Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL329W1111095725e-78
Scas_667.26*126941882e-19
CAGL0D01540g127981856e-19
YPR063C140951823e-18
KLLA0B08415g121701803e-18
Kwal_27.1261072691749e-18
KLLA0F25124g97582575.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL329W
         (109 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL329W [1412] [Homologous to ScYPR063C - SH] complement(122957....   224   5e-78
Scas_667.26*                                                           77   2e-19
CAGL0D01540g 166233..166616 similar to tr|Q12160 Saccharomyces c...    76   6e-19
YPR063C (YPR063C) [5492] chr16 complement(677807..678188,678275....    75   3e-18
KLLA0B08415g 749520..749885 weakly similar to sgd|S0006267 Sacch...    74   3e-18
Kwal_27.12610                                                          72   9e-18
KLLA0F25124g complement(2334954..2337881) similar to sp|P43571 S...    27   5.4  

>ADL329W [1412] [Homologous to ScYPR063C - SH]
           complement(122957..123292) [336 bp, 111 aa]
          Length = 111

 Score =  224 bits (572), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 109/109 (100%), Positives = 109/109 (100%)

Query: 1   MSSPGGLPTHAATNVDRYTHVLAPDTAYTGASQGVVSQSMPMLAMFMRNKFLAWFSLLTA 60
           MSSPGGLPTHAATNVDRYTHVLAPDTAYTGASQGVVSQSMPMLAMFMRNKFLAWFSLLTA
Sbjct: 1   MSSPGGLPTHAATNVDRYTHVLAPDTAYTGASQGVVSQSMPMLAMFMRNKFLAWFSLLTA 60

Query: 61  WHTYLTADPNAVRDREGTEVGPIMKLGMAVVAVVVCYTGMVLPQPAPGA 109
           WHTYLTADPNAVRDREGTEVGPIMKLGMAVVAVVVCYTGMVLPQPAPGA
Sbjct: 61  WHTYLTADPNAVRDREGTEVGPIMKLGMAVVAVVVCYTGMVLPQPAPGA 109

>Scas_667.26*
          Length = 126

 Score = 77.0 bits (188), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 58/94 (61%), Gaps = 7/94 (7%)

Query: 17  RYTHVLAPDTAYTG--ASQGVVSQSMPMLAMFMRNKFLAWFSLLTAWHTYLTADPNAVRD 74
           R +  + P   Y+   +  G+V+QSMPM A+F+RN+F+AWF+++ + H YL  D +    
Sbjct: 14  RASRAIPPKGLYSTLPSMSGIVNQSMPMAAIFLRNRFVAWFAVIQSVHYYLNTDEDEANA 73

Query: 75  REGT-----EVGPIMKLGMAVVAVVVCYTGMVLP 103
           ++G      E  PI+K+ MA+V ++VCY  +V P
Sbjct: 74  KDGKQSSSIEQTPIIKVAMAMVGLIVCYMNLVFP 107

>CAGL0D01540g 166233..166616 similar to tr|Q12160 Saccharomyces
           cerevisiae YPR063c, start by similarity
          Length = 127

 Score = 75.9 bits (185), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 60/98 (61%), Gaps = 10/98 (10%)

Query: 17  RYTHVLAPDTAYTGASQ--GVVSQSMPMLAMFMRNKFLAWFSLLTAWHTYLTADPNAVRD 74
           +Y     P   Y+ +    G+V+Q+MPM A+F++NKF+AWFSL+ + H+YL  D   + +
Sbjct: 14  QYKKSEPPRGIYSESQSLSGIVNQTMPMAAIFLKNKFIAWFSLIQSVHSYLNTDEETL-E 72

Query: 75  REGTEVG-------PIMKLGMAVVAVVVCYTGMVLPQP 105
           +  ++ G       P++K+ M++V ++VCY  +V P P
Sbjct: 73  KNKSKTGNSALDQPPLVKVAMSLVGILVCYMNLVFPTP 110

>YPR063C (YPR063C) [5492] chr16
           complement(677807..678188,678275..678315) Protein of
           unknown function [423 bp, 140 aa]
          Length = 140

 Score = 74.7 bits (182), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 57/95 (60%), Gaps = 8/95 (8%)

Query: 18  YTHVLAPDTAY--TGASQGVVSQSMPMLAMFMRNKFLAWFSLLTAWHTYLTADPN---AV 72
           Y  +  P   Y  T +  GVV+QSMPM A+F+RNKF+AWFSL+ + H YL  D +   A 
Sbjct: 15  YKKIAPPKGLYSATPSISGVVNQSMPMAAIFLRNKFIAWFSLIQSVHYYLNTDEDIIVAY 74

Query: 73  RDREG---TEVGPIMKLGMAVVAVVVCYTGMVLPQ 104
           ++ +     +  P +KL M+++ + VCY  +V PQ
Sbjct: 75  KENKAPSPMDQPPAIKLFMSLIGLCVCYMNLVFPQ 109

>KLLA0B08415g 749520..749885 weakly similar to sgd|S0006267
           Saccharomyces cerevisiae YPR063c hypothetical protein,
           start by similarity
          Length = 121

 Score = 73.9 bits (180), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 37/70 (52%), Positives = 46/70 (65%), Gaps = 6/70 (8%)

Query: 40  MPMLAMFMRNKFLAWFSLLTAWHTYLTADPNAVRDREGTEVGPIMKLGMAVVAVVVCYTG 99
           MPM AMFM+NKFLAWF++LT WH +LT+ P    D       P MK+GMAV+AV + Y G
Sbjct: 39  MPMAAMFMKNKFLAWFAVLTTWHVFLTSQP----DPSNPTDSPFMKIGMAVLAVGMNYLG 94

Query: 100 MVLP--QPAP 107
           +  P  QP P
Sbjct: 95  LFFPGTQPPP 104

>Kwal_27.12610
          Length = 72

 Score = 71.6 bits (174), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 46/69 (66%), Gaps = 5/69 (7%)

Query: 40  MPMLAMFMRNKFLAWFSLLTAWHTYLTADPNAVRDREGTEVGPIMKLGMAVVAVVVCYTG 99
           MPM AMFMRNKFLAWF+LL+  H  LT +P+A  D+       ++K+ M++V++ VCY  
Sbjct: 1   MPMAAMFMRNKFLAWFALLSTVHYALTTEPDANADQSA-----VVKVLMSLVSLAVCYIN 55

Query: 100 MVLPQPAPG 108
           +  PQP P 
Sbjct: 56  VAFPQPGPA 64

>KLLA0F25124g complement(2334954..2337881) similar to sp|P43571
           Saccharomyces cerevisiae YFL025c BST1 negative regulator
           of COPII vesicle formation singleton, start by
           similarity
          Length = 975

 Score = 26.6 bits (57), Expect = 5.4,   Method: Composition-based stats.
 Identities = 16/82 (19%), Positives = 40/82 (48%), Gaps = 1/82 (1%)

Query: 14  NVDRYTHVLAPDTAYTGASQGVVSQSMPMLAMFMRNKFLAWFSLLTAWHTYLTADPNAVR 73
           N  +Y+++   + ++   +  ++  + P++ +F+RN  + W +   + H +L   P  + 
Sbjct: 856 NNAKYSNIHNYNVSFLMLTIFMIPINAPIVVVFLRNFAIRWETAFRSHHNFLAIAPTLLL 915

Query: 74  DREGTEVG-PIMKLGMAVVAVV 94
               ++   PI+K  M  + VV
Sbjct: 916 TLRNSQCNIPIIKNRMNWLIVV 937

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.132    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,277,816
Number of extensions: 104512
Number of successful extensions: 225
Number of sequences better than 10.0: 7
Number of HSP's gapped: 220
Number of HSP's successfully gapped: 7
Length of query: 109
Length of database: 16,596,109
Length adjustment: 79
Effective length of query: 30
Effective length of database: 13,861,287
Effective search space: 415838610
Effective search space used: 415838610
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (25.4 bits)