Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADR032W4392768791e-114
Sklu_2401.74731862053e-17
KLLA0D14883g4671821725e-13
Kwal_23.39954741871361e-08
YGR091W (PRP31)4941931191e-06
Scas_716.34479531032e-04
CAGL0A04015g50829673.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADR032W
         (431 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADR032W [1773] [Homologous to ScYGR091W (PRP31) - SH] complement...   343   e-114
Sklu_2401.7 YGR091W, Contig c2401 14483-15904                          84   3e-17
KLLA0D14883g 1254381..1255784 some similarities with sp|P49704 S...    71   5e-13
Kwal_23.3995                                                           57   1e-08
YGR091W (PRP31) [2051] chr7 (666343..667827) Protein required fo...    50   1e-06
Scas_716.34                                                            44   2e-04
CAGL0A04015g complement(397378..398904) similar to sp|Q12460 Sac...    30   3.3  

>ADR032W [1773] [Homologous to ScYGR091W (PRP31) - SH]
           complement(763163..764482) [1320 bp, 439 aa]
          Length = 439

 Score =  343 bits (879), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 191/276 (69%), Positives = 191/276 (69%)

Query: 1   MDLLEGLDDPPSPQDAHVSAAEGAVGALQQRLHALLQCDXXXXXXXXXXXXXXXXXXXXX 60
           MDLLEGLDDPPSPQDAHVSAAEGAVGALQQRLHALLQCD                     
Sbjct: 1   MDLLEGLDDPPSPQDAHVSAAEGAVGALQQRLHALLQCDPRSRPSALPLLPELHEALAAG 60

Query: 61  XXXXXXXXXXXPVLRDEAADVYRQLEARYRPVFPELAELVPSQRTYVRVLRALETGAPLD 120
                      PVLRDEAADVYRQLEARYRPVFPELAELVPSQRTYVRVLRALETGAPLD
Sbjct: 61  QLDLGTLGQLLPVLRDEAADVYRQLEARYRPVFPELAELVPSQRTYVRVLRALETGAPLD 120

Query: 121 ELLTREQAMLVAMTRPQAPRADPARWPRELAPHADRHEQLHTAVDAIDAHIVRQAHRLXX 180
           ELLTREQAMLVAMTRPQAPRADPARWPRELAPHADRHEQLHTAVDAIDAHIVRQAHRL  
Sbjct: 121 ELLTREQAMLVAMTRPQAPRADPARWPRELAPHADRHEQLHTAVDAIDAHIVRQAHRLAP 180

Query: 181 XXXXXXXXXXXXXXXSHAGSVRELAQVPACNLXXXXXXXXXXXXXXXXXSGVRLRGHVWD 240
                          SHAGSVRELAQVPACNL                 SGVRLRGHVWD
Sbjct: 181 TVTALVGPVVAAALLSHAGSVRELAQVPACNLAAIGAPRHAAHARRTDASGVRLRGHVWD 240

Query: 241 TPLVQEQPPXXXXXXXXXXXXXXXXXXXVDASAPDP 276
           TPLVQEQPP                   VDASAPDP
Sbjct: 241 TPLVQEQPPALQRQALRMLCARLALAARVDASAPDP 276

>Sklu_2401.7 YGR091W, Contig c2401 14483-15904
          Length = 473

 Score = 83.6 bits (205), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 87/186 (46%), Gaps = 8/186 (4%)

Query: 72  PVLRDEAADVYRQLEARYRPVFPELAELVPSQRTYVRVLRALETG-----APLDELLTRE 126
           PV++ E A ++  +++ Y   F EL  LV   R+Y ++++ LET      + L+ +L++E
Sbjct: 100 PVIQSELALLHNYIKSLYSKKFSELDSLVNPPRSYSKLIKFLETSDARDLSTLEGILSKE 159

Query: 127 QAMLVAMTRPQAPRAD---PARWPRELAPHADRHEQLHTAVDAIDAHIVRQAHRLXXXXX 183
           Q ++V+M+     + D   P+     L    D   QL+   D I + I  Q   +     
Sbjct: 160 QILIVSMSMKTGFKRDLALPSDEKTYLLTAIDMLIQLYDLQDEITSFIASQVINIAPNVC 219

Query: 184 XXXXXXXXXXXXSHAGSVRELAQVPACNLXXXXXXXXXXXXXXXXXSGVRLRGHVWDTPL 243
                       S AG + EL+QVP+CNL                 SGVR RG+V+   L
Sbjct: 220 AIVGPQVASKILSAAGGLLELSQVPSCNLASIGKDRYMSHEINTDMSGVRQRGYVYSCSL 279

Query: 244 VQEQPP 249
           +Q+QPP
Sbjct: 280 IQDQPP 285

>KLLA0D14883g 1254381..1255784 some similarities with sp|P49704
           Saccharomyces cerevisiae YGR091w PRP31 pre-mRNA splicing
           protein, hypothetical start
          Length = 467

 Score = 70.9 bits (172), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 89/182 (48%), Gaps = 6/182 (3%)

Query: 72  PVLRDEAADVYRQLEARYRPVFPELAELVPSQRTYVRVLRALETGAP---LDELLTREQA 128
           P+   E + V++ +   Y+  FP L  +VP ++ YV V++ L+   P   LD++L++E+ 
Sbjct: 97  PLFDTELSMVFQCIVDTYKAKFPGLETIVPERKQYVDVVKMLQQDIPNVQLDQVLSKEET 156

Query: 129 MLVAMTRPQAPRADPARWPRELAPHADR-HEQLHTAVDAIDAHIVRQAHRLXXXXXXXXX 187
           ++V+M+  +    + AR  ++L   A    + L+   D +  ++  +   +         
Sbjct: 157 LVVSMSL-KTDFKEGARIDKDLLSKAIHWFDILYNLRDNVSHYVETRIQMVAPNLCALLG 215

Query: 188 XXXXXXXXSHAGSVRELAQVPACNLXXXXXXXXXXXXXXXXXSGVRLRGHVWDTPLVQEQ 247
                   +H GSV+EL+ VP+CNL                 SGVR +G+++ T +VQ Q
Sbjct: 216 PDTAAKLVTHCGSVKELSVVPSCNL-ASIGQDKTLHGKSLDISGVRQKGYLFYTDVVQTQ 274

Query: 248 PP 249
           PP
Sbjct: 275 PP 276

>Kwal_23.3995
          Length = 474

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 81/187 (43%), Gaps = 10/187 (5%)

Query: 72  PVLRDEAADVYRQLEARYRPVFPELAELVPSQRTYVRVLRALETG-------APLDELLT 124
           P++ +E   + + +   Y   FPEL  L+ S + Y +V++ LET          L+++++
Sbjct: 94  PIVLEEMGLLQKLMAKIYERRFPELQSLMTSPKGYAQVVKHLETSDINEGNLRGLEDIIS 153

Query: 125 REQAMLVAMTRPQAPRAD---PARWPRELAPHADRHEQLHTAVDAIDAHIVRQAHRLXXX 181
           +E  ++++M      + D    A   R +   AD   +L    D I+ ++      +   
Sbjct: 154 KEHFLVLSMAMHTGFKQDVPLTAEDSRLVIQTADVLLELCDIRDKIERYVASLVSDVAPN 213

Query: 182 XXXXXXXXXXXXXXSHAGSVRELAQVPACNLXXXXXXXXXXXXXXXXXSGVRLRGHVWDT 241
                         + AG + EL+++P+CNL                 SGVR +G+++ +
Sbjct: 214 LCILVGSQIAASLIAVAGGLSELSEIPSCNLSSIGKTKNSSHTSDTDASGVRQKGYIYQS 273

Query: 242 PLVQEQP 248
            LV  QP
Sbjct: 274 DLVSGQP 280

>YGR091W (PRP31) [2051] chr7 (666343..667827) Protein required for
           pre-mRNA splicing, associated with U4/U6.U5 tri-snRNP
           [1485 bp, 494 aa]
          Length = 494

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 80/193 (41%), Gaps = 16/193 (8%)

Query: 72  PVLRDEAADVYRQLEARYRPVFPELAELVPSQRTYVRVLRALE----TGAPLDEL----- 122
           P+++     ++  L + Y   FPEL+ L+PS   Y +V+  LE    +    DEL     
Sbjct: 103 PLIKSNIKLMHNFLISLYSRRFPELSSLIPSPLQYSKVISILENENYSKNESDELFFHLE 162

Query: 123 ----LTREQAMLVAMT-RPQAPRADP--ARWPRELAPHADRHEQLHTAVDAIDAHIVRQA 175
               LTREQ +++ M+ +      +P   +   ++       E L    + I  +I  + 
Sbjct: 163 NKAKLTREQILVLTMSMKTSFKNKEPLDIKTRTQILEANSILENLWKLQEDIGQYIASKI 222

Query: 176 HRLXXXXXXXXXXXXXXXXXSHAGSVRELAQVPACNLXXXXXXXXXXXXXXXXXSGVRLR 235
             +                 +HAG V E +++P+CN+                 SGVR  
Sbjct: 223 SIIAPNVCFLVGPEIAAQLIAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQE 282

Query: 236 GHVWDTPLVQEQP 248
           G+++ + ++Q+ P
Sbjct: 283 GYLFASDMIQKFP 295

>Scas_716.34
          Length = 479

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%)

Query: 196 SHAGSVRELAQVPACNLXXXXXXXXXXXXXXXXXSGVRLRGHVWDTPLVQEQP 248
           +H G + +LA++P+CNL                 SGVR  G+++ + LVQ QP
Sbjct: 258 AHTGGILQLAEIPSCNLASIGKNRHLSHELHTTLSGVRQEGYIYSSELVQNQP 310

>CAGL0A04015g complement(397378..398904) similar to sp|Q12460
           Saccharomyces cerevisiae YLR197w SIK1 involved in
           pre-rRNA processing, hypothetical start
          Length = 508

 Score = 30.4 bits (67), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 20/29 (68%)

Query: 93  FPELAELVPSQRTYVRVLRALETGAPLDE 121
           FPELA+LVP   T+ +++  ++  A L+E
Sbjct: 201 FPELAKLVPDNYTFAKLVLFIKDKASLNE 229

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.133    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,937,845
Number of extensions: 146449
Number of successful extensions: 320
Number of sequences better than 10.0: 7
Number of HSP's gapped: 310
Number of HSP's successfully gapped: 8
Length of query: 431
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 327
Effective length of database: 12,995,837
Effective search space: 4249638699
Effective search space used: 4249638699
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 63 (28.9 bits)