Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADR021W1761739271e-130
Sklu_2248.31771745812e-77
CAGL0K08800g1751745492e-72
YMR009W1791745474e-72
Kwal_55.208131751735459e-72
KLLA0D14487g1761735371e-70
Scas_717.251781755302e-69
YDR386W (MUS81)63252661.0
AFR440C53265651.3
Kwal_14.14028656601.9
Kwal_33.1428229757622.8
KLLA0E24486g64553623.7
KLLA0F27643g47829596.7
AAR129C37539588.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADR021W
         (173 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADR021W [1762] [Homologous to ScYMR009W - SH] complement(743305....   361   e-130
Sklu_2248.3 YMR009W, Contig c2248 7331-7864                           228   2e-77
CAGL0K08800g 883045..883572 similar to sp|Q03677 Saccharomyces c...   216   2e-72
YMR009W (YMR009W) [3973] chr13 (284101..284640) Member of the ac...   215   4e-72
Kwal_55.20813                                                         214   9e-72
KLLA0D14487g 1229115..1229645 similar to sp|Q03677 Saccharomyces...   211   1e-70
Scas_717.25                                                           208   2e-69
YDR386W (MUS81) [1214] chr4 (1246072..1247970) Protein involved ...    30   1.0  
AFR440C [3632] [Homologous to ScYML086C (ALO1) - SH] (1229973..1...    30   1.3  
Kwal_14.1402                                                           28   1.9  
Kwal_33.14282                                                          28   2.8  
KLLA0E24486g complement(2173560..2175497) similar to sp|P15179 S...    28   3.7  
KLLA0F27643g complement(2561213..2562649) similar to sp|P40034 S...    27   6.7  
AAR129C [316] [Homologous to ScYDR415C - SH] (572293..573420) [1...    27   8.6  

>ADR021W [1762] [Homologous to ScYMR009W - SH]
           complement(743305..743835) [531 bp, 176 aa]
          Length = 176

 Score =  361 bits (927), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 173/173 (100%), Positives = 173/173 (100%)

Query: 1   MVEAYVHDNNTHVDCRAPHHSGKSVSLERLASLGVFYRHCRSQDEVDAVACARHYSNRDE 60
           MVEAYVHDNNTHVDCRAPHHSGKSVSLERLASLGVFYRHCRSQDEVDAVACARHYSNRDE
Sbjct: 1   MVEAYVHDNNTHVDCRAPHHSGKSVSLERLASLGVFYRHCRSQDEVDAVACARHYSNRDE 60

Query: 61  VTISPASFPSEDAFRDKLAVFYTEHLHEDEEIRYALAGEGYFDLRDATTGDWIRVKLTTG 120
           VTISPASFPSEDAFRDKLAVFYTEHLHEDEEIRYALAGEGYFDLRDATTGDWIRVKLTTG
Sbjct: 61  VTISPASFPSEDAFRDKLAVFYTEHLHEDEEIRYALAGEGYFDLRDATTGDWIRVKLTTG 120

Query: 121 DLLIVPAGIYHRFTVTESNFIRAQRLFKDEPKWQAFNRPEGDARPVHKEYLAS 173
           DLLIVPAGIYHRFTVTESNFIRAQRLFKDEPKWQAFNRPEGDARPVHKEYLAS
Sbjct: 121 DLLIVPAGIYHRFTVTESNFIRAQRLFKDEPKWQAFNRPEGDARPVHKEYLAS 173

>Sklu_2248.3 YMR009W, Contig c2248 7331-7864
          Length = 177

 Score =  228 bits (581), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 136/174 (78%), Gaps = 1/174 (0%)

Query: 1   MVEAYVHDNNTHVDCRAPHHSGKSVSLERLASLGVFYRHCRSQDEVDAVACARHYSNRDE 60
           MV+ Y HDNN  VD R PH++G+ +SL+RL  +GVFYRH ++Q EVD +A  R+Y NRD 
Sbjct: 1   MVQVYYHDNNDAVDFRQPHNTGREISLQRLEKIGVFYRHFKTQQEVDELARERNYKNRDI 60

Query: 61  VTISPASFPS-EDAFRDKLAVFYTEHLHEDEEIRYALAGEGYFDLRDATTGDWIRVKLTT 119
           V+IS  SF + E+A  +KL VFY+EHLHEDEEIRY L G GYFD+RDA + +WIR K+  
Sbjct: 61  VSISKESFGNDENAMIEKLKVFYSEHLHEDEEIRYCLDGTGYFDVRDAESDEWIRCKVEP 120

Query: 120 GDLLIVPAGIYHRFTVTESNFIRAQRLFKDEPKWQAFNRPEGDARPVHKEYLAS 173
           GDLLI+PAGIYHRFT+T+ N+I+A RLFK+EPKW A+NRP+ D+ P  +EYL+S
Sbjct: 121 GDLLILPAGIYHRFTLTDDNYIKALRLFKEEPKWLAYNRPDADSNPTREEYLSS 174

>CAGL0K08800g 883045..883572 similar to sp|Q03677 Saccharomyces
           cerevisiae YMR009w, start by similarity
          Length = 175

 Score =  216 bits (549), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 127/174 (72%), Gaps = 1/174 (0%)

Query: 1   MVEAYVHDNNTHVDCRAPHHSGKSVSLERLASLGVFYRHCRSQDEVDAVACARHYSNRDE 60
           MVE YVHD N  VD R PH+SGK+V+LE L  +GV Y+H   Q +VD +A  R+Y NRD 
Sbjct: 1   MVEIYVHDENDSVDFRQPHNSGKTVALEDLGKIGVIYKHIADQADVDILAKERNYKNRDI 60

Query: 61  VTISPASFPSE-DAFRDKLAVFYTEHLHEDEEIRYALAGEGYFDLRDATTGDWIRVKLTT 119
           VTI+  +F  + +A   +L +FY EHLHEDEEIRY + G GYFD+R+     W+R K+  
Sbjct: 61  VTINVDTFKGDKNALEKQLGIFYKEHLHEDEEIRYCIEGSGYFDVRNGKDDVWVRCKVGP 120

Query: 120 GDLLIVPAGIYHRFTVTESNFIRAQRLFKDEPKWQAFNRPEGDARPVHKEYLAS 173
           GDLLI+PAGIYHRFT+TE+N I+A RLFKDEPKWQA+NRP+ D+ PV  EYL S
Sbjct: 121 GDLLILPAGIYHRFTLTETNHIKALRLFKDEPKWQAYNRPDADSLPVRHEYLQS 174

>YMR009W (YMR009W) [3973] chr13 (284101..284640) Member of the
           acireductone dioxygenase family, has high similarity to
           uncharacterized C. albicans Orf6.5544p [540 bp, 179 aa]
          Length = 179

 Score =  215 bits (547), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 128/174 (73%), Gaps = 2/174 (1%)

Query: 1   MVEAYVHDNNTHVDCRAPHHSGKSVSLERLASLGVFYRHCRSQDEVDAVACARHYSNRDE 60
           MV+ Y+HDN    D RAPH+SG  +SL+ LA LGV Y++C +++EV+ +A  R Y NRD 
Sbjct: 1   MVKVYIHDNKVDSDYRAPHNSGTELSLDELAKLGVIYKYCANEEEVNEIARQREYKNRDV 60

Query: 61  VTISPASFPSEDAFRDKLAVFYTEHLHEDEEIRYALAGEGYFDLRDATTG-DWIRVKLTT 119
           V I   SF SE  F +KLA FY EHLHEDEEIRY L G GYFD+RDA+T  +WIR  + +
Sbjct: 61  VNICEGSFKSEAEFNEKLATFYQEHLHEDEEIRYCLEGAGYFDVRDASTPENWIRCLVES 120

Query: 120 GDLLIVPAGIYHRFTVTESNFIRAQRLFKDEPKWQAFNRP-EGDARPVHKEYLA 172
           GDLLI+P GIYHRFT+T SN I+A RLFKDEPKWQA NR  + D+ PV K+Y+A
Sbjct: 121 GDLLILPPGIYHRFTLTTSNHIKALRLFKDEPKWQAINRSNQADSLPVRKDYIA 174

>Kwal_55.20813
          Length = 175

 Score =  214 bits (545), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 102/173 (58%), Positives = 125/173 (72%), Gaps = 2/173 (1%)

Query: 1   MVEAYVHDNNTHVDCRAPHHSGKSVSLERLASLGVFYRHCRSQDEVDAVACARHYSNRDE 60
           MVEAY HDN+  VD R PHHSG+++SL++LA +GVFY++C SQ +VD VA  R Y NRD 
Sbjct: 1   MVEAYYHDNDDTVDFREPHHSGETLSLDQLAKIGVFYKYCPSQAQVDEVATERDYKNRDT 60

Query: 61  VTISPASFPSEDAFRDKLAVFYTEHLHEDEEIRYALAGEGYFDLRDATTGDWIRVKLTTG 120
           V IS  +    DA   KL  FY EHLHEDEEIRY + GEG+FD+R+     W+R KL  G
Sbjct: 61  VQISQETL--GDALLPKLQTFYAEHLHEDEEIRYIIDGEGFFDVRNEPNDRWVRCKLVPG 118

Query: 121 DLLIVPAGIYHRFTVTESNFIRAQRLFKDEPKWQAFNRPEGDARPVHKEYLAS 173
           DLLI+PAGIYHRFT+T  N+++A RLFKDEPKW A  RP  D  P+ +EYLAS
Sbjct: 119 DLLILPAGIYHRFTLTSKNYVKALRLFKDEPKWVAHGRPIADDLPIRREYLAS 171

>KLLA0D14487g 1229115..1229645 similar to sp|Q03677 Saccharomyces
           cerevisiae YMR009w singleton, start by similarity
          Length = 176

 Score =  211 bits (537), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 98/173 (56%), Positives = 124/173 (71%)

Query: 1   MVEAYVHDNNTHVDCRAPHHSGKSVSLERLASLGVFYRHCRSQDEVDAVACARHYSNRDE 60
           MV+AY+HDN++ VD R  H +GK VSLE+L  +G+ YR   +Q+EVD  A  R Y NRD 
Sbjct: 1   MVKAYIHDNDSSVDFREDHDTGKPVSLEKLEQIGLIYRKFDTQEEVDQFAQDRDYKNRDI 60

Query: 61  VTISPASFPSEDAFRDKLAVFYTEHLHEDEEIRYALAGEGYFDLRDATTGDWIRVKLTTG 120
           V I+  SFP E+    KL VFY EHLHEDEEIRY L GEG+FD+RD  T +WIR ++  G
Sbjct: 61  VNITVNSFPDEETMISKLNVFYAEHLHEDEEIRYCLDGEGFFDVRDPFTEEWIRCRVQKG 120

Query: 121 DLLIVPAGIYHRFTVTESNFIRAQRLFKDEPKWQAFNRPEGDARPVHKEYLAS 173
           DLL++PAGIYHRFT+T  N+I+A RLFK+EPKW A+NRP+ D     +EYL  
Sbjct: 121 DLLVLPAGIYHRFTLTSDNYIKALRLFKEEPKWLAYNRPDADDNRYRQEYLTQ 173

>Scas_717.25
          Length = 178

 Score =  208 bits (530), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 99/175 (56%), Positives = 127/175 (72%), Gaps = 2/175 (1%)

Query: 1   MVEAYVHDNNTHVDCRAPHHSGKSVSLERLASLGVFYRHCRSQDEVDAVACARHYSNRDE 60
           MVEAYVHDN+  +D R PH+SG +VSLERLA LG+  ++    D+V+ +A  R+Y NRD 
Sbjct: 1   MVEAYVHDNDNKIDFREPHNSGVAVSLERLAKLGIVAKYLEKIDDVELLAKERNYKNRDT 60

Query: 61  VTISPASFPS-EDAFRDKLAVFYTEHLHEDEEIRYALAGEGYFDLRDATTGDWIRVKLTT 119
           V +S  +F + E    ++L +FY EHLHEDEEIRY + G GYFD++D  T +WIR K++ 
Sbjct: 61  VKLSKKTFNNDETLLLNQLNIFYQEHLHEDEEIRYCIEGSGYFDIKDTFTNEWIRCKVSP 120

Query: 120 GDLLIVPAGIYHRFTVTESNFIRAQRLFKDEPKWQAFNRP-EGDARPVHKEYLAS 173
           GDLLIVPAGIYHRFT+T  NFI+A RLFKDEPKWQA N+  + D   V K+YL S
Sbjct: 121 GDLLIVPAGIYHRFTLTTDNFIKALRLFKDEPKWQAHNKSGDTDQTSVRKQYLQS 175

>YDR386W (MUS81) [1214] chr4 (1246072..1247970) Protein involved in
           repair of DNA damage, part of a complex with Rad54p and
           Mms4p [1899 bp, 632 aa]
          Length = 632

 Score = 30.0 bits (66), Expect = 1.0,   Method: Composition-based stats.
 Identities = 15/52 (28%), Positives = 25/52 (48%), Gaps = 5/52 (9%)

Query: 38  RHCRSQDEVDAV-----ACARHYSNRDEVTISPASFPSEDAFRDKLAVFYTE 84
           R C S + V+ +       + HYS +D + I P+   S+D ++  L  F  E
Sbjct: 476 RTCNSDETVEKIHALHTVISHHYSQKDLIVIFPSDLKSKDDYKKVLLQFRRE 527

>AFR440C [3632] [Homologous to ScYML086C (ALO1) - SH]
          (1229973..1231571) [1599 bp, 532 aa]
          Length = 532

 Score = 29.6 bits (65), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 27/65 (41%), Gaps = 5/65 (7%)

Query: 36 FYRHCRSQDEVDAVACARHYSNRDEVTISPASFPSEDAFRDKLAVFY-----TEHLHEDE 90
           Y   RS+DEV A+  A     R  VT+     PS+    D   V          L EDE
Sbjct: 31 LYFQPRSEDEVVAIVRAAREQGRTIVTVGSGHSPSDMCATDDWMVNLDRLNGVLELQEDE 90

Query: 91 EIRYA 95
          + RYA
Sbjct: 91 QGRYA 95

>Kwal_14.1402
          Length = 86

 Score = 27.7 bits (60), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 119 TGDLLIVPAGIYHRFTVTESNFIRAQRL-FKDEPKWQAFNRPEGDAR-PVHKEYLA 172
           + D L+   G+Y + TV ++   R   L FKD+ KW A+   +G ++    ++Y+A
Sbjct: 21  SNDELLKLYGLYKQATVGDNTSARPSALNFKDKYKWDAWEELKGTSQEEAEQKYIA 76

>Kwal_33.14282
          Length = 297

 Score = 28.5 bits (62), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 26/57 (45%), Gaps = 3/57 (5%)

Query: 111 DWIRVKLTTGDLLIVPAGIYHRFTVTESN---FIRAQRLFKDEPKWQAFNRPEGDAR 164
           +W  V+   GDL+++   + H+  V  S    F  A  L +DE  +   N  + D +
Sbjct: 237 EWTSVECKAGDLVLIHGSVLHKSEVNHSKRSRFAYAFHLIEDEATYDKLNWLQSDIK 293

>KLLA0E24486g complement(2173560..2175497) similar to sp|P15179
           Saccharomyces cerevisiae YPL104w MSD1 aspartate--tRNA
           ligase, mitochondrial, start by similarity
          Length = 645

 Score = 28.5 bits (62), Expect = 3.7,   Method: Composition-based stats.
 Identities = 14/53 (26%), Positives = 28/53 (52%), Gaps = 5/53 (9%)

Query: 18  PHHSGKSVSLERLASLGVFYRHCRSQDEVDAVACARHYSNRDEVTISPASFPS 70
           P H+G ++  +R+ ++      C S+   D +A  +  S  D+V  SP++ P+
Sbjct: 587 PPHAGFAIGFDRMCAM-----LCGSESIRDVIAFPKSISGVDKVVGSPSTVPA 634

>KLLA0F27643g complement(2561213..2562649) similar to sp|P40034
           Saccharomyces cerevisiae YER051w singleton, start by
           similarity
          Length = 478

 Score = 27.3 bits (59), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 17/29 (58%)

Query: 113 IRVKLTTGDLLIVPAGIYHRFTVTESNFI 141
           I ++LT G+L ++P G  H     E +FI
Sbjct: 351 IAMELTEGNLFMIPCGYIHAVYTPEDSFI 379

>AAR129C [316] [Homologous to ScYDR415C - SH] (572293..573420) [1128
           bp, 375 aa]
          Length = 375

 Score = 26.9 bits (58), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 23/39 (58%)

Query: 66  ASFPSEDAFRDKLAVFYTEHLHEDEEIRYALAGEGYFDL 104
           ++ P E   R +    Y   + E+E++ YAL+G+ +FD+
Sbjct: 14  SALPLEGRRRLQFNETYIADVTEEEKLAYALSGKSFFDI 52

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.135    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,126,092
Number of extensions: 253644
Number of successful extensions: 474
Number of sequences better than 10.0: 14
Number of HSP's gapped: 469
Number of HSP's successfully gapped: 14
Length of query: 173
Length of database: 16,596,109
Length adjustment: 95
Effective length of query: 78
Effective length of database: 13,307,399
Effective search space: 1037977122
Effective search space used: 1037977122
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 58 (26.9 bits)