Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL330W27627113420.0
Kwal_27.126133112637681e-102
Sklu_2286.33382947445e-98
KLLA0B09592g3332516775e-88
CAGL0K12254g3352806238e-80
YBR105C (VID24)3622836222e-79
Scas_718.43562186073e-77
YGR066C2922093162e-34
Scas_667.273322123121e-33
YGR002C47677652.7
CAGL0G02343g32344634.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL330W
         (271 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL330W [1411] [Homologous to ScYBR105C (VID24) - SH] complement...   521   0.0  
Kwal_27.12613                                                         300   e-102
Sklu_2286.3 YBR105C, Contig c2286 2431-3447 reverse complement        291   5e-98
KLLA0B09592g 834414..835415 weakly similar to sp|P38263 Saccharo...   265   5e-88
CAGL0K12254g complement(1196376..1197383) similar to sp|P38263 S...   244   8e-80
YBR105C (VID24) [294] chr2 complement(450838..451926) Protein re...   244   2e-79
Scas_718.4                                                            238   3e-77
YGR066C (YGR066C) [2028] chr7 complement(620923..621801) Protein...   126   2e-34
Scas_667.27                                                           124   1e-33
YGR002C (SWC4) [1973] chr7 complement(498478..499908) Essential ...    30   2.7  
CAGL0G02343g complement(206880..207851) similar to sp|P36164 Sac...    29   4.0  

>ADL330W [1411] [Homologous to ScYBR105C (VID24) - SH]
           complement(121954..122784) [831 bp, 276 aa]
          Length = 276

 Score =  521 bits (1342), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/271 (92%), Positives = 251/271 (92%)

Query: 1   MINETRSAKXXXXXXXXXXXLFRCGSGESLASAWTADTSAGCSPCARKYMAXXXXXXXXX 60
           MINETRSAK           LFRCGSGESLASAWTADTSAGCSPCARKYMA         
Sbjct: 1   MINETRSAKGTAPATPAGTGLFRCGSGESLASAWTADTSAGCSPCARKYMAGLGGGGGGG 60

Query: 61  KAAPRATTTTNWLRPLMAFQGYQISGYKKYQVHVLLQTVALPTKGCATATTPHVTGFLTI 120
           KAAPRATTTTNWLRPLMAFQGYQISGYKKYQVHVLLQTVALPTKGCATATTPHVTGFLTI
Sbjct: 61  KAAPRATTTTNWLRPLMAFQGYQISGYKKYQVHVLLQTVALPTKGCATATTPHVTGFLTI 120

Query: 121 RGLTNQHPEITTFFESFAVNDTVGFLSSSMPPELAEYKSSDRVDLEHWLNFPSFKELCMA 180
           RGLTNQHPEITTFFESFAVNDTVGFLSSSMPPELAEYKSSDRVDLEHWLNFPSFKELCMA
Sbjct: 121 RGLTNQHPEITTFFESFAVNDTVGFLSSSMPPELAEYKSSDRVDLEHWLNFPSFKELCMA 180

Query: 181 GGGTTVADIMDGHYTHRDYLARRFVFMRWKEKFLVPDEEVGAVEGASYDGYYYIVHDQVT 240
           GGGTTVADIMDGHYTHRDYLARRFVFMRWKEKFLVPDEEVGAVEGASYDGYYYIVHDQVT
Sbjct: 181 GGGTTVADIMDGHYTHRDYLARRFVFMRWKEKFLVPDEEVGAVEGASYDGYYYIVHDQVT 240

Query: 241 GSVLGFYYHKDAEKFQQLELTPVYPDRQGVC 271
           GSVLGFYYHKDAEKFQQLELTPVYPDRQGVC
Sbjct: 241 GSVLGFYYHKDAEKFQQLELTPVYPDRQGVC 271

>Kwal_27.12613
          Length = 311

 Score =  300 bits (768), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 153/263 (58%), Positives = 185/263 (70%), Gaps = 12/263 (4%)

Query: 21  LFRCGSGESLASAWTADTSAGCSPCA-RKYMAXXXXXXXXXKAAPRA------TTTTNWL 73
           L+RC S +S+ S     T +G S  A RKY+A           A RA      T  TN+L
Sbjct: 44  LYRCSSVDSVDSLRHTFTPSGVSSAATRKYIAEDRSRYESRARARRAARRAPHTCCTNFL 103

Query: 74  RPLMAFQGYQISGYKKYQVHVLLQTVALPTKGCATATTPHVTGFLTIRGLTNQHPEITTF 133
           RP M F GYQIS YKKYQV V LQTVALP    ++A  PHVTGFL+IRGLT+QHPEITTF
Sbjct: 104 RPRMQFSGYQISDYKKYQVTVSLQTVALPDAPGSSAMAPHVTGFLSIRGLTSQHPEITTF 163

Query: 134 FESFAVNDTVGFLSSSMPPELAEYKSSDRVDLEHWLNFPSFKELCMA-----GGGTTVAD 188
           F+ +AV D +GFLSS++PPEL  +K++D+ DLEHWL+FP FKELC        G   +  
Sbjct: 164 FDGYAVTDNLGFLSSALPPELDAFKATDKTDLEHWLSFPCFKELCRPESACDEGTNVLGA 223

Query: 189 IMDGHYTHRDYLARRFVFMRWKEKFLVPDEEVGAVEGASYDGYYYIVHDQVTGSVLGFYY 248
           +++G Y+H DYL  RF++MRWKEKFLVPD E+ +VEGASYDGYYYIVHDQVTG +LGFYY
Sbjct: 224 VLEGSYSHEDYLQNRFIYMRWKEKFLVPDAEIDSVEGASYDGYYYIVHDQVTGHILGFYY 283

Query: 249 HKDAEKFQQLELTPVYPDRQGVC 271
           H+DAEKFQQLELTP+     G C
Sbjct: 284 HQDAEKFQQLELTPLQDPCAGDC 306

>Sklu_2286.3 YBR105C, Contig c2286 2431-3447 reverse complement
          Length = 338

 Score =  291 bits (744), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 163/294 (55%), Positives = 187/294 (63%), Gaps = 46/294 (15%)

Query: 21  LFRCGSGESLASAWTAD-TSAGCSPCARKYMAXXXXXXXXXKAAPR--ATTTTNWLRPLM 77
           L++C S +SLAS  +     +  SP  +KY+              R  ATT TN+L+P M
Sbjct: 43  LYKCSSRDSLASLNSLQHQDSIASP--KKYILEDNSAYNNVSNDTRVDATTRTNFLKPRM 100

Query: 78  AFQGYQISGYKKYQVHVLLQTVALPTKGCATATTPHVTGFLTIRGLTNQHPEITTFFESF 137
            F GYQ+SGYKKYQV V LQTV LPT   AT TTPH+TGFLTIRGLTNQHPEITTFFESF
Sbjct: 101 KFTGYQVSGYKKYQVIVDLQTVDLPTTP-ATTTTPHLTGFLTIRGLTNQHPEITTFFESF 159

Query: 138 AVNDTVGFLSSSMPPELAEYKSSDRVDLEHWLNFPSFKELCM------------------ 179
            V DT+GFLSS +P EL  YK +D VDLEHWLNFP FKELCM                  
Sbjct: 160 TVMDTIGFLSSCIPEELNAYKGNDHVDLEHWLNFPCFKELCMRRPASNNKHSSSTSYACN 219

Query: 180 -------------------AGGGTTVA---DIMDGHYTHRDYLARRFVFMRWKEKFLVPD 217
                               GG   V     I++G YTH +YL  RF+FMRWKEKFLVPD
Sbjct: 220 GKPNAYHKYTNYANVQSNCVGGDADVNILHQILNGQYTHENYLCNRFIFMRWKEKFLVPD 279

Query: 218 EEVGAVEGASYDGYYYIVHDQVTGSVLGFYYHKDAEKFQQLELTPVYPDRQGVC 271
            E+ +VEGASYDGYYYIVHDQVTG++LGFYYHKDAEKFQQLEL+PV    +  C
Sbjct: 280 AEIDSVEGASYDGYYYIVHDQVTGNILGFYYHKDAEKFQQLELSPVMSGMESAC 333

>KLLA0B09592g 834414..835415 weakly similar to sp|P38263
           Saccharomyces cerevisiae YBR105c VID24 required for
           vacuolar import and degradation of FBP1P, hypothetical
           start
          Length = 333

 Score =  265 bits (677), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 125/251 (49%), Positives = 164/251 (65%), Gaps = 12/251 (4%)

Query: 26  SGESLASAWTADTSAGCSPCARKYMAXXXXXXXXXKAAPRATTTTNWLRPLMAFQGYQIS 85
           S E+   +   D    CSP                   P+    T+WL     F GYQ+S
Sbjct: 85  SHENFQDSEDYDIQDSCSPSLNS-------PPRSRPQTPKNHERTHWLGARKRFVGYQLS 137

Query: 86  GYKKYQVHVLLQTVALPTKGCATATTPHVTGFLTIRGLTNQHPEITTFFESFAVNDTVGF 145
           GYKK+QV + +Q+V+LP    +   +PH+TGFL+I+GLT Q+PEITTFFES  V D++GF
Sbjct: 138 GYKKFQVMITIQSVSLPNDNESNCCSPHLTGFLSIKGLTVQNPEITTFFESITVTDSLGF 197

Query: 146 LSSSMPPELAEYKSSDRVDLEHWLNFPSFKELCMAG-----GGTTVADIMDGHYTHRDYL 200
           LS  +P + A YK+SD+ DLEHWLNFPSFKELCM           +  I+DG Y+H DYL
Sbjct: 198 LSKDIPIDYASYKASDQTDLEHWLNFPSFKELCMQNDPKYPSKNILQSIIDGTYSHTDYL 257

Query: 201 ARRFVFMRWKEKFLVPDEEVGAVEGASYDGYYYIVHDQVTGSVLGFYYHKDAEKFQQLEL 260
            +RF++MRW EKFLVPD ++ +++GASYDGYYYIVHDQ+ G++LGFYYH+ AE+FQQLEL
Sbjct: 258 NQRFLYMRWNEKFLVPDADLESIDGASYDGYYYIVHDQLLGNILGFYYHEHAERFQQLEL 317

Query: 261 TPVYPDRQGVC 271
            P+     G C
Sbjct: 318 QPLQEPSIGDC 328

>CAGL0K12254g complement(1196376..1197383) similar to sp|P38263
           Saccharomyces cerevisiae YBR105c VID24 required for
           vacuolar import and degradation of FBP1P, hypothetical
           start
          Length = 335

 Score =  244 bits (623), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 136/280 (48%), Positives = 176/280 (62%), Gaps = 39/280 (13%)

Query: 21  LFRCGSGESLAS-AWTADTSAGCS---PCARKYMAXXXXXXXXXKAAPR-------ATTT 69
           L++C S +SL S     D S+  S      +KY+           + PR        TT 
Sbjct: 40  LYKCHSKDSLPSLQHLIDRSSSESLPLKKKKKYIMNDRSSYTTV-SVPRYVTPTHKNTTQ 98

Query: 70  TNWLRPLMAFQGYQISGYKKYQVHVLLQTVALPT-KGCATATTPHVTGFLTIRGLTNQHP 128
           TN+LRP + F GYQ+SGYK+YQV+V L+TV LPT +   T TTPH+TG+LTI+GLT+QHP
Sbjct: 99  TNFLRPRLEFSGYQLSGYKRYQVNVSLKTVDLPTVESGNTTTTPHITGYLTIKGLTSQHP 158

Query: 129 EITTFFESFAV-NDTVGFLSSSMPPE--LAEYKSSDRVDLEHWLNFPSFKELCMAGGGTT 185
           EITTFFE++AV ++ +GFLSS  P E     YKS D+ DLEHWLNFP+F+EL +A     
Sbjct: 159 EITTFFEAYAVEHNELGFLSSQWPEENNYEPYKSDDQTDLEHWLNFPAFRELFIAQHANL 218

Query: 186 VAD---------------------IMDGHYTH--RDYLARRFVFMRWKEKFLVPDEEVGA 222
           V +                      M+    +  R+YL  R++FMRWKEKFLVPD  V  
Sbjct: 219 VKEDEEATPDFKKKRQSINTLAELFMENQAQNEGRNYLNDRYIFMRWKEKFLVPDAFVEN 278

Query: 223 VEGASYDGYYYIVHDQVTGSVLGFYYHKDAEKFQQLELTP 262
           V+GASYDG+YY+VHDQ+TG + GFYYH+DAE+FQQLEL P
Sbjct: 279 VDGASYDGFYYVVHDQLTGCMQGFYYHQDAERFQQLELVP 318

>YBR105C (VID24) [294] chr2 complement(450838..451926) Protein
           required for vacuolar import and degradation of Fbp1p
           (fructose-1,6-bisphosphatase) [1089 bp, 362 aa]
          Length = 362

 Score =  244 bits (622), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 135/283 (47%), Positives = 176/283 (62%), Gaps = 44/283 (15%)

Query: 21  LFRCGSGESLAS-AWTADTSAGCSPCARKYMAXXXXXXXXXK-----AAPRATTTTNWLR 74
           L++C S +SL+S    A T  G +   +KY+                ++   T  TN+LR
Sbjct: 67  LYKCASRDSLSSLQQLAHTPNGST--RKKYIVEDQSPYSSENPVIVTSSYNHTVCTNYLR 124

Query: 75  PLMAFQGYQISGYKKYQVHVLLQTVALPTKGCATATTPHVTGFLTIRGLTNQHPEITTFF 134
           P M F GYQISGYK+YQV V L+TV LP K C T+ +PH++GFL+IRGLTNQHPEI+T+F
Sbjct: 125 PRMQFTGYQISGYKRYQVTVNLKTVDLPKKDC-TSLSPHLSGFLSIRGLTNQHPEISTYF 183

Query: 135 ESFAVN-DTVGFLSSSMP--PELAEYKSSDRVDLEHWLNFPSFKELCMAG---------- 181
           E++AVN   +GFLSSS    P L E+K++D+ DLEHW+NFPSF++L +            
Sbjct: 184 EAYAVNHKELGFLSSSWKDEPVLNEFKATDQTDLEHWINFPSFRQLFLMSQKNGLNSTDD 243

Query: 182 GGTT---------------------VADIMDGHYTHRDYLARRFVFMRWKEKFLVPDEEV 220
            GTT                     ++ I        +YL  RF+FM+WKEKFLVPD  +
Sbjct: 244 NGTTNAAKKLPPQQLPTTPSADAGNISRIFSQEKQFDNYLNERFIFMKWKEKFLVPDALL 303

Query: 221 -GAVEGASYDGYYYIVHDQVTGSVLGFYYHKDAEKFQQLELTP 262
              V+GASYDG+YYIVHDQVTG++ GFYYH+DAEKFQQLEL P
Sbjct: 304 MEGVDGASYDGFYYIVHDQVTGNIQGFYYHQDAEKFQQLELVP 346

>Scas_718.4
          Length = 356

 Score =  238 bits (607), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 156/218 (71%), Gaps = 16/218 (7%)

Query: 64  PRATTT-TNWLRPLMAFQGYQISGYKKYQVHVLLQTVALPTKGCATATT-PHVTGFLTIR 121
           P ATTT TN+L P M F+G+Q+SGYKKYQV V ++TV LP+    T TT PH+TG LTI+
Sbjct: 130 PSATTTNTNFLTPSMKFKGFQMSGYKKYQVTVTIKTVNLPSSTQETITTQPHMTGSLTIK 189

Query: 122 GLTNQHPEITTFFESFAVNDTVGFLSS----SMPPELAEYKSSDRVDLEHWLNFPSFKEL 177
           GLT Q+P+ITTFF+SFAVN+   FLSS    +   +L + +S+DR+DLEHWLNFP FK+L
Sbjct: 190 GLTFQYPQITTFFQSFAVNENFHFLSSHWDANTRAQLHDLQSNDRIDLEHWLNFPIFKQL 249

Query: 178 CMAG--GGTTVADIMDGHYTHRDYLARRFVFMRWKEKFLVPDEE------VGAVEGASYD 229
            MA   G  T    +D +   + YL  RF+FMRWKEKFL+ D E         + GAS+D
Sbjct: 250 FMADVEGEETQDHEIDSYL--KQYLNNRFIFMRWKEKFLIRDGEHIDDDDEDEINGASFD 307

Query: 230 GYYYIVHDQVTGSVLGFYYHKDAEKFQQLELTPVYPDR 267
           G+YYIVHDQV GS+ GFYYHKDAEKFQQLEL PV+ +R
Sbjct: 308 GFYYIVHDQVDGSIHGFYYHKDAEKFQQLELVPVFNER 345

>YGR066C (YGR066C) [2028] chr7 complement(620923..621801) Protein of
           unknown function, has low similarity to a region of S.
           cerevisiae Vid24p, which is required for vacuolar import
           and degradation of fructose-1,6-bisphosphatase (S.
           cerevisiae Fbp1p) [879 bp, 292 aa]
          Length = 292

 Score =  126 bits (316), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 75/209 (35%), Positives = 110/209 (52%), Gaps = 18/209 (8%)

Query: 71  NWLRPLMAFQGYQISGYKKYQVHVLLQTVALPTKGCATATTPHVTGFLTIRGLTNQHPEI 130
           ++LRP + F G Q S Y  Y V V + TV LP    + +  PHVTG  TI+ LT    ++
Sbjct: 77  DFLRPGLRFGGSQSSKYTYYTVEVKIDTVNLPLYKDSRSLDPHVTGTFTIKNLTPVLDKV 136

Query: 131 TTFFESFAVN-DTVGFLSSSMPPE--LAEYKSSDRVDLEHWLNFPSFKELCMAGGGTTVA 187
            T FE + +N +     S   P E  L  Y +    D  HW  F  F          ++ 
Sbjct: 137 VTLFEGYVINYNQFPLCSLHWPAEETLDPYMAQRESDCSHWKRFGHF-----GSDNWSLT 191

Query: 188 DIMDGHYTHR--DYLARRFVFMRWKEKFLVPDEEVGAV--------EGASYDGYYYIVHD 237
           +   G Y H   +++ +R+++++WKE+FL+ DEE   +        EGAS++G+YY+  D
Sbjct: 192 ERNFGQYNHESAEFMNQRYIYLKWKERFLLDDEEQENLMLDDNHHLEGASFEGFYYVCLD 251

Query: 238 QVTGSVLGFYYHKDAEKFQQLELTPVYPD 266
           Q+TGSV G+YYH   E FQ+LEL P   D
Sbjct: 252 QLTGSVEGYYYHPACELFQKLELVPTNCD 280

>Scas_667.27
          Length = 332

 Score =  124 bits (312), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 74/212 (34%), Positives = 115/212 (54%), Gaps = 21/212 (9%)

Query: 67  TTTTNWLRPLMAFQGYQISGYKKYQVHVLLQTVALPTKGCATATTPHVTGFLTIRGLTNQ 126
            T +++L+P   F G Q+ G K Y + V L+T+  P         PH+TG L I+G ++ 
Sbjct: 113 NTLSHYLKPKKRFHGVQVVGPKVYVIKVDLETINFPPFN-YNIFNPHLTGRLNIQGFSDT 171

Query: 127 HPEITTFFESFAV-NDTVGFLSSSMP--PELAEYKSSDRVDLEHWLNFPSFKELCMAGGG 183
             ++TT+FE +++ ND +GFLSS+    P L +  + D VD+ HWL    F+ +      
Sbjct: 172 GEDVTTYFEGYSIENDKLGFLSSNWEDHPCLEDLTADDIVDIFHWLKLKPFRRILNKKPV 231

Query: 184 T---------TVADIMDGHYTHRDYLARRFVFMRWKEKFLVP---DEEVGAVEGASYDGY 231
                      + DI++      D    R+VFM+WKE+F++    D+E   V G +Y G+
Sbjct: 232 NKRWSKLPLRVLKDIVNETEYQND---GRYVFMKWKERFVIDHAVDDE--PVAGITYRGF 286

Query: 232 YYIVHDQVTGSVLGFYYHKDAEKFQQLELTPV 263
           YYIVHD+ TG + GFY+ +    FQ+L L PV
Sbjct: 287 YYIVHDKFTGEIEGFYHERGTAAFQRLSLQPV 318

>YGR002C (SWC4) [1973] chr7 complement(498478..499908) Essential
           protein of unknown molecular function [1431 bp, 476 aa]
          Length = 476

 Score = 29.6 bits (65), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 34/77 (44%), Gaps = 11/77 (14%)

Query: 99  VALPTKGCATATTPHVTG----FLTIRGLTNQHPEITTFFESFAVNDTVGFLSSSMPP-- 152
           V++P+   A    P VTG       + G  NQ P +     +F        LS+S P   
Sbjct: 24  VSVPSSSAANRPKPQVTGMQRELFNLLG-ENQPPVVIKSGNNFKE----KMLSTSKPSPW 78

Query: 153 ELAEYKSSDRVDLEHWL 169
              E+K+++ V L HW+
Sbjct: 79  SFVEFKANNSVTLRHWV 95

>CAGL0G02343g complement(206880..207851) similar to sp|P36164
           Saccharomyces cerevisiae YKR088c, hypothetical start
          Length = 323

 Score = 28.9 bits (63), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 5/44 (11%)

Query: 221 GAVEGASYDGYYYIVHDQVTGSVLGFY-----YHKDAEKFQQLE 259
           G + G S+ G++ +    VTGSV  FY      H  AEK   + 
Sbjct: 149 GLIYGVSFHGWFVLALGSVTGSVASFYVFKNLLHSRAEKLVHMN 192

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.134    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,281,236
Number of extensions: 330543
Number of successful extensions: 607
Number of sequences better than 10.0: 11
Number of HSP's gapped: 589
Number of HSP's successfully gapped: 13
Length of query: 271
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 171
Effective length of database: 13,134,309
Effective search space: 2245966839
Effective search space used: 2245966839
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)