   A E  ++ GYP++
Sbjct: 116  GAGITWIGPPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSVEEAEEFVQKYGYPVI 175

Query: 776  VKSTAGGGGIGLQRVDSAAELAAAFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGD 835
            +K+  GGGG G++ V    ++  AF++ + + E  F +   F+E F+ + +H+EVQ++ D
Sbjct: 176  IKAAFGGGGRGMRVVREGDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQLLAD 235

Query: 836  GHGRTVALGERDCSLQRRNQKIIEETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEF 895
             +G  V L ERDCS+QRR+QK++E  PA  L    R  +   A +L  A  Y+ AGT EF
Sbjct: 236  NYGNVVHLFERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASGYRNAGTAEF 295

Query: 896  MYDEQKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMLRIAANTPPD----FDAGVEIEG 951
            + D+Q +  YF+E+N R+QVEH ITE +TG+D+V   ++IAA    +        +   G
Sbjct: 296  LVDKQ-NRHYFIEINPRIQVEHTITEEITGVDIVAAQIQIAAGASLEQLGLMQDRITTRG 354

Query: 952  VSMEARVYVENPVKGFTPSPGLLTEVVFPSWA----RVDTW-ILKGTRVAAEYDPTLAKI 1006
             +++ R+  E+P K F P  G L   V+ S      R+D      G  ++  YD  L K 
Sbjct: 355  FAIQCRITTEDPSKNFQPDTGRLD--VYRSAGGNGVRLDGGNAFAGAVISPHYDSMLVKC 412

Query: 1007 IVHGKDREDAVSKLLLALSETRIAGCMTNLDYLKSIASSEEFRKASVFTRLLNDFEYTPT 1066
               G   E    K+L AL E RI G  TN+ +L ++ +   F     +T  ++D   TP 
Sbjct: 413  SCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDD---TPQ 469

Query: 1067 AFEV 1070
             FE+
Sbjct: 470  LFEM 473

>KLLA0C05764g complement(512470..515991) highly similar to sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2 pyruvate
            carboxylase 2, start by similarity
          Length = 1173

 Score =  266 bits (679), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 172/472 (36%), Positives = 259/472 (54%), Gaps = 19/472 (4%)

Query: 612  LRRQRDVDKPFDTVLVANRGEIAVRIIRTLKRLGIRSVAVYSDPDRHSQHVRDADVAVAL 671
            LR   ++    + +LVANRGEI +RI RT   L +++VA+YS  DR S H   AD A  +
Sbjct: 8    LRDNSNLMGEKNKLLVANRGEIPIRIFRTAHELSMKTVAIYSHEDRLSMHRLKADEAYVI 67

Query: 672  GGS---SAAETYLDIDKILAAAKKTDTQAIIPGYGFLSENATFAERCGAEGIVFVGPSGD 728
            G     +    YL ID+I+  AK      I PGYGFLSEN+ FAE+  A GI +VGP   
Sbjct: 68   GEQGKYTPVGAYLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASGITWVGPPAA 127

Query: 729  SIRKLGLKHWARELAASAGVPLTKGT-GLLQSASAALEAGEEIGYPLMVKSTAGGGGIGL 787
             I  +G K  AR LA  A VP+  GT G +++   A    ++ G+P+++K+  GGGG G+
Sbjct: 128  VIDSVGDKVSARNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIKAAFGGGGRGM 187

Query: 788  QRVDSAAELAAAFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGDGHGRTVALGERD 847
            + V    +++ AF++ + +    F +   F+E F+ + +H+EVQ++ D +G  V L ERD
Sbjct: 188  RVVREGDDISDAFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADNYGNVVHLFERD 247

Query: 848  CSLQRRNQKIIEETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFL 907
            CS+QRR+QK++E  PA  LP   R  +   A +L     Y+ AGT EF+ D Q +  YF+
Sbjct: 248  CSVQRRHQKVVEVAPAKTLPEEVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQ-NRHYFI 306

Query: 908  EVNTRLQVEHPITEMVTGLDLVEWMLRIAANTPPD----FDAGVEIEGVSMEARVYVENP 963
            E+N R+QVEH ITE +TG+D+V   ++IAA    +        +   G +++ R+  E+P
Sbjct: 307  EINPRIQVEHTITEEITGIDIVAAQIQIAAGATLEQLGLMQDKITTRGFAIQCRITTEDP 366

Query: 964  VKGFTPSPGLLTEVVFPSWA----RVDTW-ILKGTRVAAEYDPTLAKIIVHGKDREDAVS 1018
             K F P  G +   V+ S      R+D      G+ ++  YD  L K    G   E    
Sbjct: 367  SKNFQPDTGRID--VYRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYEIVRR 424

Query: 1019 KLLLALSETRIAGCMTNLDYLKSIASSEEFRKASVFTRLLNDFEYTPTAFEV 1070
            K+L AL E RI G  TN+ +L ++ +   F+    +T  ++D   TP  FE+
Sbjct: 425  KMLRALIEFRIRGVKTNIPFLLTLLTHPVFKSGEYWTTFIDD---TPQLFEM 473

>CAGL0F06941g 679960..683502 highly similar to sp|P11154 Saccharomyces
            cerevisiae YGL062w PYC1 pyruvate carboxylase or sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2, hypothetical start
          Length = 1180

 Score =  265 bits (677), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 174/480 (36%), Positives = 258/480 (53%), Gaps = 19/480 (3%)

Query: 604  GFRRYVEHLRRQRDVDKPFDTVLVANRGEIAVRIIRTLKRLGIRSVAVYSDPDRHSQHVR 663
            G ++ +  LR   ++    D +LVANRGEI +RI RT   L +R+VA+YS  DR S H  
Sbjct: 5    GQKKKLAGLRANFNILGEKDKILVANRGEIPIRIFRTAHELSMRTVAIYSHEDRLSTHRL 64

Query: 664  DADVAVALGGS---SAAETYLDIDKILAAAKKTDTQAIIPGYGFLSENATFAERCGAEGI 720
             AD A  +G     +    YL ID+I+  AKK     I PGYGFLSEN+ FA++    GI
Sbjct: 65   KADEAYVIGEEGQYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKAGI 124

Query: 721  VFVGPSGDSIRKLGLKHWARELAASAGVPLTKGT-GLLQSASAALEAGEEIGYPLMVKST 779
             ++GP  + I  +G K  AR LAA A VP   GT G +++   A     E GYP+++K+ 
Sbjct: 125  TWIGPPPEVIESVGDKVSARNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVIIKAA 184

Query: 780  AGGGGIGLQRVDSAAELAAAFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGDGHGR 839
             GGGG G++ V    ++  AF++   + +  F +   F+E F+ + +H+EVQ++ D HG 
Sbjct: 185  YGGGGRGMRVVREGEDIGDAFQRATSEAKTAFGNGTCFVERFLDKPKHIEVQLLADNHGN 244

Query: 840  TVALGERDCSLQRRNQKIIEETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDE 899
             + L ERDCS+QRR+QK++E  PA  LP   R  +   A +L     Y+ AGT EF+ D 
Sbjct: 245  VIHLFERDCSVQRRHQKVVEVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAEFLVDN 304

Query: 900  QKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMLRIAANTPPD----FDAGVEIEGVSME 955
            Q +  YF+E+N R+QVEH ITE +TG+D+V   ++IAA             +   G +++
Sbjct: 305  Q-NRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLTELGLLQDRITTRGFAIQ 363

Query: 956  ARVYVENPVKGFTPSPGLLTEVVFPSWA----RVDTW-ILKGTRVAAEYDPTLAKIIVHG 1010
             R+  E+P K F P  G +   V+ S      R+D      G  ++  YD  L K    G
Sbjct: 364  CRITTEDPAKNFQPDTGRIE--VYGSTGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSG 421

Query: 1011 KDREDAVSKLLLALSETRIAGCMTNLDYLKSIASSEEFRKASVFTRLLNDFEYTPTAFEV 1070
               E    K++ AL E RI G  TN+ +L ++ +   F     +T  ++D   TP  F +
Sbjct: 422  STYEIVRRKIIRALIEFRIRGVKTNIPFLLTLLTHPVFISGQYWTTFIDD---TPQLFHM 478

>Scas_686.17
          Length = 1176

 Score =  264 bits (675), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 172/461 (37%), Positives = 252/461 (54%), Gaps = 19/461 (4%)

Query: 623  DTVLVANRGEIAVRIIRTLKRLGIRSVAVYSDPDRHSQHVRDADVAVALGGS---SAAET 679
            + +LVANRGEI +RI R+   L +R+VA+YS  DR S H   AD +  +G     +    
Sbjct: 20   NKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADESYVIGEEGQFTPVGA 79

Query: 680  YLDIDKILAAAKKTDTQAIIPGYGFLSENATFAERCGAEGIVFVGPSGDSIRKLGLKHWA 739
            YL ID+I+  AKK     I PGYGFLSEN+ FA++    GI ++GP  + I  +G K  A
Sbjct: 80   YLAIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVAKAGITWIGPPAEVIDSVGDKVSA 139

Query: 740  RELAASAGVPLTKGT-GLLQSASAALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAELAA 798
            R LAA A VP   GT G ++S   A +   + GYP+++K+  GGGG G++ V    ++  
Sbjct: 140  RYLAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAAFGGGGRGMRVVREGEDIND 199

Query: 799  AFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGDGHGRTVALGERDCSLQRRNQKII 858
            AF++   +    F D   F+E F+   +H+EVQ++GD +G  V L ERDCS+QRR+QK++
Sbjct: 200  AFQRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGNVVHLFERDCSVQRRHQKVV 259

Query: 859  EETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFLEVNTRLQVEHP 918
            E  PA N+P   R  +   A +L     Y+ AGT EF+ D Q +  YF+E+N R+QVEH 
Sbjct: 260  EVAPAKNIPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQ-NRHYFIEINPRIQVEHT 318

Query: 919  ITEMVTGLDLVEWMLRIAANTPPD----FDAGVEIEGVSMEARVYVENPVKGFTPSPGLL 974
            ITE +TG+DLV   ++IAA             +   G +++ R+  E+P K F P  G L
Sbjct: 319  ITEEITGIDLVAAQIQIAAGASLAQLGLLQDRITTRGFAIQCRITTEDPAKNFQPDTGRL 378

Query: 975  TEVVFPSWA----RVDTW-ILKGTRVAAEYDPTLAKIIVHGKDREDAVSKLLLALSETRI 1029
               V+ S      R+D      G  ++  YD  L K    G   E    K++ AL E RI
Sbjct: 379  E--VYRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRI 436

Query: 1030 AGCMTNLDYLKSIASSEEFRKASVFTRLLNDFEYTPTAFEV 1070
             G  TN+ +L ++ +   F     +T  ++D   TP  F++
Sbjct: 437  RGVKTNIPFLLTLLTHPVFISGDYWTTFIDD---TPQLFKM 474

>Scas_563.12
          Length = 1216

 Score =  247 bits (631), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 159/446 (35%), Positives = 240/446 (53%), Gaps = 19/446 (4%)

Query: 638  IRTLKRLGIRSVAVYSDPDRHSQHVRDADVAVALGGS---SAAETYLDIDKILAAAKKTD 694
             R+   L +++VA+YS  DR S H   AD +  +G     +    YL ID+I+  AK+  
Sbjct: 76   FRSAHELSMQTVAIYSHEDRLSTHRLKADESYVIGEPHQFTPVGAYLAIDEIINIAKRHG 135

Query: 695  TQAIIPGYGFLSENATFAERCGAEGIVFVGPSGDSIRKLGLKHWARELAASAGVPLTKGT 754
               I PGYGFLSEN+ FA++    GI ++GP    I  +G K  AR LA  A VP   GT
Sbjct: 136  VDYIHPGYGFLSENSEFADKVAKAGITWIGPPASVIDSVGDKVSARNLATKANVPTVPGT 195

Query: 755  -GLLQSASAALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAELAAAFEQVQRQGELYFTD 813
             G +++   A +   E GYP+++K+  GGGG G++ V+   +LA AF++   +    F D
Sbjct: 196  PGPIRTVQDAQDFVNEYGYPVIIKAAFGGGGRGMRVVNEGDDLADAFQRASSEALTAFGD 255

Query: 814  SGVFLESFIARARHVEVQIMGDGHGRTVALGERDCSLQRRNQKIIEETPAPNLPAHTRQK 873
               F+E F+ + +H+EVQ++ D HG  + L ERDCS+QRR+QK++E  PA  LP   R  
Sbjct: 256  GTCFVERFLNKPKHIEVQLLADTHGNVIHLFERDCSVQRRHQKVVEVAPAKTLPREVRDA 315

Query: 874  MRQAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWML 933
            +   A +L     Y+ AGT EF+ D+Q +  YF+E+N R+QVEH ITE +TG+D+V   +
Sbjct: 316  ILTDAVKLAKECGYQNAGTAEFLVDDQ-NRHYFIEINPRIQVEHTITEEITGIDIVAAQI 374

Query: 934  RIAANTPPD----FDAGVEIEGVSMEARVYVENPVKGFTPSPGLLTEVVFPSWA----RV 985
            +IAA    +        +   G +++ R+  E+P K F P  G L   V+ S      R+
Sbjct: 375  QIAAGASLEQLGLLQDKITTRGFAIQCRITTEDPAKNFQPDTGRLE--VYDSAGGNGVRL 432

Query: 986  DTW-ILKGTRVAAEYDPTLAKIIVHGKDREDAVSKLLLALSETRIAGCMTNLDYLKSIAS 1044
            D      G  ++  YD  L K    G   E    K++ AL E RI G  TN+ +L ++ +
Sbjct: 433  DGGNAYAGAIISPHYDSMLVKCSCSGSTYEVVRRKMIRALIEFRIRGVKTNIPFLLTLLT 492

Query: 1045 SEEFRKASVFTRLLNDFEYTPTAFEV 1070
               F     +T  ++D   TP  F++
Sbjct: 493  HPVFIAGDYWTTFIDD---TPQLFKM 515

>Sklu_1458.1 YGL062W, Contig c1458 155-3553 reverse complement
          Length = 1132

 Score =  242 bits (617), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 159/438 (36%), Positives = 239/438 (54%), Gaps = 19/438 (4%)

Query: 646  IRSVAVYSDPDRHSQHVRDADVAVALGGS---SAAETYLDIDKILAAAKKTDTQAIIPGY 702
            +++VA+YS+ DR S H   AD A  +G     +    YL ID+I++ AK+     I PGY
Sbjct: 1    MKTVAIYSNEDRLSMHRLKADEAYMIGEGGKYTPVGAYLAIDEIISIAKEHGVSFIHPGY 60

Query: 703  GFLSENATFAERCGAEGIVFVGPSGDSIRKLGLKHWARELAASAGVPLTKGT-GLLQSAS 761
            GFLSENA FA +    GI ++GP  + I  +G K  AR+LAA A VP   GT G ++S  
Sbjct: 61   GFLSENAEFAAKVIDAGITWIGPPPEVINSVGDKVSARDLAAKANVPTVPGTPGPIESVE 120

Query: 762  AALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAELAAAFEQVQRQGELYFTDSGVFLESF 821
             A     E GYP+++K+  GGGG G++ V    ++  AF++   + +  F +   F+E F
Sbjct: 121  EAEAFVAEYGYPVIIKAAFGGGGRGMRVVREGDDIGDAFQRATSEAKTAFGNGTCFVERF 180

Query: 822  IARARHVEVQIMGDGHGRTVALGERDCSLQRRNQKIIEETPAPNLPAHTRQKMRQAAQRL 881
            + + +H+EVQ++ D +G  + L ERDCS+QRR+QK++E  PA  LP   R  +   A +L
Sbjct: 181  LDKPKHIEVQLLADNYGNVIHLFERDCSVQRRHQKVVEVAPAKTLPKEVRDSILTDAVKL 240

Query: 882  CSAVKYKCAGTVEFMYDEQKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMLRIAANTPP 941
                KY+ AGT EF+ D Q +  YF+E+N R+QVEH ITE +TG+D+V   ++IAA    
Sbjct: 241  AKEAKYRNAGTAEFLVDAQ-NRHYFIEINPRIQVEHTITEEITGVDVVAAQIQIAAGASL 299

Query: 942  D----FDAGVEIEGVSMEARVYVENPVKGFTPSPGLLTEVVFPSWA----RVDTW-ILKG 992
                     +   G +++ R+  E+P K F P  G +   V+ S      R+D      G
Sbjct: 300  QQLGLLQDKITTRGFAIQCRITTEDPSKNFQPDTGRIE--VYRSAGGNGVRLDGGNAYAG 357

Query: 993  TRVAAEYDPTLAKIIVHGKDREDAVSKLLLALSETRIAGCMTNLDYLKSIASSEEFRKAS 1052
              ++  YD  L K    G   E    K+L AL E RI G  TN+ +L ++ +   F+   
Sbjct: 358  AVISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHSVFKSGE 417

Query: 1053 VFTRLLNDFEYTPTAFEV 1070
             +T  ++D   TP  FE+
Sbjct: 418  YWTTFIDD---TPQLFEM 432

>KLLA0F06072g 583276..589971 highly similar to sp|Q00955 Saccharomyces
            cerevisiae YNR016c ACC1 acetyl-CoA carboxylase, start by
            similarity
          Length = 2231

 Score =  241 bits (615), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 161/508 (31%), Positives = 254/508 (50%), Gaps = 75/508 (14%)

Query: 625  VLVANRGEIAVRIIRTLKRLGIRS-----------VAVYSDPDRHSQHVRDADVAVALGG 673
            VL+AN G  AV+ IR++++    +           +A   D + +++++R AD  + + G
Sbjct: 63   VLIANNGIAAVKEIRSVRKWAYETFGDERTVQFVAMATPEDLEANAEYIRMADQYIEVPG 122

Query: 674  SSAAETYLDIDKILAAAKKTDTQAIIPGYGFLSENATFAERCGAE--GIVFVGPSGDSIR 731
             +    Y ++D I+  A++ D  A+  G+G  SEN    ER  A    I+F+GP G+++R
Sbjct: 123  GTNNNNYANVDLIVEVAERADVDAVWAGWGHASENPLLPERLAASHRKIIFIGPPGNAMR 182

Query: 732  KLGLKHWARELAASAGVPLT--KGTGL-----------------------LQSASAALEA 766
             LG K  +  +A  A VP     GTG+                         S    L+ 
Sbjct: 183  SLGDKISSTIVAQHAKVPCIPWSGTGVDEVHVDKETNLVSVEDKVYQEGCCSSPEDGLKK 242

Query: 767  GEEIGYPLMVKSTAGGGGIGLQRVDSAAELAAAFEQVQRQGELYFTDSGVFLESFIARAR 826
             +EIG+P+MVK++ GGGG G+++V++  E  + ++Q   +       S +F+     +AR
Sbjct: 243  AKEIGFPIMVKASEGGGGKGIRKVENEDEFLSLYQQAANE----IPGSPIFIMKLAGKAR 298

Query: 827  HVEVQIMGDGHGRTVALGERDCSLQRRNQKIIEETPAPNLPAHTRQKMRQAAQRLCSAVK 886
            H+EVQ++ D +G  ++L  RDCS+QRR+QKIIEE P       T  +M +AA RL   V 
Sbjct: 299  HLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFTEMEKAAVRLGQLVG 358

Query: 887  YKCAGTVEFMYDEQKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMLRIAANTPP----- 941
            Y  AGTVE++Y   +D+FYFLE+N RLQVEHP TEMVTG++L    L+IA   P      
Sbjct: 359  YVSAGTVEYLYSHDEDKFYFLELNPRLQVEHPTTEMVTGVNLPSAQLQIAMGIPMHRIRD 418

Query: 942  -------DFDAGVEIE------------------GVSMEARVYVENPVKGFTPSPGLLTE 976
                   D  +  EI+                  G     R+  E+P +GF PS G L E
Sbjct: 419  IRLLYGVDPKSASEIDFNFSTPESAKTQRKPTPKGHCTACRITSEDPNEGFKPSGGALHE 478

Query: 977  VVFPSWARVDTWILKGTR--VAAEYDPTLAKIIVHGKDREDAVSKLLLALSETRIAGCM- 1033
            + F S + V  +   G    + +  D     I   G++R+ +   +++AL E  I G   
Sbjct: 479  LNFRSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFR 538

Query: 1034 TNLDYLKSIASSEEFRKASVFTRLLNDF 1061
            T ++YL  +  +E+F   ++ T  L+D 
Sbjct: 539  TTVEYLIKLLETEDFEDNTITTGWLDDL 566

>Scas_720.74
          Length = 2231

 Score =  236 bits (603), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 159/508 (31%), Positives = 253/508 (49%), Gaps = 75/508 (14%)

Query: 625  VLVANRGEIAVRIIRTLKR-----------LGIRSVAVYSDPDRHSQHVRDADVAVALGG 673
            +L+AN G  AV+ IR++++           +   ++A   D + +++++R AD  V + G
Sbjct: 62   ILIANNGIAAVKEIRSVRKWAYETFGNERTIQFVAMATPEDLEANAEYIRMADQYVEVPG 121

Query: 674  SSAAETYLDIDKILAAAKKTDTQAIIPGYGFLSENATFAERCG--AEGIVFVGPSGDSIR 731
             +  + Y ++D I+  A++ D  A+  G+G  SEN    E+       +VF+GP G ++R
Sbjct: 122  GTNNKNYANVDLIVDIAERADVDAVWAGWGHASENPHLPEKLAMSKRKVVFIGPPGSAMR 181

Query: 732  KLGLKHWARELAASAGVP-------------LTKGTGLLQSASA------------ALEA 766
             LG K  +  +A SA VP             + K TGL+  A               LE 
Sbjct: 182  SLGDKISSTIVAQSAHVPCIPWSGTGIDKVQVDKDTGLVSVADEVYAQGCCSSPEDGLEK 241

Query: 767  GEEIGYPLMVKSTAGGGGIGLQRVDSAAELAAAFEQVQRQGELYFTDSGVFLESFIARAR 826
             ++IG+P+M+K++ GGGG G+++V+   +  A + Q   +       S +F+     +AR
Sbjct: 242  AKKIGFPVMIKASEGGGGKGIRQVEREEDFIALYHQAANE----IPGSPIFIMKLAGKAR 297

Query: 827  HVEVQIMGDGHGRTVALGERDCSLQRRNQKIIEETPAPNLPAHTRQKMRQAAQRLCSAVK 886
            H+EVQ++ D +G  ++L  RDCS+QRR+QKIIEE P       T   M ++A RL   V 
Sbjct: 298  HLEVQLLADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAAPETFAMMEKSAVRLGKLVG 357

Query: 887  YKCAGTVEFMYDEQKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMLRIAANTPP----- 941
            Y  AGTVE++Y  +  +FYFLE+N RLQVEHP TEMVTG++L    L+IA   P      
Sbjct: 358  YVSAGTVEYLYSHEDKKFYFLELNPRLQVEHPTTEMVTGVNLPATQLQIAMGIPMHRISD 417

Query: 942  ---------------DFDAGVEI----------EGVSMEARVYVENPVKGFTPSPGLLTE 976
                           DFD   E           +G     R+  E+P +GF PS G L E
Sbjct: 418  IRVFYGMNPHTASEIDFDFSTEESLKTQRKPVPKGHCTACRITSEDPDEGFKPSGGSLHE 477

Query: 977  VVFPSWARVDTWILKGTR--VAAEYDPTLAKIIVHGKDREDAVSKLLLALSETRIAGCM- 1033
            + F S + V  +   G    + +  D     I   G++R+ +   +++AL E  I G   
Sbjct: 478  LNFRSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFR 537

Query: 1034 TNLDYLKSIASSEEFRKASVFTRLLNDF 1061
            T ++YL  +  +E+F   ++ T  L+D 
Sbjct: 538  TTVEYLIKLLETEDFEDNTITTGWLDDL 565

>YMR207C (HFA1) [4163] chr13 complement(677192..683563) Protein with
            similarity to acetyl-CoA carboxylase [6372 bp, 2123 aa]
          Length = 2123

 Score =  234 bits (598), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 154/470 (32%), Positives = 235/470 (50%), Gaps = 58/470 (12%)

Query: 646  IRSVAVYSDPDRH--SQHVRDADVAVALGGSSAAETYLDIDKILAAAKKTDTQAIIPGYG 703
            I+ V + +  D H  S+++R AD  V + G +    Y +ID IL  A++TD  A+  G+G
Sbjct: 18   IQFVVMATPDDLHANSEYIRMADQYVQVPGGTNNNNYANIDLILDVAEQTDVDAVWAGWG 77

Query: 704  FLSENATFAERCGA--EGIVFVGPSGDSIRKLGLKHWARELAASAGVPLTKGT------- 754
              SEN    E   +    I+F+GP G ++R LG K  +  +A SA +P    +       
Sbjct: 78   HASENPCLPELLASSQRKILFIGPPGRAMRSLGDKISSTIVAQSAKIPCIPWSGSHIDTI 137

Query: 755  ------------------GLLQSASAALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAEL 796
                              G   S   ALE  + IG+P+M+K++ GGGG G++RVD+  + 
Sbjct: 138  HIDNKTNFVSVPDDVYVRGCCSSPEDALEKAKLIGFPVMIKASEGGGGKGIRRVDNEDDF 197

Query: 797  AAAFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGDGHGRTVALGERDCSLQRRNQK 856
             A + Q   +       S +F+   +  ARH+EVQ++ D +G  + L  RDCS+QRR+QK
Sbjct: 198  IALYRQAVNET----PGSPMFVMKVVTDARHLEVQLLADQYGTNITLFGRDCSIQRRHQK 253

Query: 857  IIEETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFLEVNTRLQVE 916
            IIEE P       T Q+M +AA RL   V Y  AGTVE++Y  + D+FYFLE+N RLQVE
Sbjct: 254  IIEEAPVTITKPETFQRMERAAIRLGELVGYVSAGTVEYLYSPKDDKFYFLELNPRLQVE 313

Query: 917  HPITEMVTGLDLVEWMLRIAANTPPDFDAGVEI----------------------EGVSM 954
            HP TEM++G++L    L+IA   P    + +                        +G  +
Sbjct: 314  HPTTEMISGVNLPATQLQIAMGIPMHMISDIRKLYGLDPTGTSYIDFKNLKRPSPKGHCI 373

Query: 955  EARVYVENPVKGFTPSPGLLTEVVFPSWARVDTWILKGTR--VAAEYDPTLAKIIVHGKD 1012
              R+  E+P +GF PS G + E+ F S + V  +   G    + +  D     I   G D
Sbjct: 374  SCRITSEDPNEGFKPSTGKIHELNFRSSSNVWGYFSVGNNGAIHSFSDSQFGHIFAVGND 433

Query: 1013 REDAVSKLLLALSETRIAG-CMTNLDYLKSIASSEEFRKASVFTRLLNDF 1061
            R+DA   ++LAL +  I G   T ++YL  +  + +F   ++ T  L+D 
Sbjct: 434  RQDAKQNMVLALKDFSIRGEFKTPIEYLIELLETRDFESNNISTGWLDDL 483

>AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C (HFA1)
            - SH] complement(466791..473486) [6696 bp, 2231 aa]
          Length = 2231

 Score =  234 bits (596), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 158/508 (31%), Positives = 252/508 (49%), Gaps = 75/508 (14%)

Query: 625  VLVANRGEIAVRIIRTLKRLGIRS-----------VAVYSDPDRHSQHVRDADVAVALGG 673
            +L+AN G  AV+ IR++++    +           +A   D + +++++R AD  V + G
Sbjct: 62   ILIANNGIAAVKEIRSVRKWAYETFGDGKVVQFVVMATPEDLEANTEYIRMADQYVEVPG 121

Query: 674  SSAAETYLDIDKILAAAKKTDTQAIIPGYGFLSENATFAERCG--AEGIVFVGPSGDSIR 731
             +    Y ++D I+  A++ D  A+  G+G  SEN    E+       +VF+GP G ++R
Sbjct: 122  GTNNNNYANVDLIVDVAERADVDAVWAGWGHASENPLLPEKLARSKRKVVFIGPPGSAMR 181

Query: 732  KLGLKHWARELAASAGVPLT--KGTGLLQ-----------------------SASAALEA 766
             LG K  +  +A  A VP     GTG+ Q                       S    L  
Sbjct: 182  SLGDKISSTIVAQHAKVPCIPWSGTGVDQVEIDPHTKLVSVADDIYQKGCCLSPEDGLNK 241

Query: 767  GEEIGYPLMVKSTAGGGGIGLQRVDSAAELAAAFEQVQRQGELYFTDSGVFLESFIARAR 826
             ++IG+P+MVK++ GGGG G+++V    +  + ++Q   +       S +F+     +AR
Sbjct: 242  AKQIGFPVMVKASEGGGGKGIRKVVREEDFISLYQQAANE----IPGSPIFIMKLAGKAR 297

Query: 827  HVEVQIMGDGHGRTVALGERDCSLQRRNQKIIEETPAPNLPAHTRQKMRQAAQRLCSAVK 886
            H+EVQ++ D +G  ++L  RDCS+QRR+QKIIEE P       T  +M +AA RL   V 
Sbjct: 298  HLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFAEMERAAVRLGKLVG 357

Query: 887  YKCAGTVEFMYDEQKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMLRIAANTP------ 940
            Y  AGTVE++Y  ++D+FYFLE+N RLQVEHP TEMVTG++L    L+IA   P      
Sbjct: 358  YVSAGTVEYLYSHEEDKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPLHRIRD 417

Query: 941  --------PDFDAGVEIEGVSMEA----------------RVYVENPVKGFTPSPGLLTE 976
                    P     ++ E  S +A                R+  E+P +GF PS G L E
Sbjct: 418  IRLFYGLDPHTATEIDFEFSSADALQTQRRPIPKGHCTACRITSEDPNEGFKPSGGSLHE 477

Query: 977  VVFPSWARVDTWILKGTR--VAAEYDPTLAKIIVHGKDREDAVSKLLLALSETRIAGCM- 1033
            + F S + V  +   G    + +  D     I   G++R+ +   +++AL E  I G   
Sbjct: 478  LNFRSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFR 537

Query: 1034 TNLDYLKSIASSEEFRKASVFTRLLNDF 1061
            T ++YL  +  +E+F   ++ T  L+D 
Sbjct: 538  TTVEYLIKLLETEDFEDNTITTGWLDDL 565

>YNR016C (ACC1) [4599] chr14 complement(654672..661373) Acetyl-CoA
            carboxylase, first and rate-limiting step in fatty acid
            biosynthesis pathway [6702 bp, 2233 aa]
          Length = 2233

 Score =  233 bits (595), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 155/508 (30%), Positives = 253/508 (49%), Gaps = 75/508 (14%)

Query: 625  VLVANRGEIAVRIIRTLKRLGIRS-----------VAVYSDPDRHSQHVRDADVAVALGG 673
            +L+AN G  AV+ IR++++    +           +A   D + +++++R AD  + + G
Sbjct: 62   ILIANNGIAAVKEIRSVRKWAYETFGDDRTVQFVAMATPEDLEANAEYIRMADQYIEVPG 121

Query: 674  SSAAETYLDIDKILAAAKKTDTQAIIPGYGFLSENATFAERCG--AEGIVFVGPSGDSIR 731
             +    Y ++D I+  A++ D  A+  G+G  SEN    E+       ++F+GP G+++R
Sbjct: 122  GTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLSQSKRKVIFIGPPGNAMR 181

Query: 732  KLGLKHWARELAASAGVP-------------LTKGTGLLQ------------SASAALEA 766
             LG K  +  +A SA VP             + + TGL+             S    L+ 
Sbjct: 182  SLGDKISSTIVAQSAKVPCIPWSGTGVDTVHVDEKTGLVSVDDDIYQKGCCTSPEDGLQK 241

Query: 767  GEEIGYPLMVKSTAGGGGIGLQRVDSAAELAAAFEQVQRQGELYFTDSGVFLESFIARAR 826
             + IG+P+M+K++ GGGG G+++V+   +  A + Q   +       S +F+     RAR
Sbjct: 242  AKRIGFPVMIKASEGGGGKGIRQVEREEDFIALYHQAANE----IPGSPIFIMKLAGRAR 297

Query: 827  HVEVQIMGDGHGRTVALGERDCSLQRRNQKIIEETPAPNLPAHTRQKMRQAAQRLCSAVK 886
            H+EVQ++ D +G  ++L  RDCS+QRR+QKIIEE P     A T  +M +AA RL   V 
Sbjct: 298  HLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKAETFHEMEKAAVRLGKLVG 357

Query: 887  YKCAGTVEFMYDEQKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMLRIAANTP------ 940
            Y  AGTVE++Y     +FYFLE+N RLQVEHP TEMV+G++L    L+IA   P      
Sbjct: 358  YVSAGTVEYLYSHDDGKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPMHRISD 417

Query: 941  --------PDFDAGVEIEGVSMEA----------------RVYVENPVKGFTPSPGLLTE 976
                    P   + ++ E  + +A                R+  E+P  GF PS G L E
Sbjct: 418  IRTLYGMNPHSASEIDFEFKTQDATKKQRRPIPKGHCTACRITSEDPNDGFKPSGGTLHE 477

Query: 977  VVFPSWARVDTWILKGT--RVAAEYDPTLAKIIVHGKDREDAVSKLLLALSETRIAGCM- 1033
            + F S + V  +   G    + +  D     I   G++R+ +   +++AL E  I G   
Sbjct: 478  LNFRSSSNVWGYFSVGNNGNIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFR 537

Query: 1034 TNLDYLKSIASSEEFRKASVFTRLLNDF 1061
            T ++YL  +  +E+F   ++ T  L+D 
Sbjct: 538  TTVEYLIKLLETEDFEDNTITTGWLDDL 565

>Kwal_23.6157
          Length = 2230

 Score =  229 bits (584), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 158/508 (31%), Positives = 250/508 (49%), Gaps = 75/508 (14%)

Query: 625  VLVANRGEIAVRIIRTLKRLGIRS-----------VAVYSDPDRHSQHVRDADVAVALGG 673
            VL+AN G  AV+ IR++++    +           +A   D + +++++R AD  V + G
Sbjct: 63   VLIANNGIAAVKEIRSVRKWAYETFGNERAVQFVAMATPEDLEANAEYLRMADQYVEVPG 122

Query: 674  SSAAETYLDIDKILAAAKKTDTQAIIPGYGFLSENATFAERCGAE--GIVFVGPSGDSIR 731
             +    Y ++D I+  A++ D  A+  G+G  SEN    ER  A    ++F+GP G+++R
Sbjct: 123  GTNNNNYANVDLIVELAERADVDAVWAGWGHASENPLLPERLAASPRKVIFIGPPGNAMR 182

Query: 732  KLGLKHWARELAASAGVPLT--KGTGLLQ-----------------------SASAALEA 766
             LG K  +  +A  A VP     GTG+ Q                       S    L  
Sbjct: 183  SLGDKISSTIVAQHAKVPCIPWSGTGVDQVHLDEENGLVSVTDDIYQKGCCDSPEDGLAK 242

Query: 767  GEEIGYPLMVKSTAGGGGIGLQRVDSAAELAAAFEQVQRQGELYFTDSGVFLESFIARAR 826
             ++IG+P+MVK++ GGGG G+++V+   +    ++Q   +       S +F+      AR
Sbjct: 243  AKKIGFPVMVKASEGGGGKGIRKVEREQDFIPLYKQAANE----IPGSPIFIMKLAGNAR 298

Query: 827  HVEVQIMGDGHGRTVALGERDCSLQRRNQKIIEETPAPNLPAHTRQKMRQAAQRLCSAVK 886
            H+EVQ++ D +G  ++L  RDCS+QRR+QKIIEE P       T  +M ++A RL   V 
Sbjct: 299  HLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFTEMERSAVRLGKLVG 358

Query: 887  YKCAGTVEFMYDEQKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMLRIAANTPP----- 941
            Y  AGTVE++Y    D+FYFLE+N RLQVEHP TEMV+G++L    L+IA   P      
Sbjct: 359  YVSAGTVEYLYSHDDDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPMHRIKD 418

Query: 942  ---------------DFDAGVEI----------EGVSMEARVYVENPVKGFTPSPGLLTE 976
                           DFD   +           +G     R+  E+P +GF PS G L E
Sbjct: 419  IRLMYGVDPHTATEIDFDFSSKDSTKIQRRPTPKGHCTACRITSEDPNEGFKPSGGSLHE 478

Query: 977  VVFPSWARVDTWILKGTR--VAAEYDPTLAKIIVHGKDREDAVSKLLLALSETRIAGCM- 1033
            + F S + V  +    +   + +  D     I   G++R+ +   +++AL E  I G   
Sbjct: 479  LNFRSSSNVWGYFSVSSSGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFR 538

Query: 1034 TNLDYLKSIASSEEFRKASVFTRLLNDF 1061
            T ++YL  +  +E+F   S+ T  L+D 
Sbjct: 539  TTVEYLIKLLETEDFEGNSITTGWLDDL 566

>CAGL0L10780g complement(1149588..1156289) highly similar to sp|Q00955
            Saccharomyces cerevisiae YNR016c ACC1 or sp|P32874
            Saccharomyces cerevisiae YMR207c HFA1, start by
            similarity
          Length = 2233

 Score =  229 bits (583), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 156/508 (30%), Positives = 248/508 (48%), Gaps = 75/508 (14%)

Query: 625  VLVANRGEIAVRIIRTLKRLGIRS-----------VAVYSDPDRHSQHVRDADVAVALGG 673
            VL+AN G  AV+ IR++++    +           +A   D + +++++R AD  V + G
Sbjct: 62   VLIANNGIAAVKEIRSVRKWAYETFGDEKIVQFVAMATPEDLEANAEYIRMADQYVEVPG 121

Query: 674  SSAAETYLDIDKILAAAKKTDTQAIIPGYGFLSENATFAERCG--AEGIVFVGPSGDSIR 731
             +    Y ++D I+  A++ D  A+  G+G  SEN    E+       I+F+GP G+++R
Sbjct: 122  GTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLARSKRKILFIGPPGNAMR 181

Query: 732  KLGLKHWARELAASAGVPLT--KGTGL-----------------------LQSASAALEA 766
             LG K  +  +A  A VP     GTG+                         S    LE 
Sbjct: 182  SLGDKISSTIVAQHAKVPCIPWSGTGVDTVHIDEKNGLVSVDDDIYQKGCCSSPEDGLEK 241

Query: 767  GEEIGYPLMVKSTAGGGGIGLQRVDSAAELAAAFEQVQRQGELYFTDSGVFLESFIARAR 826
             ++IG+P+M+K++ GGGG G+++V    +    + Q   +       S +F+     +AR
Sbjct: 242  AKKIGFPVMIKASEGGGGKGIRQVTREEDFINLYHQAANE----IPGSPIFIMKLAGKAR 297

Query: 827  HVEVQIMGDGHGRTVALGERDCSLQRRNQKIIEETPAPNLPAHTRQKMRQAAQRLCSAVK 886
            H+EVQ++ D +G  ++L  RDCS+QRR+QKIIEE P       T  +M +AA RL   V 
Sbjct: 298  HLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAGPETFGEMEKAAVRLGKLVG 357

Query: 887  YKCAGTVEFMYDEQKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMLRIAANTP------ 940
            Y  AGTVE++Y    ++FYFLE+N RLQVEHP TEMVTG++L    L+IA   P      
Sbjct: 358  YVSAGTVEYLYSHDDNKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPMHRISD 417

Query: 941  --------PDFDAGVEIE----------------GVSMEARVYVENPVKGFTPSPGLLTE 976
                    P   + ++ E                G     R+  E+P  GF PS G L E
Sbjct: 418  IRIFYGLNPRGSSEIDFEFKSEDSLKTQRKPIPKGHCTACRITSEDPNDGFKPSGGTLNE 477

Query: 977  VVFPSWARVDTWILKGTR--VAAEYDPTLAKIIVHGKDREDAVSKLLLALSETRIAGCM- 1033
            + F S + V  +   G    + +  D     I   G++R+ +   +++AL E  I G   
Sbjct: 478  LNFRSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFR 537

Query: 1034 TNLDYLKSIASSEEFRKASVFTRLLNDF 1061
            T ++YL  +  +E+F + ++ T  L+D 
Sbjct: 538  TTVEYLIKLLETEDFEENTITTGWLDDL 565

>ABR140C [732] [Homologous to ScYMR293C - SH] (662185..663576) [1392
           bp, 463 aa]
          Length = 463

 Score =  100 bits (249), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 75/199 (37%), Positives = 92/199 (46%), Gaps = 7/199 (3%)

Query: 71  PLYGVPVAVKDNIDVRGLATTAACPSFA-YTAAQDATAVRLLRDAGAVILGKTNMDQFAT 129
           PL  + V +KDNI  + L TT +    A Y +  DAT V LL +AGAV  GKTNMD+F  
Sbjct: 38  PLGNLVVGIKDNIVTKKLPTTCSSGVLAGYMSPYDATVVELLDEAGAVTAGKTNMDEFGM 97

Query: 130 GLVGTRSPY--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLTLGTDTAGSGRVPAALNN 187
           G  G  S +                                  LGTDT GS R+PAA  +
Sbjct: 98  GSGGIHSFFGPTLNPAFPERPTVAGGSSSGSAAAVAAGVVDFALGTDTGGSVRMPAAYTS 157

Query: 188 LVGVKPTRGTVSCTGVVPACRSLDCVSVFARDVADAHRCLRILARPDGSDPYSRP----S 243
            VG KP+ G VS  GV+   +SLD V + ARDV    R   +L R D  DP S P     
Sbjct: 158 TVGFKPSYGRVSRHGVIAYAQSLDTVGIGARDVGLVRRVFEVLDRHDPKDPTSLPDELRQ 217

Query: 244 PADAPRRLSTCPVVGVPRE 262
            A A RR      +G+P E
Sbjct: 218 QAAALRREKKHLKIGIPAE 236

>KLLA0A09845g complement(862467..863876) similar to sp|Q03557
           Saccharomyces cerevisiae YMR293c, start by similarity
          Length = 469

 Score = 92.0 bits (227), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 79/174 (45%), Gaps = 4/174 (2%)

Query: 71  PLYGVPVAVKDNIDVRGLATTAACPSF-AYTAAQDATAVRLLRDAGAVILGKTNMDQFAT 129
           PL     A+KDNI  + + +T A      Y +  DAT V LL +AG VI GK NMD+F  
Sbjct: 46  PLNYTLAAIKDNIATKNMPSTCASKILDGYMSPFDATVVSLLLEAGTVIAGKANMDEFGM 105

Query: 130 GLVGTRS---PYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLTLGTDTAGSGRVPAALN 186
           G  G  S   P                                 LGTDT GS R+PA+  
Sbjct: 106 GSAGIHSHFGPTFNPLFDHKDRVIAGGSSSGSAAAVASGVVDFALGTDTGGSVRLPASYT 165

Query: 187 NLVGVKPTRGTVSCTGVVPACRSLDCVSVFARDVADAHRCLRILARPDGSDPYS 240
           +  G KP+ G +S  GV+   +SLD V VFA D++   R   +L + D  DP S
Sbjct: 166 STFGFKPSYGRLSRHGVISYAQSLDTVGVFANDLSMIDRVFSLLDKHDKKDPTS 219

>CAGL0M13585g complement(1335488..1336891) similar to sp|Q03557
           Saccharomyces cerevisiae YMR293c, hypothetical start
          Length = 467

 Score = 90.5 bits (223), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/173 (30%), Positives = 81/173 (46%), Gaps = 4/173 (2%)

Query: 72  LYGVPVAVKDNIDVRGLATTAACPSF-AYTAAQDATAVRLLRDAGAVILGKTNMDQFATG 130
           L G+   +KDNI  + + TT        Y +  DAT V+LL+  G+++LGKTN+D+F  G
Sbjct: 39  LSGLLCGIKDNIVTKDMPTTCGSEILRGYQSPYDATVVKLLKQEGSIVLGKTNLDEFGMG 98

Query: 131 LVGTRS---PYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLTLGTDTAGSGRVPAALNN 187
             G  S   P                                +LGTDT GS R+PA   +
Sbjct: 99  SRGIHSCFGPTFNPLYPAADKVIMGGSSSGSAAAVVSEAVDFSLGTDTGGSVRLPATYGS 158

Query: 188 LVGVKPTRGTVSCTGVVPACRSLDCVSVFARDVADAHRCLRILARPDGSDPYS 240
           + G KP+ G +S  GV+   +SLD V +  ++++   +   +L + D  DP S
Sbjct: 159 IYGFKPSYGRISRYGVIAYAQSLDTVGILTKNISTLRKVYHVLDKYDDKDPTS 211

>Kwal_23.4249
          Length = 465

 Score = 89.0 bits (219), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 59/185 (31%), Positives = 85/185 (45%), Gaps = 3/185 (1%)

Query: 59  RVLQSRGDRQRLPLYGVPVAVKDNIDVRGLATTAACPSFA-YTAAQDATAVRLLRDAGAV 117
           R+ Q        PL  +   +KDNI  + L T+        + +  +AT V LL  AGAV
Sbjct: 33  RLSQGSSADDEKPLKNILCGIKDNIATKELPTSCGSKILKDFQSPFNATVVDLLEGAGAV 92

Query: 118 ILGKTNMDQFATGLVGTRSPY--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLTLGTDT 175
            +GKTNMD+F  G  GT S +                                  +GTDT
Sbjct: 93  TVGKTNMDEFGMGSGGTHSHFGPTRNPQFPSDNVIAGGSSSGSAAAVAADVVDFAIGTDT 152

Query: 176 AGSGRVPAALNNLVGVKPTRGTVSCTGVVPACRSLDCVSVFARDVADAHRCLRILARPDG 235
            GS R+PAA  +++G KP+ G +S  GVV   +SLD V + A+D+    +  ++L + D 
Sbjct: 153 GGSVRLPAAYTSVMGFKPSYGRISRHGVVAYAQSLDTVGILAKDIDIVQQVFKVLDKYDW 212

Query: 236 SDPYS 240
            DP S
Sbjct: 213 KDPTS 217

>Scas_684.25
          Length = 482

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 60/180 (33%), Positives = 82/180 (45%), Gaps = 3/180 (1%)

Query: 64  RGDRQRLPLYGVPVAVKDNIDVRGLATTAACPSFA-YTAAQDATAVRLLRDAGAVILGKT 122
           +G     PL     AVKDNI    + TT +    + Y +  DAT V+LLR++G  I+GKT
Sbjct: 41  KGSTVNNPLSNTLCAVKDNIATNDMPTTCSSSMLSNYQSPFDATVVKLLRESGTTIVGKT 100

Query: 123 NMDQFATGLVGTRSPYXXXXXXX--XXXXXXXXXXXXXXXXXXXXXXPLTLGTDTAGSGR 180
           NMD+FA G +G  S Y                                  LGTDT GS R
Sbjct: 101 NMDEFAMGSLGIHSHYGPALNPLFHDVDTVSGGSSSGSAGSVTSGVVHFALGTDTGGSVR 160

Query: 181 VPAALNNLVGVKPTRGTVSCTGVVPACRSLDCVSVFARDVADAHRCLRILARPDGSDPYS 240
           +PA   +++G K + G +S  GVV   +SLD V + A ++         L + D  DP S
Sbjct: 161 LPACYCSVLGFKGSYGRISRFGVVSFAQSLDTVGIMADNLQRVKDVFNTLDKFDKKDPTS 220

>YMR293C (YMR293C) [4247] chr13 complement(855398..856792) Protein
           with similarity to amidases, may be involved in
           mitochondrial function [1395 bp, 464 aa]
          Length = 464

 Score = 82.8 bits (203), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 56/187 (29%), Positives = 84/187 (44%), Gaps = 6/187 (3%)

Query: 58  WRVLQSRGDRQRLPLYGVPVAVKDNIDVRGLATTAACPSFA-YTAAQDATAVRLLRDAGA 116
           + +   +G ++ L   G   ++KDNI  +   TT A      + +  DAT V+LL+ AG 
Sbjct: 32  YSITNKKGTKETLT--GCVASIKDNIVTKDFPTTCASHILENFKSPFDATVVKLLKQAGV 89

Query: 117 VILGKTNMDQFATGLVGT---RSPYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLTLGT 173
            ILGKTN+D+F  G  G    R P                                 LGT
Sbjct: 90  HILGKTNLDEFGMGSGGVHSIRGPVINPLYPHEDKKIMGGSSSGAAASVACDLVDFALGT 149

Query: 174 DTAGSGRVPAALNNLVGVKPTRGTVSCTGVVPACRSLDCVSVFARDVADAHRCLRILARP 233
           DT GS R+PA   +++G KP+ G +S  GV+   +SLD V + ++ +    +    L + 
Sbjct: 150 DTGGSVRLPACYGSVLGFKPSYGRLSRFGVIAYSQSLDTVGILSKKINVLRKVFHTLDKY 209

Query: 234 DGSDPYS 240
           D  DP S
Sbjct: 210 DMKDPTS 216

>Kwal_56.22295
          Length = 583

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 58/196 (29%), Positives = 76/196 (38%), Gaps = 23/196 (11%)

Query: 69  RLPLYGVPVAVKDNIDVRGLATTAACPSFAYTAA---QDATAVRLLRDAGAVILGKTNMD 125
           R PL+G+P  VKDN   +    T  C S+A   +   +DA  V  LRDAGAV+ G   + 
Sbjct: 129 RGPLHGIPFVVKDNYATKDKMDTT-CGSWALLGSVVPRDAHVVAKLRDAGAVLFGHATLS 187

Query: 126 QFATGLVGT------------RSPYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLTLGT 173
           ++A     +            R P+                             P +LGT
Sbjct: 188 EWADMRSSSYSEGYSARGGQARCPFNLSVNPGGSSSGSAAAVAANMI-------PFSLGT 240

Query: 174 DTAGSGRVPAALNNLVGVKPTRGTVSCTGVVPACRSLDCVSVFARDVADAHRCLRILARP 233
           +T GS   PA  N +VG KPT G  S  GVVP     D     AR V DA    + +   
Sbjct: 241 ETDGSIIDPAMRNGIVGFKPTVGLTSRAGVVPESEHQDSTGPMARSVRDAVYAFQYMWGV 300

Query: 234 DGSDPYSRPSPADAPR 249
           D  D Y+       P 
Sbjct: 301 DERDVYTLNQTGHVPE 316

>Sklu_2417.11 , Contig c2417 20071-21846
          Length = 591

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 75/195 (38%), Gaps = 21/195 (10%)

Query: 69  RLPLYGVPVAVKDNIDVRG-LATTAACPSFAYTAA-QDATAVRLLRDAGAVILGKTNMDQ 126
           R PL+G+P  VKDN   +  + TTA   S   +   +DA  V  LRDAGAV+ G   M +
Sbjct: 138 RGPLHGIPFVVKDNYATKDKMDTTAGSWSLMGSVVPRDAYVVEKLRDAGAVLFGHATMSE 197

Query: 127 FATGLVGT------------RSPYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLTLGTD 174
           +A     +            R P+                               +LGT+
Sbjct: 198 WADMRSNSYSEGYSARGGQARCPFNLTVNPGGSSSGSAGSVAANMIM-------FSLGTE 250

Query: 175 TAGSGRVPAALNNLVGVKPTRGTVSCTGVVPACRSLDCVSVFARDVADAHRCLRILARPD 234
           T GS   PA  N +VG KPT G  S  GV+P     D     AR V DA    + +   D
Sbjct: 251 TDGSIIDPAMRNGIVGFKPTVGLTSRAGVIPESEHQDSTGPMARTVKDAVYVFQSMWGVD 310

Query: 235 GSDPYSRPSPADAPR 249
             D Y+       P 
Sbjct: 311 ERDAYTLNQTGHTPE 325

>Sklu_2417.10 , Contig c2417 20071-21846
          Length = 591

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 75/195 (38%), Gaps = 21/195 (10%)

Query: 69  RLPLYGVPVAVKDNIDVRG-LATTAACPSFAYTAA-QDATAVRLLRDAGAVILGKTNMDQ 126
           R PL+G+P  VKDN   +  + TTA   S   +   +DA  V  LRDAGAV+ G   M +
Sbjct: 138 RGPLHGIPFVVKDNYATKDKMDTTAGSWSLMGSVVPRDAYVVEKLRDAGAVLFGHATMSE 197

Query: 127 FATGLVGT------------RSPYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLTLGTD 174
           +A     +            R P+                               +LGT+
Sbjct: 198 WADMRSNSYSEGYSARGGQARCPFNLTVNPGGSSSGSAGSVAANMIM-------FSLGTE 250

Query: 175 TAGSGRVPAALNNLVGVKPTRGTVSCTGVVPACRSLDCVSVFARDVADAHRCLRILARPD 234
           T GS   PA  N +VG KPT G  S  GV+P     D     AR V DA    + +   D
Sbjct: 251 TDGSIIDPAMRNGIVGFKPTVGLTSRAGVIPESEHQDSTGPMARTVKDAVYVFQSMWGVD 310

Query: 235 GSDPYSRPSPADAPR 249
             D Y+       P 
Sbjct: 311 ERDAYTLNQTGHTPE 325

>Sklu_1884.2 YDR242W, Contig c1884 1484-3124 reverse complement
          Length = 546

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 63/141 (44%), Gaps = 3/141 (2%)

Query: 59  RVLQSRGDRQRLPLYGVPVAVKDNIDVRGLATTAACPSFAY---TAAQDATAVRLLRDAG 115
           ++L  R   + LPLYG+P+++KD  +V G  TT      A+   TAA+++  V+ L+D G
Sbjct: 107 KLLDERKPDKLLPLYGIPISLKDQCNVAGYDTTLGYLGRAFKPKTAAEESLLVKFLKDLG 166

Query: 116 AVILGKTNMDQFATGLVGTRSPYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLTLGTDT 175
           AV+  KT +           + +                              L +GTD 
Sbjct: 167 AVLYVKTTVPSSMMASETVSNTFGYTLNSVNTNFSSGGSSGGEGSLIGCYGSILGIGTDI 226

Query: 176 AGSGRVPAALNNLVGVKPTRG 196
            GS R+P++   L G++PT G
Sbjct: 227 GGSIRIPSSFQGLFGLRPTHG 247

>YDR242W (AMD2) [1076] chr4 (946799..948448) Protein with similarity
           to amidases [1650 bp, 549 aa]
          Length = 549

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 74/288 (25%), Positives = 121/288 (42%), Gaps = 32/288 (11%)

Query: 71  PLYGVPVAVKDNIDVRGLATTAA--CPSFA-YTAAQDATAVRLLRDAGAVILGKTNMDQF 127
           PLYG+P+++KD  +V G+ T+    C +F   T  +++  V  LRD GA+I  KT +   
Sbjct: 123 PLYGIPISLKDQCNVEGVDTSLGYLCRTFKPKTKNEESLIVSFLRDLGAIIFVKTTVPSS 182

Query: 128 ATGLVGTRSPYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLTLGTDTAGSGRVPAALNN 187
                   + +                              L LGTD  GS R+P++   
Sbjct: 183 MMATDTQSNTFGYTYNSINLSFSSGGSSGGEGSLIGAHGSLLGLGTDIGGSIRIPSSYQG 242

Query: 188 LVGVKPTRGTVSCTGVVPACRSLDCV-SV---FARDVADAH---RCLRILARPDGSDPYS 240
           L G+KPT G V    V  +    + + SV    ARD++D      C+  + +P   D   
Sbjct: 243 LFGLKPTFGRVPYLRVDNSFEGRETIPSVIGPLARDLSDLRYFMSCVINICQPWVQDVKC 302

Query: 241 RPSPADAP-RRLSTCPVVGVPREPEWFGES------QNAKLFATACQRM--RATGARVVK 291
            P   D+   +L    VVG+     W+G+        + +   T C+ +  +  G + VK
Sbjct: 303 IPYHFDSSTSKLHDNYVVGI-----WYGDGVIDPPPSDIRALKT-CEDLVNKTKGMKAVK 356

Query: 292 VDPQPLLDLGRSLYE---GPWVAERYAAMRAFY--SGQPPRDTLDPTV 334
            +P    +L R L++      VA+    ++  +  SG+P  D L P V
Sbjct: 357 WEPSS--ELSRELFDLANEADVADSGNEIKNEFEISGEPLLDILKPMV 402

>Scas_721.66
          Length = 573

 Score = 60.5 bits (145), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 67/151 (44%), Gaps = 4/151 (2%)

Query: 52  EHIEHQWRVLQSRGDRQRLP-LYGVPVAVKDNIDVRGLATTAACPSFAYTAAQ---DATA 107
           E +EH   + Q++ +   LP LYG+P+++KD  +V G+ TT    S A+   +   ++  
Sbjct: 121 EALEHSKILDQNKYEYSTLPPLYGIPISLKDQCNVEGVDTTLGYLSRAFKPKKKEDESLI 180

Query: 108 VRLLRDAGAVILGKTNMDQFATGLVGTRSPYXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 167
           V  LRD GA+I  KT +         T + +                             
Sbjct: 181 VSFLRDLGAIIYVKTTVPPSMMATETTSNTFGYTYNSFNQHFSAGGSSGGEGSLIGCYGS 240

Query: 168 PLTLGTDTAGSGRVPAALNNLVGVKPTRGTV 198
            L LGTD  GS R+PA+ + + G KP+ G V
Sbjct: 241 VLGLGTDIGGSIRIPASYHGIFGFKPSTGKV 271

>Kwal_34.15724
          Length = 556

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 57/257 (22%), Positives = 103/257 (40%), Gaps = 34/257 (13%)

Query: 72  LYGVPVAVKDNIDVRGLATTAACPSFAYTAAQDATAV-RLLRDAGAVILGKTNMDQFATG 130
           L+GVP+++KD +++ G+ TT    S   + ++  + + R+L+D GA+   KT +      
Sbjct: 124 LHGVPISLKDQVNLPGIETTIGYISKVGSKSEKVSLLARVLQDQGAIFYVKTAVPTAMLA 183

Query: 131 LVGTRSPYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLTLGTDTAGSGRVPAALNNLVG 190
                S +                             PL +GTD  GS R+PAA   L G
Sbjct: 184 SETVSSLHGRTLNAVNIAFSSGGSSGGEGSLIGARGSPLGVGTDIGGSIRIPAAFQGLYG 243

Query: 191 VKPTRGTVSCTGVV--------------PACRSLDCVSVFARDVADA---HRCLRILARP 233
           ++P+ G +    V               P   SL+ + +F + V DA   +   +++A P
Sbjct: 244 LRPSHGRIPYMHVANSYEGQELIPSVIGPLGTSLNDLELFTKSVIDAKTWNNDPQVIALP 303

Query: 234 --DGSDPYSRPSPADAPRRLSTCPVVGVPREPEWFGESQNAKLFATACQRMRATGARVVK 291
             D SD  +R         + T   + +P  P         +     C  +   G  +V+
Sbjct: 304 WRDCSDLKTRKLKIG----IMTWDKIVMPHPPV-------LRALKETCDTLTRNGHEIVE 352

Query: 292 ---VDPQPLLDLGRSLY 305
              +D + L+++G  +Y
Sbjct: 353 WDVLDHKKLMEIGEKVY 369

>KLLA0B08800g complement(772732..774444) similar to
           ca|CA4426|CaAMD21 Candida albicans amidase (by
           homology), start by similarity
          Length = 570

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 85/379 (22%), Positives = 141/379 (37%), Gaps = 46/379 (12%)

Query: 71  PLYGVPVAVKDNIDVRGLATTAACPSFA-YTAAQDATAVRLLRDAGAVILGKT------- 122
           PL+GVPV++K+ +  +G  T A+  S+  +   Q A +V +L   GAV   +T       
Sbjct: 141 PLHGVPVSIKEQMCYKGKVTNASYVSYVDFVPEQSAVSVDILIKLGAVCHVRTSQPQTIM 200

Query: 123 NMDQFATGLVGTRSPYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLTLGTDTAGSGRVP 182
           ++D +   +  TR+P                               +  G+D  GS R P
Sbjct: 201 HLDTWNNYIGRTRNPRSTKLSPGGSSGGESACVGMHGSV-------IGHGSDIGGSIRAP 253

Query: 183 AALNNLVGVKPTRGTVSCTGVVPACRSLDCVSV----FARDVADAHRCLRILARPDGSDP 238
           AA  NL G++PT   VS    +   +  + V       AR + +    ++     +G   
Sbjct: 254 AAFANLFGLRPTTKRVSLLNGISGGKGQESVVAVQGPLARSIDELDYYMKSYLN-EGKPW 312

Query: 239 YSRPSPADAPRRLSTCP-VVGVPREPEWFGESQNAKLFATACQRMRATGARVVKVDPQ-P 296
            + PS    P R S+ P V+ +   P     S        +  R     A V+  DP+  
Sbjct: 313 ETDPSLVPIPWRKSSLPDVINIGILP-----SDGLVTPYPSITRGVKHVADVLSKDPRFN 367

Query: 297 LLDLGRSLYEGPWVAERYAAMRAFYS---GQPPRDTLDPT------VTGIITSAGGYSAA 347
           ++DL    +    + E Y    + Y+    +     L+P+      +T      GG    
Sbjct: 368 VIDLSEQWFSEEEMKELYDTTLSLYTCDGNKVQLSMLEPSGEPILPLTRHFLEFGGGKEH 427

Query: 348 DVFDHGLRRQKLVAA----IEAELAGVDALLVPTCPLNPTLAAIAAEPLLVNARQGMWTN 403
            ++ + +   K  AA    +     G+   L+ T P N   A I  E          +T+
Sbjct: 428 SIYSNRMMNAKRDAAKLDIMNKYFKGMKLDLILT-PTNVAPAEIPGESFYWG-----YTS 481

Query: 404 FVNLADLAAVAIPAGFRRD 422
             NL D   V  P G + D
Sbjct: 482 LWNLVDYPNVTFPTGLKHD 500

>Sklu_2072.3 , Contig c2072 3010-4362 reverse complement
          Length = 450

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 54/141 (38%), Gaps = 1/141 (0%)

Query: 71  PLYGVPVAVKDNIDVRGLATTAACPSFAYT-AAQDATAVRLLRDAGAVILGKTNMDQFAT 129
           P++G+P+++K++   +G  T A   S       +DA    + R AGAV   +T   Q   
Sbjct: 28  PMHGLPLSLKEHYAYKGKTTNAGFSSMIDNLTEEDALTTEIFRKAGAVFYIRTTQPQSLM 87

Query: 130 GLVGTRSPYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLTLGTDTAGSGRVPAALNNLV 189
            L    +                               PL  G+D  GS R PAA  N+ 
Sbjct: 88  HLDSFNNITGRCRNPLNTLLSPGGSTSGEGALISLRGSPLGTGSDIGGSIRAPAAFCNIW 147

Query: 190 GVKPTRGTVSCTGVVPACRSL 210
           G KPT   VS  G   + R +
Sbjct: 148 GFKPTNKRVSLQGAWASYRDM 168

>Scas_582.4*
          Length = 2193

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 64/312 (20%), Positives = 127/312 (40%), Gaps = 25/312 (8%)

Query: 634  AVRIIRTLKRLGIRSVAVYSDPDRHSQHVRDADVAVALGGSSAAETYLDIDKILAAAKKT 693
            AV  +RTL+   I+++ +  +P+  S    +AD           ET +++++IL   +  
Sbjct: 977  AVTAVRTLRANKIKTIMINYNPETVSTDYDEAD-------RLYFET-INLERILDIYEIE 1028

Query: 694  DTQAIIPGYGFLSENATFAERCGAEGIVFVGPSGDSIRKLGLKHWARELAASAGV--PLT 751
            ++  ++   G  + N   A     E +  +G S + I     ++    +    GV  P  
Sbjct: 1029 NSSGVVVSMGGQTSN-NIAMSLHRENVKILGTSPEMIDSAENRYKFSRMLDQIGVDQPAW 1087

Query: 752  KGTGLLQSASAALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAELAAAFEQVQRQGELYF 811
            K    L S   A    E++GYP++V+ +    G  +  V S  +LA+   Q         
Sbjct: 1088 KE---LTSMDEAESFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLASYLNQAVEVSR--- 1141

Query: 812  TDSGVFLESFIARARHVEVQIM---GDGHGRTVALGERDCSLQRRNQKIIEETPAPNLPA 868
             D  V +  +I  A+ +E+  +   G+     V+    +  +   +  +I   P  +L  
Sbjct: 1142 -DYPVVITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLI--VPPQDLAK 1198

Query: 869  HTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFLEVNTRLQVEHPITEMVTGLDL 928
             T  ++  A  ++  A+K      ++F+   + +E   +E N R     P    V G++L
Sbjct: 1199 ETVDRIVVATAKIGKALKITGPYNIQFI--AKDNEIKVIECNVRASRSFPFISKVVGVNL 1256

Query: 929  VEWMLRIAANTP 940
            +E   +     P
Sbjct: 1257 IELATKAVMGLP 1268

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 65/338 (19%), Positives = 132/338 (39%), Gaps = 50/338 (14%)

Query: 740  RELAASAGVPLTKGTGLLQSASA---ALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAEL 796
            REL A+A   + +      +A++   AL A ++IG+P++V++    GG+G    ++  EL
Sbjct: 553  RELFANAIDEINEKCAKSHAANSVEEALTAVKDIGFPVIVRAAYALGGLGSGFANNEQEL 612

Query: 797  AAAFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGDGHGRTVALGERDCSLQRRNQK 856
                  +      + +   V +E  +   + +E +++ D     V +    C+++  +  
Sbjct: 613  ------IDLCNVAFASSPQVLVERSMKGWKEIEYEVVRDAFDNCVTV----CNMENFDPL 662

Query: 857  IIEE------TPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFLEVN 910
             I         P+  L       +R  A  +   +       +++  +    E+  +EVN
Sbjct: 663  GIHTGDSIVVAPSQTLSDEEYNMLRNTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVN 722

Query: 911  TRLQVEHPITEMVTGLDLVEWMLRIAANTPPDFDAGVEIEGVSMEARVYVENPVKGFTPS 970
             RL     +    TG  L     ++  N P           ++       ++    F PS
Sbjct: 723  ARLSRSSALASKATGYPLAYTAAKLGLNIP-----------LNEVINSVTKSTCACFEPS 771

Query: 971  PGLLTEVVFPSWARVDTWILKGTRVAAEYDPTL---AKIIVHGKDREDAVSKLL------ 1021
                  V  P W      + K TRV+ E   ++    +++  G+  E+A+ K +      
Sbjct: 772  LDYCV-VKMPRWD-----LKKFTRVSTELSSSMKSVGEVMSIGRTFEEAIQKAIRSTEYA 825

Query: 1022 -LALSETRIAGCMTNLDY-LKSIASSEEFRKASVFTRL 1057
             L  +ET +     ++DY L +      F  A+ F++L
Sbjct: 826  NLGFNETDLE---IDIDYELANPTDLRVFAIANAFSKL 860

>YJL130C (URA2) [2788] chr10 complement(165641..172285)
            Multifunctional protein of pyrimidine biosynthesis
            pathway, contains glutamine amidotransferase,
            glutamine-dependent carbamylphosphate synthetase
            (CPSase), dihydroorotase-like (DHOase) domain, and
            aspartate carbamyltransferase (ATCase) [6645 bp, 2214 aa]
          Length = 2214

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 64/312 (20%), Positives = 126/312 (40%), Gaps = 25/312 (8%)

Query: 634  AVRIIRTLKRLGIRSVAVYSDPDRHSQHVRDADVAVALGGSSAAETYLDIDKILAAAKKT 693
            AV  +RTL+   I+++ V  +P+  S    +AD           ET ++++++L   +  
Sbjct: 1002 AVTAVRTLRANNIKTIMVNYNPETVSTDYDEAD-------RLYFET-INLERVLDIYEIE 1053

Query: 694  DTQAIIPGYGFLSENATFAERCGAEGIVFVGPSGDSIRKLGLKHWARELAASAGV--PLT 751
            ++  ++   G  + N   A     E +  +G S D I     ++    +    GV  P  
Sbjct: 1054 NSSGVVVSMGGQTSN-NIAMTLHRENVKILGTSPDMIDSAENRYKFSRMLDQIGVDQPAW 1112

Query: 752  KGTGLLQSASAALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAELAAAFEQVQRQGELYF 811
            K    L S   A    E++GYP++V+ +    G  +  V S  +L +   Q         
Sbjct: 1113 KE---LTSMDEAESFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLESYLNQAVEVSR--- 1166

Query: 812  TDSGVFLESFIARARHVEVQIM---GDGHGRTVALGERDCSLQRRNQKIIEETPAPNLPA 868
             D  V +  +I  A+ +E+  +   G+     V+    +  +   +  +I   P  +L  
Sbjct: 1167 -DYPVVITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLI--VPPQDLAP 1223

Query: 869  HTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFLEVNTRLQVEHPITEMVTGLDL 928
             T  ++  A  ++  A+K      ++F+   + +E   +E N R     P    V G++L
Sbjct: 1224 ETVDRIVVATAKIGKALKITGPYNIQFI--AKDNEIKVIECNVRASRSFPFISKVVGVNL 1281

Query: 929  VEWMLRIAANTP 940
            +E   +     P
Sbjct: 1282 IELATKAIMGLP 1293

 Score = 40.8 bits (94), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 68/349 (19%), Positives = 136/349 (38%), Gaps = 43/349 (12%)

Query: 701  GYGFLSENATFAERCGAEGIVFVGPSGDSIRKLGLKHWARELAASAGVPLTKGTGLLQSA 760
            G   LS      +   A G+  +G   D+I    +    REL ++A   + +     Q+A
Sbjct: 523  GQTALSVGIAMKDEFEALGVKVLGTPIDTI----ITTEDRELFSNAIDEINEKCAKSQAA 578

Query: 761  SA---ALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAELAAAFEQVQRQGELYFTDSGVF 817
            ++   AL A +EIG+P++V++    GG+G    ++  EL      V      + +   V 
Sbjct: 579  NSVDEALAAVKEIGFPVIVRAAYALGGLGSGFANNEKEL------VDLCNVAFSSSPQVL 632

Query: 818  LESFIARARHVEVQIMGDGHGRTVALGERDCSLQRRNQKIIEE------TPAPNLPAHTR 871
            +E  +   + VE +++ D     + +    C+++  +   I         P+  L     
Sbjct: 633  VEKSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDY 688

Query: 872  QKMRQAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFLEVNTRLQVEHPITEMVTGLDLVEW 931
              +R  A  +   +       +++  +    ++  +EVN RL     +    TG  L   
Sbjct: 689  NMLRTTAVNVIRHLGVVGECNIQYALNPVSKDYCIIEVNARLSRSSALASKATGYPLAYT 748

Query: 932  MLRIAANTPPDFDAGVEIEGVSMEARVYVENPVKGFTPSPGLLTEVVFPSWARVDTWILK 991
              ++  N P +     E++          ++    F PS      V  P W      + K
Sbjct: 749  AAKLGLNIPLN-----EVKN------SVTKSTCACFEPSLDYCV-VKMPRWD-----LKK 791

Query: 992  GTRVAAEYDPTL---AKIIVHGKDREDAVSKLLLALSETRIAGCMTNLD 1037
             TRV+ E   ++    +++  G+  E+A+ K + +     +    T+LD
Sbjct: 792  FTRVSTELSSSMKSVGEVMSIGRTFEEAIQKAIRSTEYANLGFNETDLD 840

>CAGL0L05676g 619734..626369 highly similar to sp|P07259 Saccharomyces
            cerevisiae YJL130c URA2, start by similarity
          Length = 2211

 Score = 48.5 bits (114), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 63/312 (20%), Positives = 126/312 (40%), Gaps = 25/312 (8%)

Query: 634  AVRIIRTLKRLGIRSVAVYSDPDRHSQHVRDADVAVALGGSSAAETYLDIDKILAAAKKT 693
            AV  +RTL+   I+++ +  +P+  S    +AD           ET ++++++L   +  
Sbjct: 1000 AVTAVRTLRANNIKTIMINYNPETVSTDYDEAD-------RLYFET-INLERVLDIYEAE 1051

Query: 694  DTQAIIPGYGFLSENATFAERCGAEGIVFVGPSGDSIRKLGLKHWARELAASAGV--PLT 751
             +  ++   G  + N   A     E +  +G S D I     ++    +    GV  P  
Sbjct: 1052 ASNGVVVSMGGQTSN-NIAMSLHRENVKILGTSPDMIDSAENRYKFSRMLDQIGVDQPAW 1110

Query: 752  KGTGLLQSASAALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAELAAAFEQVQRQGELYF 811
            K    L S   A +  E++GYP++V+ +    G  +  V S  +L +   Q         
Sbjct: 1111 KE---LTSMDEAEDFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLESYLNQAVEVSR--- 1164

Query: 812  TDSGVFLESFIARARHVEVQIM---GDGHGRTVALGERDCSLQRRNQKIIEETPAPNLPA 868
             D  V +  +I  A+ +E+  +   G+     V+    +  +   +  +I   P  +L  
Sbjct: 1165 -DYPVVITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLI--VPPQDLAP 1221

Query: 869  HTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFLEVNTRLQVEHPITEMVTGLDL 928
             T  ++  A  ++  A+K      ++F+   + +E   +E N R     P    V G++L
Sbjct: 1222 ETVDRIVVATAKIGKALKITGPYNIQFI--AKDNEIKVIECNVRASRSFPFISKVVGVNL 1279

Query: 929  VEWMLRIAANTP 940
            +E   +     P
Sbjct: 1280 IELATKAIMGLP 1291

 Score = 39.3 bits (90), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 66/335 (19%), Positives = 135/335 (40%), Gaps = 44/335 (13%)

Query: 740  RELAASAGVPLTKGTGLLQSASA---ALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAEL 796
            REL A+A   + +     Q+A++   AL A ++IG+P++V++    GG+G    ++  EL
Sbjct: 556  RELFANAIDEIDEKCAKSQAANSVEEALAAVKDIGFPVIVRAAYALGGLGSGFANNEQEL 615

Query: 797  AAAFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGDGHGRTVALGERDCSLQRRNQK 856
                  +      + +   V +E  +   + VE +++ D     + +    C+++  +  
Sbjct: 616  ------IDLCNVAFASSPQVLVERSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPL 665

Query: 857  IIEE------TPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFLEVN 910
             I         P+  L       +R  A  +   +       +++  +    E+  +EVN
Sbjct: 666  GIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVN 725

Query: 911  TRLQVEHPITEMVTGLDLVEWMLRIAANTPPDFDAGVEIEGVSMEARVYVENPVKGFTPS 970
             RL     +    TG  L     ++  N P +     E++    ++          F PS
Sbjct: 726  ARLSRSSALASKATGYPLAYTAAKLGLNIPLN-----EVKNSVTKSTCAC------FEPS 774

Query: 971  PGLLTEVVFPSWARVDTWILKGTRVAAEYDPTL---AKIIVHGKDREDAVSKLLLALSET 1027
                  V  P W      + K TRV+ E   ++    +++  G+  E+A+ K + +   +
Sbjct: 775  LDYCV-VKMPRWD-----LKKFTRVSTELSSSMKSVGEVMSIGRTFEEAIQKAIRSTEYS 828

Query: 1028 RIAGCMTNL----DY-LKSIASSEEFRKASVFTRL 1057
             +    T+L    DY L++ +    F  A+ F +L
Sbjct: 829  NLGFNATDLEIDIDYELQNPSDLRIFAIANAFDKL 863

>Sklu_2331.1 YJL130C, Contig c2331 2029-8691
          Length = 2220

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 64/312 (20%), Positives = 125/312 (40%), Gaps = 25/312 (8%)

Query: 634  AVRIIRTLKRLGIRSVAVYSDPDRHSQHVRDADVAVALGGSSAAETYLDIDKILAAAKKT 693
            AV  +RTL+   ++++ V  +P+  S    +AD           ET +++++IL   +  
Sbjct: 1002 AVTAVRTLRANNVKTIMVNYNPETVSTDYDEAD-------RLYFET-INLERILDIYEAE 1053

Query: 694  DTQAIIPGYGFLSENATFAERCGAEGIVFVGPSGDSIRKLGLKHWARELAASAGV--PLT 751
             +  ++   G  + N   A     E +  +G S + I     ++    +    GV  P  
Sbjct: 1054 ASAGVVISMGGQTSN-NIAMSLHREKVKILGTSPEMIDSAENRYKFSRMLDQIGVDQPAW 1112

Query: 752  KGTGLLQSASAALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAELAAAFEQVQRQGELYF 811
            K    L S   A    E +GYP++V+ +    G  +  V S  +LA+   Q         
Sbjct: 1113 KE---LTSIDEAEGFAENVGYPVLVRPSYVLSGAAMNTVYSKDDLASYLNQAVEVSR--- 1166

Query: 812  TDSGVFLESFIARARHVEVQ-IMGDGHGRTVALGER--DCSLQRRNQKIIEETPAPNLPA 868
             D  V +  +I  A+ +E+  +  DG      + E   +  +   +  +I   P  +L  
Sbjct: 1167 -DYPVVITKYIENAKEIEMDAVAKDGELVMHVVSEHVENAGVHSGDATLI--VPPQDLDP 1223

Query: 869  HTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFLEVNTRLQVEHPITEMVTGLDL 928
             T  ++  A  ++  A+K      ++F+   + ++   +E N R     P    V G++L
Sbjct: 1224 ETVNRIVVATAKIGKALKITGPYNIQFI--AKNNDIKVIECNVRASRSFPFISKVVGVNL 1281

Query: 929  VEWMLRIAANTP 940
            +E   +     P
Sbjct: 1282 IEMATKAVMGLP 1293

 Score = 40.0 bits (92), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 43/210 (20%), Positives = 84/210 (40%), Gaps = 19/210 (9%)

Query: 740 RELAASAGVPLTKGTGLLQSASA---ALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAEL 796
           REL ++A   + +     ++AS    ALEA +EIG+P++V++    GG+G     +  EL
Sbjct: 558 RELFSNAMDEINEKCAKSKAASTVKEALEAVKEIGFPVIVRAAYALGGLGSGFASNETEL 617

Query: 797 AAAFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGDGHGRTVALGERDCSLQRRNQK 856
                 V      + +   V +E  +   + VE +++ D     + +    C+++  +  
Sbjct: 618 ------VDLCNVAFASSPQVLVERSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPL 667

Query: 857 IIEE------TPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFLEVN 910
            I         P+  L       +R  A  +   +       +++  +    E+  +EVN
Sbjct: 668 GIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVN 727

Query: 911 TRLQVEHPITEMVTGLDLVEWMLRIAANTP 940
            RL     +    TG  L     ++  N P
Sbjct: 728 ARLSRSSALASKATGYPLAFIAAKLGLNIP 757

>Sklu_2136.3 , Contig c2136 3336-5189 reverse complement
          Length = 617

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 56/130 (43%), Gaps = 1/130 (0%)

Query: 71  PLYGVPVAVKDNIDVRGLATTAACPSFAYTAAQD-ATAVRLLRDAGAVILGKTNMDQFAT 129
           PL+GVPV++K+ ++ +G  T A+  S+     ++ A ++ +L   GA+   +T+  Q   
Sbjct: 188 PLHGVPVSLKEQMNFKGKPTHASYVSYITNIPKNSAVSIDILDKLGAIFHTRTSQPQAIM 247

Query: 130 GLVGTRSPYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLTLGTDTAGSGRVPAALNNLV 189
            L    +                                +  G+D  GS RVPAA  +L 
Sbjct: 248 HLDTWNNITGRTRNPCSTRLSPGGSSGGESAMVGMHGSVIGHGSDIGGSIRVPAAFVDLF 307

Query: 190 GVKPTRGTVS 199
           G++PT   +S
Sbjct: 308 GIRPTTRRIS 317

>KLLA0E15444g 1370741..1377427 highly similar to sp|P07259
            Saccharomyces cerevisiae YJL130c URA2 multifunctional
            pyrimidine biosynthesis protein, start by similarity
          Length = 2228

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 60/312 (19%), Positives = 126/312 (40%), Gaps = 25/312 (8%)

Query: 634  AVRIIRTLKRLGIRSVAVYSDPDRHSQHVRDADVAVALGGSSAAETYLDIDKILAAAKKT 693
            AV  +RTL++   +++ V  +P+  S    +AD           ET +++++I+   +  
Sbjct: 1000 AVTAVRTLRKNNFKTIMVNYNPETVSTDYDEAD-------RLYFET-INLERIMDIYELE 1051

Query: 694  DTQAIIPGYGFLSENATFAERCGAEGIVFVGPSGDSIRKLGLKHWARELAASAGV--PLT 751
             +  ++   G  + N   A     E +  +G S + I     ++    +     V  P  
Sbjct: 1052 SSAGVVVSMGGQTSN-NIAMSLHRENVKILGTSPEMIDSAENRYKFSRMLDQIDVDQPAW 1110

Query: 752  KGTGLLQSASAALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAELAAAFEQVQRQGELYF 811
            K    L S   A +  E++ YP++V+ +    G  +  V S  +L +   Q       Y 
Sbjct: 1111 KE---LTSMDEAEDFAEKVSYPVLVRPSYVLSGAAMNTVYSKDDLESYLNQAVEVSREY- 1166

Query: 812  TDSGVFLESFIARARHVE---VQIMGDGHGRTVALGERDCSLQRRNQKIIEETPAPNLPA 868
                V +  +I  A+ +E   V + G+     V+    +  +   +  +I   P  +L  
Sbjct: 1167 ---PVVITKYIENAKEIEMDAVALDGELIMHVVSEHVENAGVHSGDATLI--VPPQDLDP 1221

Query: 869  HTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFLEVNTRLQVEHPITEMVTGLDL 928
             T +++ +A  ++  A++      ++F+   + +E   +E N R     P    V G++L
Sbjct: 1222 ETVRRIVEATAKIGRALQITGPYNIQFI--AKNNEIKVIECNVRASRSFPFISKVVGVNL 1279

Query: 929  VEWMLRIAANTP 940
            +E   +     P
Sbjct: 1280 IEMATKAIMGIP 1291

 Score = 32.3 bits (72), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 31/179 (17%), Positives = 68/179 (37%), Gaps = 16/179 (8%)

Query: 768 EEIGYPLMVKSTAGGGGIGLQRVDSAAELAAAFEQVQRQGELYFTDSGVFLESFIARARH 827
           ++IG+P++V++    GG+G     +  EL      V      + +   V +E  +   + 
Sbjct: 587 KDIGFPVIVRAAYALGGLGSGFASNEKEL------VDLCNVAFASSPQVLVERSMKGWKE 640

Query: 828 VEVQIMGDGHGRTVALGERDCSLQRRNQKIIEE------TPAPNLPAHTRQKMRQAAQRL 881
           +E +++ D     + +    C+++  +   I         P+  L       +R  A  +
Sbjct: 641 IEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVIAPSQTLSDEDYNMLRTTAVNV 696

Query: 882 CSAVKYKCAGTVEFMYDEQKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMLRIAANTP 940
              +       +++  +    E+  +EVN RL     +    TG  L     ++  N P
Sbjct: 697 IRHLGVVGECNIQYALNPTSKEYCIIEVNARLSRSSALASKATGYPLAYTAAKLGLNIP 755

>ACR263C [1310] [Homologous to ScYJL130C (URA2) - SH] (827830..834552)
            [6723 bp, 2240 aa]
          Length = 2240

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 62/312 (19%), Positives = 127/312 (40%), Gaps = 25/312 (8%)

Query: 634  AVRIIRTLKRLGIRSVAVYSDPDRHSQHVRDADVAVALGGSSAAETYLDIDKILAAAKKT 693
            AV  +RTL++  ++++ V  +P+  S    + D           ET +++++IL   +  
Sbjct: 1018 AVTAVRTLRQNNVKTIMVNYNPETVSTDYDEVD-------RLYFET-INMERILDIYEVE 1069

Query: 694  DTQAIIPGYGFLSENATFAERCGAEGIVFVGPSGDSIRKLGLKH-WAREL-AASAGVPLT 751
             +  ++   G  + N   A     E +  +G S + I     ++ ++R L       P  
Sbjct: 1070 SSAGVVVSMGGQTSN-NIAMSLHRENVKILGTSPEMIDSAENRYKFSRMLDQIEVDQPAW 1128

Query: 752  KGTGLLQSASAALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAELAAAFEQVQRQGELYF 811
            K    L S   A +   ++GYP++V+ +    G  +  V S  +L +   Q       Y 
Sbjct: 1129 KE---LTSMEEAEDFANKVGYPVLVRPSYVLSGAAMNTVYSKDDLESYLNQAVEVSREY- 1184

Query: 812  TDSGVFLESFIARARHVEVQ-IMGDGHGRTVALGER--DCSLQRRNQKIIEETPAPNLPA 868
                V +  +I  A+ +E+  +  DG      + E   +  +   +  +I   P  +L  
Sbjct: 1185 ---PVVITKYIENAKEIEMDAVAKDGEMIMHVVSEHVENAGVHSGDATLI--VPPQDLDP 1239

Query: 869  HTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFLEVNTRLQVEHPITEMVTGLDL 928
             T +++  A  ++  A+K      ++F+   + +E   +E N R     P    V G++L
Sbjct: 1240 ETVRRIVDATAKIGRALKITGPYNIQFI--AKNNEIKVIECNVRASRSFPFISKVIGVNL 1297

Query: 929  VEWMLRIAANTP 940
            +E   +     P
Sbjct: 1298 IEMATKAIMGIP 1309

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 52/249 (20%), Positives = 98/249 (39%), Gaps = 23/249 (9%)

Query: 701 GYGFLSENATFAERCGAEGIVFVGPSGDSIRKLGLKHWARELAASAGVPLTKGTGLLQSA 760
           G   LS      +   A G+  +G S D+I    +    REL A+A   + +     ++A
Sbjct: 539 GQTALSVGIEMKDEFEALGVKVLGTSIDTI----ITTEDRELFANAMDEINEKCAKSKAA 594

Query: 761 SA---ALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAELAAAFEQVQRQGELYFTDSGVF 817
           S    ALEA ++IG+P++V++    GG+G     +  EL      V      + +   V 
Sbjct: 595 STVDEALEAVKDIGFPVIVRAAYALGGLGSGFASNEQEL------VDLCNVAFASSPQVL 648

Query: 818 LESFIARARHVEVQIMGDGHGRTVALGERDCSLQRRNQKIIEE------TPAPNLPAHTR 871
           +E  +   + VE +++ D     + +    C+++  +   I         P+  L     
Sbjct: 649 VERSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDY 704

Query: 872 QKMRQAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFLEVNTRLQVEHPITEMVTGLDLVEW 931
             +R  A  +   +       +++  +    E+  +EVN RL     +    TG  L   
Sbjct: 705 NMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKATGYPLAYT 764

Query: 932 MLRIAANTP 940
             ++  N P
Sbjct: 765 AAKLGLNIP 773

>Kwal_27.10438
          Length = 569

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 55/273 (20%), Positives = 102/273 (37%), Gaps = 56/273 (20%)

Query: 66  DRQRL--PLYGVPVAVKDNIDVRGLATTAACPSFAYTAAQ-DATAVRLLRDAGAVILGKT 122
           D ++L  PL+GV V++K+ ++ +G  TTA+  ++     + +  ++ +LR  GAV   +T
Sbjct: 136 DNKKLIGPLHGVVVSLKEQMNYKGKVTTASYVAYLRNVTEKEGLSISILRKLGAVFHVRT 195

Query: 123 -------NMDQFATGLVGTRSPYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLTLGTDT 175
                  ++D +      TR+P                               +  G+D 
Sbjct: 196 AQPQGIMHLDTWNNITGRTRNPLSTRLSPGGSSGGESAIVAMHGSV-------IGHGSDI 248

Query: 176 AGSGRVPAALNNLVGVKPTRGTVSCTGVV--------------PACRSLDCVSVFARDVA 221
            GS R PAA  +L G++PT   +S    +              P  RS++ + ++ R   
Sbjct: 249 GGSIRAPAAFADLFGIRPTTKRISLVNGLSSGKGQESIVAVQGPLARSIEELDLYMRAYI 308

Query: 222 DAHR-------CLRILARPDGSDPYSR-----------PSPA------DAPRRLSTCPVV 257
           +  +       C+ +  R     P  +           P PA      +   +LS  P  
Sbjct: 309 NDGKPWLYDPVCIPLEWRQPQLPPKIKIGVLYDDNLVTPFPAITRGIQETVAKLSENPEF 368

Query: 258 GVPR-EPEWFGESQNAKLFATACQRMRATGARV 289
            V    P W+ E Q   ++ T  +     G ++
Sbjct: 369 EVVNLNPTWYSEEQMTDIYTTNLKLYTCDGNKI 401

>Kwal_33.14061
          Length = 2221

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 63/312 (20%), Positives = 125/312 (40%), Gaps = 25/312 (8%)

Query: 634  AVRIIRTLKRLGIRSVAVYSDPDRHSQHVRDADVAVALGGSSAAETYLDIDKILAAAKKT 693
            AV  +RTL++  I+S+ V  +P+  S    +AD       +   E  LDI +I ++A   
Sbjct: 1002 AVTAVRTLRKEKIKSIMVNYNPETVSTDYDEADRLYF--ETICLERILDIYEIESSA--- 1056

Query: 694  DTQAIIPGYGFLSENATFAERCGAEGIVFVGPSGDSIRKLGLKHWARELAASAGV--PLT 751
                ++   G  + N   A     E +  +G + + I     ++    +    GV  P  
Sbjct: 1057 ---GVVVSMGGQTSN-NIAMSLHRENVKILGTTPEMIDSAENRYKFSRMLDQIGVDQPAW 1112

Query: 752  KGTGLLQSASAALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAELAAAFEQVQRQGELYF 811
            K    L S   A +  + + +P++V+ +    G  +  V S  +LA+   Q         
Sbjct: 1113 KE---LTSIEEAEQFADAVSFPVLVRPSYVLSGAAMNTVYSKDDLASYLNQAVEVSR--- 1166

Query: 812  TDSGVFLESFIARARHVEVQ-IMGDGHGRTVALGER--DCSLQRRNQKIIEETPAPNLPA 868
             D  V +  +I  A+ +E+  +  DG      + E   +  +   +  +I   P  +L  
Sbjct: 1167 -DYPVVITKYIENAKEIEMDAVAKDGELVMHVVSEHVENAGVHSGDATLI--VPPQDLDP 1223

Query: 869  HTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFLEVNTRLQVEHPITEMVTGLDL 928
             T +++  A  ++  A+K      ++F+   + ++   +E N R     P    V  ++L
Sbjct: 1224 ETVERIVVATAKIGKALKITGPFNIQFI--AKNNDIKVIECNVRASRSFPFISKVVNVNL 1281

Query: 929  VEWMLRIAANTP 940
            +E   +     P
Sbjct: 1282 IEMATKAIMGLP 1293

 Score = 38.1 bits (87), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 41/210 (19%), Positives = 84/210 (40%), Gaps = 19/210 (9%)

Query: 740 RELAASAGVPLTKGTGLLQSASA---ALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAEL 796
           REL ++A   + +     ++A+    ALEA +EIG+P++ ++    GG+G    ++  EL
Sbjct: 558 RELFSNAMDEINEKCAKSKAAATVEEALEAVKEIGFPVICRAAYALGGLGSGFANNEKEL 617

Query: 797 AAAFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGDGHGRTVALGERDCSLQRRNQK 856
                 V      + +   V +E  +   + VE +++ D     + +    C+++  +  
Sbjct: 618 ------VDLCNIAFASSPQVLVERSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPL 667

Query: 857 IIEE------TPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFLEVN 910
            I         P+  L       +R  A  +   +       +++  +    E+  +EVN
Sbjct: 668 GIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVN 727

Query: 911 TRLQVEHPITEMVTGLDLVEWMLRIAANTP 940
            RL     +    TG  L     ++  N P
Sbjct: 728 ARLSRSSALASKATGYPLAYTAAKLGLNIP 757

>KLLA0F03190g complement(296883..300236) highly similar to sp|P03965
           Saccharomyces cerevisiae YJR109c CPA2 arginine-specific
           carbamoylphosphate synthase, large chain, start by
           similarity
          Length = 1117

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 74/181 (40%), Gaps = 8/181 (4%)

Query: 758 QSASAALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAELAAAFEQVQRQGELYFTDSGVF 817
           ++  AALEA + +G+P++V+S    GG+G    ++A E+       Q   +       + 
Sbjct: 172 ETVDAALEAADIVGFPVIVRSAYALGGLGSGFANNAQEMK------QLASQSLSLAPQIL 225

Query: 818 LESFIARARHVEVQIMGD--GHGRTVALGERDCSLQRRNQKIIEETPAPNLPAHTRQKMR 875
           +E  +   + VE +++ D  G+  TV   E    L       I   P+  L       +R
Sbjct: 226 VEKSLKGWKEVEYEVVRDRVGNCITVCNMENFDPLGIHTGDSIVFAPSQTLSDEEFHMLR 285

Query: 876 QAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMLRI 935
            AA ++   +       V++       ++  +EVN RL     +    TG  L     +I
Sbjct: 286 SAAIKIIRHLGVIGECNVQYALSPDSLDYRVIEVNARLSRSSALASKATGYPLAYTAAKI 345

Query: 936 A 936
           A
Sbjct: 346 A 346

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 56/302 (18%), Positives = 119/302 (39%), Gaps = 21/302 (6%)

Query: 634 AVRIIRTLKRLGIRSVAVYSDPDRHSQHVRDADVAVALGGSSAAETYLDIDKILAAAKKT 693
           AV   + L++ G +++ +  +P+  S    + D         + E  +DI ++     + 
Sbjct: 601 AVNTTKALRKEGKKTIMINYNPETVSTDFDEVDRLYF--EELSFERVMDIYEL-----EN 653

Query: 694 DTQAIIPGYGFLSENATFAERCGAEGIVFVGPSGDSIRKLGLKHWARELAASAGVPLTKG 753
               +I   G L +N   A +    G   +G S + I K   +H    +  S GV   + 
Sbjct: 654 SEGCVISVGGQLPQN--IALKLLHNGAHILGTSPEDIDKAENRHKFSTILDSIGVNQPEW 711

Query: 754 TGLLQSASAALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAELAAAFEQVQRQGELYFTD 813
           + L     A + A + +GYP++++ +    G  +  V    EL                D
Sbjct: 712 SELSSVEEAKVFANQ-VGYPVLIRPSYVLSGAAMSVVTGEHELEVKLTTASDVS----PD 766

Query: 814 SGVFLESFIARARHVEVQ-IMGDGHGRTVALGER--DCSLQRRNQKIIEETPAPNLPAHT 870
             V +  FI  A+ ++V  +  +G     A+ E   +  +   +  ++   P  NL  + 
Sbjct: 767 HPVVMSKFIEGAQEIDVDAVAHNGMVLVHAISEHVENAGIHSGDATLV--LPPQNLSQNI 824

Query: 871 RQKMRQAAQRLCSAVKYKCAGTVEFMYDEQKD--EFYFLEVNTRLQVEHPITEMVTGLDL 928
           + ++++ A ++  A        ++ + D++ +      +E N R     P    V G++ 
Sbjct: 825 KDRLKEIADKVAKAWNITGPFNMQIIKDDRDEGVSLKVIECNIRASRSFPFVSKVLGVNF 884

Query: 929 VE 930
           +E
Sbjct: 885 IE 886

>KLLA0D12628g 1071637..1073373 weakly similar to sp|P22580
           Saccharomyces cerevisiae YDR242w AMD2 amidase singleton,
           hypothetical start
          Length = 578

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 82/394 (20%), Positives = 144/394 (36%), Gaps = 71/394 (18%)

Query: 71  PLYGVPVAVKDNIDVRGLATTAACPSFAYTAA-QDATAVRLLRDAGAVILGKT------- 122
           P++G+P+++K+++  +G  T A+  S   +   + A  V +    GA+   +T       
Sbjct: 143 PMHGIPISLKEHLSFKGEITHASYVSLLSSVTPKHALTVDIFDKQGALYHVRTAQPQTIM 202

Query: 123 NMDQFATGLVGTRSPYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLTLGTDTAGSGRVP 182
           ++D +      TR+P                               + +GTD  GS R P
Sbjct: 203 HLDTWNIITGRTRNPRSTKLSPGGSSGGESAAIGMHGSV-------IGIGTDIGGSIRCP 255

Query: 183 AALNNLVGVKPTRGTVSCTGVVPAC----RSLDCVSVFARDVADAHRCLRIL---ARPDG 235
           AA   + G++PT   VS   V P+       +  +   AR + +    ++      +P  
Sbjct: 256 AAFAGICGMRPTVKRVSLLDVTPSSGGQESIVPTIGPLARSIEELDYFMKHYINDGKPWE 315

Query: 236 SDPYSRPSP---ADAPRRLSTCPVVGVPREPEWFGESQNAKLFATACQRMRATGARVVK- 291
           SD  S P P   A+ P+++     VGV               +    + M+    ++ K 
Sbjct: 316 SDTTSIPIPWREAELPQKIK----VGV------LYTDNLVTPYPAIVRGMKTAAEQLAKH 365

Query: 292 VDPQPLLDLGRSLYEGPWVAERYAAMRAFY--------------SGQPPRDTLDPTVTGI 337
            D   ++DL    +    + + Y      Y              SG+P    + P     
Sbjct: 366 SDTFEIVDLAPYWFSEQEMLDIYTTNLVLYTIDGNKGQLSLTEKSGEP----ILPLTEHY 421

Query: 338 ITSAGG--YSAADVFDHG----LRRQKLVAAIEAELA---GVDALLVPTCPLNPTLAAIA 388
               GG   SA +   H     + +Q++      + +   G+D +L PT   N + A I 
Sbjct: 422 FKFGGGKPLSAFENRQHNHVRDVNQQRIFEEFFKKTSSSLGLDFILSPT---NVSPAEIP 478

Query: 389 AEPLLVNARQGMWTNFVNLADLAAVAIPAGFRRD 422
           AE          +T+F NL D   V  P+G   D
Sbjct: 479 AESFYWG-----YTSFWNLFDYPNVIFPSGVSHD 507

>YJR109C (CPA2) [3001] chr10 complement(629500..632856)
           Carbamoylphosphate synthetase of arginine biosynthetic
           pathway, synthetase (large) subunit [3357 bp, 1118 aa]
          Length = 1118

 Score = 38.9 bits (89), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 79/195 (40%), Gaps = 13/195 (6%)

Query: 740 RELAASA----GVPLTKGTGLLQSASAALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAE 795
           R+L ASA     +P+ +     ++   ALEA E + YP++V+S    GG+G    ++A+E
Sbjct: 150 RDLFASALKDINIPIAESFAC-ETVDEALEAAERVKYPVIVRSAYALGGLGSGFANNASE 208

Query: 796 LAAAFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGD--GHGRTVALGERDCSLQRR 853
           +     Q             + +E  +   + VE +++ D  G+  TV   E    L   
Sbjct: 209 MKELAAQSLSLA------PQILVEKSLKGWKEVEYEVVRDRVGNCITVCNMENFDPLGVH 262

Query: 854 NQKIIEETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFLEVNTRL 913
               +   P+  L       +R AA ++   +       V++       ++  +EVN RL
Sbjct: 263 TGDSMVFAPSQTLSDEEFHMLRSAAIKIIRHLGVIGECNVQYALQPDGLDYRVIEVNARL 322

Query: 914 QVEHPITEMVTGLDL 928
                +    TG  L
Sbjct: 323 SRSSALASKATGYPL 337

>KLLA0C09735g 841867..844221 similar to sgd|S0005782 Saccharomyces
           cerevisiae YOR256c, start by similarity
          Length = 784

 Score = 37.0 bits (84), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 44/87 (50%), Gaps = 10/87 (11%)

Query: 654 DPDRHSQHVRDADVAVALGGSSAAETYLDIDKILAAAKKTDTQAIIPGYGFL-SENATFA 712
           +P   + ++++AD+  A  G+ A     DI  +      +D   ++  YG L SE    A
Sbjct: 244 NPLSSNGNIQNADIIYANYGTVA-----DIQSLKENGLLSDNTVLVMKYGNLPSEQILVA 298

Query: 713 ERCGAEGIVFV----GPSGDSIRKLGL 735
           E+ G +GI+F+    G  GD I+KL +
Sbjct: 299 EKHGIKGIIFISKPFGNDGDVIQKLSV 325

>YKL162C (YKL162C) [3108] chr11 complement(147635..148843) Protein of
            unknown function [1209 bp, 402 aa]
          Length = 402

 Score = 36.2 bits (82), Expect = 0.22,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 25/52 (48%)

Query: 1032 CMTNLDYLKSIASSEEFRKASVFTRLLNDFEYTPTAFEVKIPGAYTTIQDYP 1083
            C   + YLKS  S   F+K   F   L   +  P+     IPG+ + +QDYP
Sbjct: 126  CKNLMSYLKSTLSDNMFQKIKYFMVPLYKCDKIPSKLLDGIPGSVSLVQDYP 177

>Sklu_2258.5 YML054C, Contig c2258 8274-10016 reverse complement
          Length = 580

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 73/178 (41%), Gaps = 25/178 (14%)

Query: 632 EIAVRIIRTLKRLGIRSVAVYSDPDRHSQHVRDADVAV----------------ALGGSS 675
           +I   +I+ +++LG++++ V  D     +  +D  V                  + G S+
Sbjct: 330 KITDDLIKQVEKLGLKAIFVTVDAPSLGRREKDMKVKFTNSNGAKAMEKTKVKESKGASA 389

Query: 676 AAETYLD----IDKILAAAKKTDTQAIIPGYGFLSENATFAERCGAEGIVFVGPSGDSIR 731
           A  T++D     D I+   KKT+   +I G   + E+   A   GA G+V     G   R
Sbjct: 390 ALSTFIDPALSWDDIVEIKKKTNLPIVIKGVQRV-EDVLKAAEVGAAGVVLSNHGG---R 445

Query: 732 KLGLKHWARELAASAGVPLTKGTGLLQSASAALEAGEEIGYPLMVKSTAGGGGIGLQR 789
           +L       E+ A + VP+ K   L       ++ G   G  ++     G  G+GL R
Sbjct: 446 QLDFSRAPIEVLAES-VPVLKERNLSDKLEIFIDGGVRRGNDVLKALCLGAKGVGLGR 502

>ABR157W [750] [Homologous to ScYJR109C (CPA2) - SH]
           complement(695747..699088) [3342 bp, 1113 aa]
          Length = 1113

 Score = 35.4 bits (80), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 76/203 (37%), Gaps = 13/203 (6%)

Query: 740 RELAASA----GVPLTKGTGLLQSASAALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAE 795
           REL A A     +P+ +      +   A+ A  +IGYP++V+S    GG+G    D   +
Sbjct: 150 RELFARALKEINMPIAESVAC-STVEDAVAAANDIGYPVIVRSAYALGGLGSGFADDDLQ 208

Query: 796 LAAAFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGD--GHGRTVALGERDCSLQRR 853
           L       Q   +       V +E  +   + +E +++ D  G+  TV   E    L   
Sbjct: 209 LR------QLCAQSLALSPQVLVEKSLKGWKEIEYEVVRDRVGNCITVCNMENFDPLGIH 262

Query: 854 NQKIIEETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFLEVNTRL 913
               I   P+  L       +R AA  +   +       V++        F  +EVN RL
Sbjct: 263 TGDSIVLAPSQTLSDEEFHMLRTAAIEIIRHLGVVGECNVQYALQPDGLAFKVIEVNARL 322

Query: 914 QVEHPITEMVTGLDLVEWMLRIA 936
                +    TG  L     +IA
Sbjct: 323 SRSSALASKATGYPLAYTAAKIA 345

>CAGL0C04917g 457506..460847 highly similar to sp|P03965
           Saccharomyces cerevisiae YJR109c CPA2, hypothetical
           start
          Length = 1113

 Score = 35.0 bits (79), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 42/207 (20%), Positives = 78/207 (37%), Gaps = 21/207 (10%)

Query: 740 RELAASA----GVPLTKGTGLLQSASAALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAE 795
           R+L ASA     +P+ +     ++    L A   IGYP++++S    GG+G    ++  E
Sbjct: 149 RDLFASALKEIDIPIAESIAC-ENIDDVLSAASTIGYPVIIRSAYALGGLGSGFANNPEE 207

Query: 796 LAAAFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGDGHGRTVALGERDCSLQR--- 852
           L     Q             V +E  +   + VE +++ D     + +    C+++    
Sbjct: 208 LKELASQSLSLA------PQVLVEKSLRGWKEVEYEVVRDRENNCITV----CNMENFDP 257

Query: 853 ---RNQKIIEETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFLEV 909
                   I   P+  L       +R AA ++   +       V++       ++  +EV
Sbjct: 258 LGVHTGDSIVFAPSQTLSDEEFHMLRSAAIKIIRHLGVVGECNVQYALSPNSLDYRVIEV 317

Query: 910 NTRLQVEHPITEMVTGLDLVEWMLRIA 936
           N RL     +    TG  L     +IA
Sbjct: 318 NARLSRSSALASKATGYPLAYTAAKIA 344

>Kwal_55.19783
          Length = 1121

 Score = 35.0 bits (79), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 39/181 (21%), Positives = 69/181 (38%), Gaps = 8/181 (4%)

Query: 758 QSASAALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAELAAAFEQVQRQGELYFTDSGVF 817
           ++   AL A   +GYP++V+S    GG+G    ++ AE+     Q             + 
Sbjct: 174 ETVDEALSAASRVGYPVIVRSAYALGGLGSGFAENEAEMKELAAQALS------LSPQIL 227

Query: 818 LESFIARARHVEVQIMGD--GHGRTVALGERDCSLQRRNQKIIEETPAPNLPAHTRQKMR 875
           +E  +   + VE +++ D   +  TV   E    L       I   P+  L       +R
Sbjct: 228 VEKSLKGWKEVEYEVVRDRVDNCITVCNMENFDPLGVHTGDSIVFAPSQTLSDEEFHMLR 287

Query: 876 QAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMLRI 935
            AA ++   +       V++       ++  +EVN RL     +    TG  L     +I
Sbjct: 288 TAAIKIIRHLGVVGECNVQYALQPDGLDYRVIEVNARLSRSSALASKATGYPLAYTAAKI 347

Query: 936 A 936
           A
Sbjct: 348 A 348

>Sklu_2413.4 YJR109C, Contig c2413 10886-14254
          Length = 1122

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 43/203 (21%), Positives = 78/203 (38%), Gaps = 13/203 (6%)

Query: 740 RELAASA----GVPLTKGTGLLQSASAALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAE 795
           R+L A A     +P+ +     ++   ALEA  ++ YP++V+S    GG+G    +   E
Sbjct: 153 RDLFAQALKEINIPIAESFAC-ETIDQALEAAAKVKYPVIVRSAYALGGLGSGFANDEQE 211

Query: 796 LAAAFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGD--GHGRTVALGERDCSLQRR 853
           +     Q             + +E  +   + +E +++ D  G+  TV   E    L   
Sbjct: 212 MKELASQSLSLA------PQILVEKSLKGWKEIEYEVVRDRVGNCITVCNMENFDPLGIH 265

Query: 854 NQKIIEETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFLEVNTRL 913
               I   P+  L       +R AA ++   +       V++       ++  +EVN RL
Sbjct: 266 TGDSIVFAPSQTLSDEEFHMLRSAAIKIIRHLGVVGECNVQYALQPDGLDYRVIEVNARL 325

Query: 914 QVEHPITEMVTGLDLVEWMLRIA 936
                +    TG  L     +IA
Sbjct: 326 SRSSALASKATGYPLAYTAAKIA 348

>KLLA0B13651g complement(1196688..1198082) weakly similar to sp|P36075
            Saccharomyces cerevisiae YKL090w hypothetical protein
            singleton, start by similarity
          Length = 464

 Score = 33.5 bits (75), Expect = 1.6,   Method: Composition-based stats.
 Identities = 13/22 (59%), Positives = 17/22 (77%)

Query: 1744 YPEDAHMVYSEYAGRFWKQVVS 1765
            +PEDAH+V SE   R+WKQ +S
Sbjct: 373  FPEDAHLVTSECLKRWWKQELS 394

>Kwal_27.12376
          Length = 749

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 63/151 (41%), Gaps = 23/151 (15%)

Query: 948  EIEGVSMEARV-YVENPVKGFTPSPGLLTEVVFPSWARVDTWILKGTRVAAEYDPTLAKI 1006
            EI G+S  A++ Y++N  +    SP  L  +V  S   +  W+  G R +     TL K+
Sbjct: 598  EIAGMSESAKIAYIDNTFRDAYKSP--LNILVIDSLETLVDWVPIGPRFSNNILQTL-KV 654

Query: 1007 IVHGKDREDAVSKLLL--------ALSETRIAGC---------MTNLDYLKSIASSEEFR 1049
             +  K  +D   +LLL         L +  +  C         +TNLD   ++    +F 
Sbjct: 655  YLKRKPPKD--RRLLLISTTSAYSVLQQMDLLSCFDNEIAVPNITNLDEFNNVMIESDFL 712

Query: 1050 KASVFTRLLNDFEYTPTAFEVKIPGAYTTIQ 1080
              +   ++LN+F        V I  A T I+
Sbjct: 713  DDADRVKVLNEFSALNLKLNVGIKKALTNIE 743

>Scas_691.19
          Length = 1117

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 44/203 (21%), Positives = 76/203 (37%), Gaps = 13/203 (6%)

Query: 740 RELAASA----GVPLTKGTGLLQSASAALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAE 795
           R+L A+A     +P+        +   AL A   I YP++++S    GG+G    ++  E
Sbjct: 150 RDLFANALKEINIPIANSIAC-ATVDEALAAANSIKYPVIIRSAYALGGLGSGFANNDQE 208

Query: 796 LAAAFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGD--GHGRTVALGERDCSLQRR 853
           L     Q             + +E  +   + VE +++ D  G+  TV   E    L   
Sbjct: 209 LKQLSSQSLSLS------PQILVERSMKGWKEVEYEVVRDRVGNCITVCNMENFDPLGVH 262

Query: 854 NQKIIEETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFLEVNTRL 913
               I   P+  L       +R AA ++   +       V++       ++  +EVN RL
Sbjct: 263 TGDSIVFAPSQTLSDEEYHMLRSAAIKIIRHLGVIGECNVQYALQPDGLDYCVIEVNARL 322

Query: 914 QVEHPITEMVTGLDLVEWMLRIA 936
                +    TG  L     +IA
Sbjct: 323 SRSSALASKATGYPLAYTAAKIA 345

>AER169C [2672] [Homologous to ScYBR080C (SEC18) - SH]
            (951174..953462) [2289 bp, 762 aa]
          Length = 762

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 56/123 (45%), Gaps = 14/123 (11%)

Query: 947  VEIEGVSMEARV-YVENPVKGFTPSPGLLTEVVFPSWARVDTWILKGTRVAAEYDPTLAK 1005
            VEI G+S  A++ Y++N  +    SP  L  +V  S   +  W+  G R +   +  L  
Sbjct: 596  VEIAGMSEAAKIAYIDNTFRDAYKSP--LNILVVDSLETLVDWVPIGPRFS---NSILQV 650

Query: 1006 IIVHGKDREDAVSKLLL--------ALSETRIAGCMTNLDYLKSIASSEEFRKASVFTRL 1057
            + V+ K +  +  +LL+         L +  I  C  N   + +I+S +EF    + T  
Sbjct: 651  LKVYLKRKPPSGRRLLIISTTSTYSVLQQMDILSCFDNEIAVPNISSIDEFNNVMIETNF 710

Query: 1058 LND 1060
            L+D
Sbjct: 711  LDD 713

>ACR210C [1257] [Homologous to ScYOR128C (ADE2) - SH]
           (714549..716246) [1698 bp, 565 aa]
          Length = 565

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 38/75 (50%), Gaps = 4/75 (5%)

Query: 725 PSGDSIRKLGLKHWARELAASAGVPLTKGTGLLQSASAALEAGEEIGYPLMVKSTA---- 780
           P+ ++I  +  KH  +E  +  GV + +   +  +  A +  GE++GYP M+K+      
Sbjct: 95  PTPEAIELIQDKHVQKEHLSGHGVAVAESIAVEGTEPALVAVGEQLGYPYMLKARKLAYD 154

Query: 781 GGGGIGLQRVDSAAE 795
           G G   ++  DS AE
Sbjct: 155 GRGNFVVKSRDSIAE 169

>Sklu_2071.3 YPL101W, Contig c2071 2749-4143
          Length = 464

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 39/81 (48%), Gaps = 4/81 (4%)

Query: 174 DTAGSGRVPAALNNLVGVKPTRGTVSCTGV-VPACRSLDCVSVFARDVADAHRCLRILAR 232
           D   S R PA L   +   P R      G+  PA  ++  V++  R++A   + L+ ++ 
Sbjct: 25  DALDSRRGPAPLRTPL---PNRAVPDRKGINTPARTTVSSVTMGMRNIALNDKFLQTVST 81

Query: 233 PDGSDPYSRPSPADAPRRLST 253
            D S P  RPSPA + +  ST
Sbjct: 82  LDPSHPGVRPSPATSQQTTST 102

>YKL143W (LTV1) [3124] chr11 (176786..178177) Protein that may play a
            role in pre-rRNA processing, required for viability at
            low temperature [1392 bp, 463 aa]
          Length = 463

 Score = 31.2 bits (69), Expect = 9.3,   Method: Composition-based stats.
 Identities = 25/98 (25%), Positives = 42/98 (42%), Gaps = 7/98 (7%)

Query: 1243 RESWKIGLVCGPHGSPDFFKREALEEFF---SSPWKVHYNSNRFGIRLIGPKPKWARSDG 1299
            + S +  +V  PH  P F+  +A        S+P K    ++     +   KPK  R+  
Sbjct: 8    KNSQRYVVVHRPHDDPSFYDTDASAHVLVPVSNPNKTSPEADLRKKDVSSTKPKGRRAHV 67

Query: 1300 GEAGLHPSN----THDYVYSVGAINFTGDEPVIIAAEG 1333
            GEA L+  N     +DY   +  I    +  + IA++G
Sbjct: 68   GEAALYGINFDDSEYDYTQHLKPIGLDPENSIFIASKG 105

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.136    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 54,272,132
Number of extensions: 2318680
Number of successful extensions: 5243
Number of sequences better than 10.0: 70
Number of HSP's gapped: 5215
Number of HSP's successfully gapped: 94
Length of query: 1786
Length of database: 16,596,109
Length adjustment: 116
Effective length of query: 1670
Effective length of database: 12,580,421
Effective search space: 21009303070
Effective search space used: 21009303070
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)