Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADR034W40439720150.0
Scas_716.3250941410201e-135
KLLA0D14927g50740910171e-135
YGR093W5073969811e-129
Kwal_23.39913573558661e-114
CAGL0G03069g4864038401e-108
Sklu_1641.146250691.8
YER151C (UBP3)912106639.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADR034W
         (397 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADR034W [1775] [Homologous to ScYGR093W - SH] complement(767110....   780   0.0  
Scas_716.32                                                           397   e-135
KLLA0D14927g 1258177..1259700 similar to sp|P53255 Saccharomyces...   396   e-135
YGR093W (YGR093W) [2053] chr7 (670390..671913) Member of the pro...   382   e-129
Kwal_23.3991                                                          338   e-114
CAGL0G03069g 284268..285728 similar to sp|P53255 Saccharomyces c...   328   e-108
Sklu_1641.1 YBL098W, Contig c1641 1163-2551                            31   1.8  
YER151C (UBP3) [1580] chr5 complement(469681..472419) Ubiquitin-...    29   9.9  

>ADR034W [1775] [Homologous to ScYGR093W - SH]
           complement(767110..768324) [1215 bp, 404 aa]
          Length = 404

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/397 (95%), Positives = 379/397 (95%)

Query: 1   MKIGYFTPSERIEPSAVDAELEIFKKVGRLDILLTKEWPKSVRSKLEEVSGTDTVDQLVI 60
           MKIGYFTPSERIEPSAVDAELEIFKKVGRLDILLTKEWPKSVRSKLEEVSGTDTVDQLVI
Sbjct: 1   MKIGYFTPSERIEPSAVDAELEIFKKVGRLDILLTKEWPKSVRSKLEEVSGTDTVDQLVI 60

Query: 61  SSKPQYHFATLGDKYFELEPFGWDRSSMPDITRFINLATFGSGEKWAYAFNITVGTDQEA 120
           SSKPQYHFATLGDKYFELEPFGWDRSSMPDITRFINLATFGSGEKWAYAFNITVGTDQEA
Sbjct: 61  SSKPQYHFATLGDKYFELEPFGWDRSSMPDITRFINLATFGSGEKWAYAFNITVGTDQEA 120

Query: 121 SVPTNLTTNPFITMXXXXXXXXXXXXXXXXXXTKVLPAACHFCLSNPSVEDHMVISIGKH 180
           SVPTNLTTNPFITM                  TKVLPAACHFCLSNPSVEDHMVISIGKH
Sbjct: 121 SVPTNLTTNPFITMDRPKRDLDSDPLPPPKKRTKVLPAACHFCLSNPSVEDHMVISIGKH 180

Query: 181 SYLTIAKGPLSVPRGEMTFSGHCLIIPIDHVPKFNSASPDQTTSAIMETEMGKEVMRYES 240
           SYLTIAKGPLSVPRGEMTFSGHCLIIPIDHVPKFNSASPDQTTSAIMETEMGKEVMRYES
Sbjct: 181 SYLTIAKGPLSVPRGEMTFSGHCLIIPIDHVPKFNSASPDQTTSAIMETEMGKEVMRYES 240

Query: 241 ALVNMNYKKFDMSTLVFEINSVNSVHFHKQVVPVPKYLIGSFTTALDRQLHINNEKFKKN 300
           ALVNMNYKKFDMSTLVFEINSVNSVHFHKQVVPVPKYLIGSFTTALDRQLHINNEKFKKN
Sbjct: 241 ALVNMNYKKFDMSTLVFEINSVNSVHFHKQVVPVPKYLIGSFTTALDRQLHINNEKFKKN 300

Query: 301 ANFTFQDFEGLQHPDFLALVNDPKTNYMQFTVYETHKASPKVFIATFKSEDSIDLQFGRR 360
           ANFTFQDFEGLQHPDFLALVNDPKTNYMQFTVYETHKASPKVFIATFKSEDSIDLQFGRR
Sbjct: 301 ANFTFQDFEGLQHPDFLALVNDPKTNYMQFTVYETHKASPKVFIATFKSEDSIDLQFGRR 360

Query: 361 VAAFLLKLPKRVIWNSKACLQSKEEEEIEVKDFQRSF 397
           VAAFLLKLPKRVIWNSKACLQSKEEEEIEVKDFQRSF
Sbjct: 361 VAAFLLKLPKRVIWNSKACLQSKEEEEIEVKDFQRSF 397

>Scas_716.32
          Length = 509

 Score =  397 bits (1020), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 195/414 (47%), Positives = 267/414 (64%), Gaps = 23/414 (5%)

Query: 1   MKIGYFTPSERIEPSAVDAELEIFKKVGR-LDILLTKEWPKSVRSKLEEVSGTDTVDQLV 59
           ++IGY    E       D  LE FK V   +DIL+T+EW   +    + +SG+DT+D + 
Sbjct: 93  LRIGYIALEEAKCNELKDKILEKFKLVNAPIDILITREWSTHIAELKDRLSGSDTIDDVA 152

Query: 60  ISSKPQYHFA-TLGDKYFELEPFGWDRSSMPDITRFINLATFGSGEKWAYAFNITVGTD- 117
              +P+YHF  +  D +FEL PF W+      ++RFINLAT+GSG KWAYAFNI + TD 
Sbjct: 153 KLLQPRYHFTYSDNDTFFELNPFLWNEKE--SVSRFINLATYGSGSKWAYAFNIKIETDD 210

Query: 118 -----QEASVPTNLTTNPFIT---------MXXXXXXXXXXXXXXXXXXTKVLPAACHFC 163
                 E+++PTNL +NP+ T         +                   KVLP  CHFC
Sbjct: 211 DIEDEHESNLPTNLISNPYSTTNIKKRPMDLIDTDGQQVTKSSISLKKPRKVLPIDCHFC 270

Query: 164 LSNPSVEDHMVISIGKHSYLTIAKGPLSVPRGEMTFSGHCLIIPIDHVPKFNSASPDQTT 223
            +NP++EDHM+ISI   +Y+T AKGPL+VP+G+M F GHCLIIPI+H+PKFN+       
Sbjct: 271 FTNPNMEDHMIISIDDSAYMTTAKGPLTVPKGDMNFPGHCLIIPIEHIPKFNNVD----G 326

Query: 224 SAIMETEMGKEVMRYESALVNMNYKKFDMSTLVFEINSVNSVHFHKQVVPVPKYLIGSFT 283
            +  ET +GK+++ YE ++VNMNY+KFDMST+VFEINS  S+HFHKQV P+PKYLI  F 
Sbjct: 327 QSPFETPLGKDLLAYERSVVNMNYQKFDMSTIVFEINSERSIHFHKQVFPIPKYLIMKFN 386

Query: 284 TALDRQLHINNEKFKKNANFTFQDFEGLQHPDFLALVNDPKTNYMQFTVYETHKASPKVF 343
            +LDRQLH NNEK+ +NA   F+ FE      + A+V +   NY+QFTVYET    P ++
Sbjct: 387 ESLDRQLHFNNEKYSRNAKLNFEKFETTSDLRYEAIVKNSNMNYLQFTVYETPITEPAIY 446

Query: 344 IATFKSEDSIDLQFGRRVAAFLLKLPKRVIWNSKACLQSKEEEEIEVKDFQRSF 397
           ++ F+ +D +DLQFGRRV AFLL LP R+ W+S  C Q+KE+E I+V+ FQ+S+
Sbjct: 447 VSKFELDDRLDLQFGRRVVAFLLHLPNRLNWDSPTCQQTKEQEMIDVEKFQKSY 500

>KLLA0D14927g 1258177..1259700 similar to sp|P53255 Saccharomyces
           cerevisiae YGR093w singleton, start by similarity
          Length = 507

 Score =  396 bits (1017), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 190/409 (46%), Positives = 273/409 (66%), Gaps = 17/409 (4%)

Query: 1   MKIGYFTPSERIEPSAVDAELEIFKKVGR---LDILLTKEWPKSVRSKLEEVSGTDTVDQ 57
           +KIGY   + ++  SA    L+ F+++      DILL+ +W +++  +   + G   VDQ
Sbjct: 96  LKIGYLAETSKLSDSARAEVLKNFQELSEQTSADILLSYDWSEAISERENLILGNSLVDQ 155

Query: 58  LVISSKPQYHFATLGDK-YFELEPFGWDRSSMPDITRFINLATFGSGEKWAYAFNITVGT 116
           +    KP+YHF    +K +FEL+PF WD ++   I RFIN+A F SG KWAYAF I +  
Sbjct: 156 VASLMKPKYHFTGKNEKQFFELDPFVWDHTN-EHICRFINVAQFKSGSKWAYAFKINLLE 214

Query: 117 DQEASVPTNLTTNPFIT--------MXXXXXXXXXXXXXXXXXXTKVLPAACHFCLSNPS 168
             E ++P NL  NP++         +                   +VLP+ C FCLSN  
Sbjct: 215 GLE-TIPDNLIDNPYLEKPSGKRDLVPDPETDNSSAVSKKQRKPKQVLPSECRFCLSNTK 273

Query: 169 VEDHMVISIGKHSYLTIAKGPLSVPRGEMTFSGHCLIIPIDHVPKFNSASPDQTTSAIME 228
           + DHM+ISI K SY+TIAKGPL+ P  +M FSGHCLIIPI+H+PK N+A  +   + I +
Sbjct: 274 LNDHMIISISKFSYITIAKGPLTTPGNDMDFSGHCLIIPIEHIPKLNTAKQE---AVITD 330

Query: 229 TEMGKEVMRYESALVNMNYKKFDMSTLVFEINSVNSVHFHKQVVPVPKYLIGSFTTALDR 288
           T++ K++ ++E ++  MN+K++DMSTL+FEINS N++HFHKQ++PVPKYLIG+F +AL+R
Sbjct: 331 TDLFKDLNKFEESIAEMNFKRYDMSTLIFEINSSNAIHFHKQLIPVPKYLIGNFISALNR 390

Query: 289 QLHINNEKFKKNANFTFQDFEGLQHPDFLALVNDPKTNYMQFTVYETHKASPKVFIATFK 348
           Q+H+NNEKFK NA   F++FEG    ++L LVND +TNY QF + ET  + PKV+I+ F 
Sbjct: 391 QVHMNNEKFKSNAKLEFKEFEGFDDKEYLGLVNDHETNYFQFIIRETASSKPKVYISVFD 450

Query: 349 SEDSIDLQFGRRVAAFLLKLPKRVIWNSKACLQSKEEEEIEVKDFQRSF 397
            ++ IDLQFGRRVAAFLLK PKR +W+SK C Q+K++EE +V +FQR++
Sbjct: 451 KDERIDLQFGRRVAAFLLKQPKRTMWDSKVCFQTKQQEEKDVSNFQRAY 499

>YGR093W (YGR093W) [2053] chr7 (670390..671913) Member of the
           protein similar to CwfJ N-terminus 1 containing family
           and of the CwfJ N-terminus 2 containing family, has low
           similarity to uncharacterized C. albicans Orf6.6477p
           [1524 bp, 507 aa]
          Length = 507

 Score =  382 bits (981), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 181/396 (45%), Positives = 257/396 (64%), Gaps = 32/396 (8%)

Query: 22  EIFKKVGRLDILLTKEWPKSVRSKLEEVSGTDTVDQLVISSKPQYHFATLGD-KYFELEP 80
           E  K   ++DILLTKEW  S+  +   +SG++ VD+L    + +YHFA   +  ++ELEP
Sbjct: 114 EFGKSEDQVDILLTKEWGLSISERCGRLSGSEVVDELAKKLQARYHFAFSDEINFYELEP 173

Query: 81  FGWDRSSMPDITRFINLATFGSGEKWAYAFNITVGTDQ--EASVPTNLTTNPFITMXXXX 138
           F W+R  +   +RF+N+  +GSG+KWAYAFN+ +G ++  +   P NL  NP+ ++    
Sbjct: 174 FQWERERL---SRFLNIPKYGSGKKWAYAFNMPIGDNELKDEPEPPNLIANPYNSVVTNS 230

Query: 139 XXX-----------------XXXXXXXXXXXTKVLPAACHFCLSNPSVEDHMVISIGKHS 181
                                            +LP++CHFC SNP++EDHM+ISIGK  
Sbjct: 231 NKRPLETETENSFDGDKQVLANREKNENKKIRTILPSSCHFCFSNPNLEDHMIISIGKLV 290

Query: 182 YLTIAKGPLSVPRGEMTFSGHCLIIPIDHVPKFNSASPDQTTSAIMETEMGKEVMRYESA 241
           YLT AKGPLSVP+G+M  SGHCLIIPI+H+PK + +            E+ + ++ YE++
Sbjct: 291 YLTTAKGPLSVPKGDMDISGHCLIIPIEHIPKLDPSK---------NAELTQSILAYEAS 341

Query: 242 LVNMNYKKFDMSTLVFEINSVNSVHFHKQVVPVPKYLIGSFTTALDRQLHINNEKFKKNA 301
           LV MNY KFDM T+VFEI S  S+HFHKQV+PVPKYL+  F +ALDRQ+H NNEKF +NA
Sbjct: 342 LVKMNYIKFDMCTIVFEIQSERSIHFHKQVIPVPKYLVLKFCSALDRQVHFNNEKFTRNA 401

Query: 302 NFTFQDFEGLQHPDFLALVNDPKTNYMQFTVYETHKASPKVFIATFKSEDSIDLQFGRRV 361
              FQ ++      ++ ++N+   NY+QFTVYET +A PK+++ATF + ++IDLQFGRRV
Sbjct: 402 KLEFQCYDSHSSKQYVDVINNQSNNYLQFTVYETPEADPKIYLATFNASETIDLQFGRRV 461

Query: 362 AAFLLKLPKRVIWNSKACLQSKEEEEIEVKDFQRSF 397
            AFLL LP+RV WNS  CLQ+K++E IE + FQ+++
Sbjct: 462 LAFLLNLPRRVKWNSSTCLQTKQQETIEAEKFQKAY 497

>Kwal_23.3991
          Length = 357

 Score =  338 bits (866), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 162/355 (45%), Positives = 228/355 (64%), Gaps = 10/355 (2%)

Query: 48  EVSGTDTVDQLVISSKPQYHFATLGDKYF-ELEPFGWDRSSMPDITRFINLATFGSGEKW 106
           E S +  VD ++ ++ P+YHF+  G+  F E+ PF W  +S  D TR +NLA F SG KW
Sbjct: 4   EDSSSPIVDFVLTNTHPKYHFSATGNDTFQEIAPFKW--ASTNDTTRCLNLAQFDSGAKW 61

Query: 107 AYAFNITVGTDQEASVPTNLTTNPF---ITMXXXXXXXXXXXXXXXXXXTKVLPAACHFC 163
           AYAF +  G + +  +P  L  NP+   IT                    +VLP  C FC
Sbjct: 62  AYAFTVATGVNNQ-DIPQTLGKNPYEVEITNKRTHESENADNSRISKKPKQVLPEECRFC 120

Query: 164 LSNPSVEDHMVISIGKHSYLTIAKGPLSVPRGEMTFSGHCLIIPIDHVPKFNSASPDQTT 223
            SN S+EDH++ISIG+H+YLT AKGPL++P   M F GHCL+IPI H+PK  +     ++
Sbjct: 121 FSNSSIEDHLIISIGEHAYLTTAKGPLTLPTSNMNFPGHCLVIPIKHIPKMKARH--NSS 178

Query: 224 SAIMETEMGKEVMRYESALVNMNYKKFDMSTLVFEINSVNSVHFHKQVVPVPKYLIGSFT 283
           + +      +E  +YE A+  MN+ KF+M T+ FEINS NS+H+HKQ++PVPKYLI  F 
Sbjct: 179 ADLSYDPFWRESQKYEEAIAKMNFTKFEMGTVAFEINSENSIHYHKQIIPVPKYLINKFK 238

Query: 284 TALDRQLHINNEKFKKNANFTFQDFEGLQHPDFLALVNDPKTNYMQFTVYE-THKASPKV 342
           +AL+RQ+H NN K+  NA   FQ+F G     + +L+ND + NY+QF+VYE    A PK 
Sbjct: 239 SALERQVHFNNTKYTNNAQLEFQEFNGPNDEGYRSLINDYEQNYLQFSVYEGIDGAPPKT 298

Query: 343 FIATFKSEDSIDLQFGRRVAAFLLKLPKRVIWNSKACLQSKEEEEIEVKDFQRSF 397
           ++ATFK ++ IDLQFGRRV AF+L+LPKR  W+S AC Q+ E+E+ +V++FQ+ F
Sbjct: 299 YVATFKPDERIDLQFGRRVVAFVLRLPKRAKWDSPACRQTLEQEKNDVREFQKHF 353

>CAGL0G03069g 284268..285728 similar to sp|P53255 Saccharomyces
           cerevisiae YGR093w, hypothetical start
          Length = 486

 Score =  328 bits (840), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 171/403 (42%), Positives = 245/403 (60%), Gaps = 19/403 (4%)

Query: 3   IGYFTPSERIEPSAVDAELEIFKKVGR-LDILLTKEWPKSVRSKLE-EVSGTDTVDQLVI 60
           +GY T S+        + LE FK     +D+L+T    K+V S L+ + +G   +D+++ 
Sbjct: 87  VGYITLSKNSLQQEKKSILEYFKASKEFIDVLVTNIGSKAVASHLQYKANGNSIIDEVMK 146

Query: 61  SSKPQYHFATLGDK-YFELEPFGW-DRSSMPDITRFINLATFG--SGEKWAYAFNITVGT 116
             KPQYH    GD+ Y +++PF W + SS   ITR+ NL ++   +  KW  AF+I  G 
Sbjct: 147 HCKPQYHLTYDGDRGYHDMKPFCWGETSSDSQITRYYNLPSYSPITKSKWIVAFSIEPGK 206

Query: 117 D--QEASVPTNLTTNPFITMXXXXXXXXXXXXXXXXXXTKVLPAACHFCLSNPSVEDHMV 174
           D  +       L TNP++                    TK+    CHFC SNP+VED M+
Sbjct: 207 DFNEINDYKNELGTNPYLLKPALKRDRSGIEQNAHTKKTKIDSTTCHFCFSNPNVEDQMI 266

Query: 175 ISIGKHSYLTIAKGPLSVPRGEMTFSGHCLIIPIDHVPKFNSASPDQTTSAIMETEMGKE 234
           ++I KHSYLT+AKGPL+VP+G+M+FSGH LI PI+HV K + +         ++ E+ KE
Sbjct: 267 VAIAKHSYLTLAKGPLTVPKGDMSFSGHALITPINHVAKIDKS---------LDNELSKE 317

Query: 235 VMRYESALVNMNYKKFDMSTLVFEINSVNSVHFHKQVVPVPKYLIGSFTTALDRQLHINN 294
           +  +ES +  MNYK FD ST+VFEI S  ++HFHKQV+PVPKYLI  F  ALDRQ+HIN+
Sbjct: 318 IELFESRVAKMNYKLFDCSTVVFEIQSDKAIHFHKQVIPVPKYLITKFERALDRQVHINS 377

Query: 295 EKFKKNANFTFQDFEGLQHPDFLALVNDPKTNYMQFTVYETHKASPKVFIATFKSEDSID 354
           E  + N    F+ F+GL + ++  +V    TNY+QFT+YET  +   ++I++F   + +D
Sbjct: 378 E--RGNCKLEFEKFDGLDNEEYRKIVGRKDTNYLQFTIYETDTSKATIYISSFDITERLD 435

Query: 355 LQFGRRVAAFLLKLPKRVIWNSKACLQSKEEEEIEVKDFQRSF 397
           LQ+GRR  AF+L LPKRV WNS  C QSKE+E  E + +Q+SF
Sbjct: 436 LQYGRRTLAFVLNLPKRVQWNSPICQQSKEQELKEAQLYQKSF 478

>Sklu_1641.1 YBL098W, Contig c1641 1163-2551
          Length = 462

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 28/50 (56%), Gaps = 4/50 (8%)

Query: 295 EKFKKNANFTFQDFEGLQHPDFLALVNDPKTNYMQFTVYETHKASPKVFI 344
           +K+K +    F ++   +H D +A+++  K NY +     +HK + K+F+
Sbjct: 339 DKYKGDRQRAFDEYSHSRHEDLVAIIDLAKNNYKEM----SHKVTSKLFL 384

>YER151C (UBP3) [1580] chr5 complement(469681..472419)
           Ubiquitin-specific protease, ubiquitin C-terminal
           hydrolase [2739 bp, 912 aa]
          Length = 912

 Score = 28.9 bits (63), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 51/106 (48%), Gaps = 19/106 (17%)

Query: 270 QVVPVP--KYLIGSFTTALDRQLHINNEKFKKNANFTFQDFEGLQHPDFLALVNDPKTNY 327
           ++VP P  K   G F + LD    I N K  ++ + T   F+ +Q     A VND +T +
Sbjct: 691 EIVPSPISKLFGGQFRSVLD----IPNNK--ESQSITLDPFQTIQLDISDAGVNDLETAF 744

Query: 328 MQFTVYETHKASPKVFIATFKSEDSIDLQFGRRVAAFLLKLPKRVI 373
            +F+ YE         +  FKS    D++  ++   F+ KLP+ ++
Sbjct: 745 KKFSEYE---------LLPFKSSSGNDVEAKKQT--FIDKLPQVLL 779

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.134    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,725,482
Number of extensions: 534352
Number of successful extensions: 1337
Number of sequences better than 10.0: 15
Number of HSP's gapped: 1332
Number of HSP's successfully gapped: 16
Length of query: 397
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 293
Effective length of database: 12,995,837
Effective search space: 3807780241
Effective search space used: 3807780241
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 63 (28.9 bits)