Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL328C1511497911e-110
Kwal_27.126071521505685e-76
YPR062W (FCY1)1581495555e-74
CAGL0D01562g1551495556e-74
KLLA0B08437g1521505452e-72
Scas_667.25*1541495287e-70
Scas_690.232561071054e-06
ACR075C245991038e-06
CAGL0J01023g259115984e-05
YJL035C (TAD2)250102966e-05
Kwal_23.289424791887e-04
KLLA0C10989g23882820.004
AFR023W30079730.071
CAGL0A00847g32953730.084
Kwal_47.1761032124680.31
AFR493C32438680.40
ACL069C64448660.65
YHR144C (DCD1)31265650.89
CAGL0G05852g30769631.3
Scas_670.29*35724631.5
Sklu_2368.332951612.7
Scas_677.2431650612.8
KLLA0C18403g32824612.9
Kwal_33.1331748654604.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL328C
         (149 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL328C [1413] [Homologous to ScYPR062W (FCY1) - SH] (123313..12...   309   e-110
Kwal_27.12607                                                         223   5e-76
YPR062W (FCY1) [5491] chr16 (677160..677636) Cytosine deaminase,...   218   5e-74
CAGL0D01562g complement(166898..167365) highly similar to sp|Q12...   218   6e-74
KLLA0B08437g complement(750194..750652) highly similar to sp|Q12...   214   2e-72
Scas_667.25*                                                          207   7e-70
Scas_690.23                                                            45   4e-06
ACR075C [1122] [Homologous to ScYJL035C (TAD2) - SH] (497467..49...    44   8e-06
CAGL0J01023g complement(100059..100838) similar to sp|P47058 Sac...    42   4e-05
YJL035C (TAD2) [2876] chr10 complement(380165..380917) Subunit t...    42   6e-05
Kwal_23.2894                                                           39   7e-04
KLLA0C10989g complement(944739..945455) similar to sp|P47058 Sac...    36   0.004
AFR023W [3215] [Homologous to ScYHR144C (DCD1) - SH] complement(...    33   0.071
CAGL0A00847g complement(86551..87540) similar to sp|Q9URQ3 Sacch...    33   0.084
Kwal_47.17610                                                          31   0.31 
AFR493C [3685] [Homologous to ScYLR316C (TAD3) - SH] (1325485..1...    31   0.40 
ACL069C [980] [Homologous to ScYHL032C (GUT1) - SH] (232439..234...    30   0.65 
YHR144C (DCD1) [2432] chr8 complement(387789..388727) Deoxycytid...    30   0.89 
CAGL0G05852g 565237..566160 similar to sp|P06773 Saccharomyces c...    29   1.3  
Scas_670.29*                                                           29   1.5  
Sklu_2368.3 YHR144C, Contig c2368 5164-6153                            28   2.7  
Scas_677.24                                                            28   2.8  
KLLA0C18403g 1627733..1628719 some similarities with sp|Q9URQ3 S...    28   2.9  
Kwal_33.13317                                                          28   4.5  

>ADL328C [1413] [Homologous to ScYPR062W (FCY1) - SH]
           (123313..123768) [456 bp, 151 aa]
          Length = 151

 Score =  309 bits (791), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%)

Query: 1   MAQWDRKGMEIAYQEALQGYAEGGVPIGGCLIDQTDGTVLGRGRNMRFQRASATLHGETA 60
           MAQWDRKGMEIAYQEALQGYAEGGVPIGGCLIDQTDGTVLGRGRNMRFQRASATLHGETA
Sbjct: 1   MAQWDRKGMEIAYQEALQGYAEGGVPIGGCLIDQTDGTVLGRGRNMRFQRASATLHGETA 60

Query: 61  ALENAGRLPGHVYKHCTLYTTLSPCDMCAGAVLLYGIPRCVVGENDTFLGAEAHLRARGV 120
           ALENAGRLPGHVYKHCTLYTTLSPCDMCAGAVLLYGIPRCVVGENDTFLGAEAHLRARGV
Sbjct: 61  ALENAGRLPGHVYKHCTLYTTLSPCDMCAGAVLLYGIPRCVVGENDTFLGAEAHLRARGV 120

Query: 121 EVTVLQDARCRALMQQFVAARPQDWNEDI 149
           EVTVLQDARCRALMQQFVAARPQDWNEDI
Sbjct: 121 EVTVLQDARCRALMQQFVAARPQDWNEDI 149

>Kwal_27.12607
          Length = 152

 Score =  223 bits (568), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 120/150 (80%), Gaps = 1/150 (0%)

Query: 1   MAQWDRKGMEIAYQEALQGYAEGGVPIGGCLIDQTDGTVLGRGRNMRFQRASATLHGETA 60
           M++WD+KG+++AY+EAL+GY EGGVPIGGCLI+  DGTVLG G NMRFQ+ SATLHGE +
Sbjct: 1   MSKWDQKGIDLAYEEALKGYKEGGVPIGGCLINNKDGTVLGSGHNMRFQKGSATLHGEIS 60

Query: 61  ALENAGRLPGHVYKHCTLYTTLSPCDMCAGAVLLYGIPRCVVGENDTFLG-AEAHLRARG 119
            LEN GR+ G VYK CTLYTTLSPCDMC GA+LLYGI RCVVGEN  F G  E +L  RG
Sbjct: 61  TLENCGRMKGSVYKDCTLYTTLSPCDMCTGAILLYGISRCVVGENVNFKGDGERYLAERG 120

Query: 120 VEVTVLQDARCRALMQQFVAARPQDWNEDI 149
            EV VL D RC+ +M+QF+  RPQDW EDI
Sbjct: 121 CEVKVLDDDRCKDIMKQFIEERPQDWFEDI 150

>YPR062W (FCY1) [5491] chr16 (677160..677636) Cytosine deaminase,
           catalyzes the hydrolysis of cytidine into uridine and
           ammonia [477 bp, 158 aa]
          Length = 158

 Score =  218 bits (555), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 118/149 (79%), Gaps = 1/149 (0%)

Query: 2   AQWDRKGMEIAYQEALQGYAEGGVPIGGCLIDQTDGTVLGRGRNMRFQRASATLHGETAA 61
           ++WD+KGM+IAY+EA  GY EGGVPIGGCLI+  DG+VLGRG NMRFQ+ SATLHGE + 
Sbjct: 8   SKWDQKGMDIAYEEAALGYKEGGVPIGGCLINNKDGSVLGRGHNMRFQKGSATLHGEIST 67

Query: 62  LENAGRLPGHVYKHCTLYTTLSPCDMCAGAVLLYGIPRCVVGENDTFLG-AEAHLRARGV 120
           LEN GRL G VYK  TLYTTLSPCDMC GA+++YGIPRCVVGEN  F    E +L+ RG 
Sbjct: 68  LENCGRLEGKVYKDTTLYTTLSPCDMCTGAIIMYGIPRCVVGENVNFKSKGEKYLQTRGH 127

Query: 121 EVTVLQDARCRALMQQFVAARPQDWNEDI 149
           EV V+ D RC+ +M+QF+  RPQDW EDI
Sbjct: 128 EVVVVDDERCKKIMKQFIDERPQDWFEDI 156

>CAGL0D01562g complement(166898..167365) highly similar to sp|Q12178
           Saccharomyces cerevisiae YPR062w FCY1 cytosine
           deaminase, hypothetical start
          Length = 155

 Score =  218 bits (555), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 118/149 (79%), Gaps = 1/149 (0%)

Query: 2   AQWDRKGMEIAYQEALQGYAEGGVPIGGCLIDQTDGTVLGRGRNMRFQRASATLHGETAA 61
           AQWD  GM+IAY+EA +G+ EGGVPIGGCLI+  DGTVLGRG NMRFQ+ S TLHGE + 
Sbjct: 5   AQWDALGMKIAYEEAAKGFEEGGVPIGGCLINNKDGTVLGRGHNMRFQKGSPTLHGEIST 64

Query: 62  LENAGRLPGHVYKHCTLYTTLSPCDMCAGAVLLYGIPRCVVGENDTFLG-AEAHLRARGV 120
           LEN GRL G VYK  TLYTTLSPCDMC GA+LLYGIPRCV+GE+D F    E +L++RGV
Sbjct: 65  LENCGRLEGKVYKDTTLYTTLSPCDMCTGAILLYGIPRCVIGESDNFKSPGEEYLKSRGV 124

Query: 121 EVTVLQDARCRALMQQFVAARPQDWNEDI 149
           EV  + D  C+A+M++F+  RPQDW EDI
Sbjct: 125 EVVQMNDEPCKAIMKKFIDTRPQDWFEDI 153

>KLLA0B08437g complement(750194..750652) highly similar to sp|Q12178
           Saccharomyces cerevisiae YPR062w FCY1 cytosine deaminase
           singleton, start by similarity
          Length = 152

 Score =  214 bits (545), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 115/150 (76%), Gaps = 1/150 (0%)

Query: 1   MAQWDRKGMEIAYQEALQGYAEGGVPIGGCLIDQTDGTVLGRGRNMRFQRASATLHGETA 60
           MA+WD+KGM+ AY+EA  GY EGGVPIGGCLID   G +LG G NMRFQ+ S TLHGET+
Sbjct: 1   MAEWDKKGMDKAYEEAAIGYKEGGVPIGGCLIDNLTGEILGSGHNMRFQKGSPTLHGETS 60

Query: 61  ALENAGRLPGHVYKHCTLYTTLSPCDMCAGAVLLYGIPRCVVGENDTFLG-AEAHLRARG 119
            LENAGRL G VYKHCT+YTTLSPCDMC GA+LLYGI R VVGEN  F    E +L  RG
Sbjct: 61  TLENAGRLKGSVYKHCTMYTTLSPCDMCTGAILLYGIGRVVVGENVNFKSPGEKYLAERG 120

Query: 120 VEVTVLQDARCRALMQQFVAARPQDWNEDI 149
           +EV V+ D RC  +M+ F+A RP+DW EDI
Sbjct: 121 IEVKVVDDERCIEIMKDFIAKRPEDWFEDI 150

>Scas_667.25*
          Length = 154

 Score =  207 bits (528), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 114/149 (76%), Gaps = 1/149 (0%)

Query: 2   AQWDRKGMEIAYQEALQGYAEGGVPIGGCLIDQTDGTVLGRGRNMRFQRASATLHGETAA 61
            QWD+ GM+IA++EA  GYAEGGVPIGGCLI+  DG VLGRG NMRFQ+ S TLHGE + 
Sbjct: 4   GQWDKLGMDIAFEEAANGYAEGGVPIGGCLINNKDGKVLGRGHNMRFQKGSPTLHGEIST 63

Query: 62  LENAGRLPGHVYKHCTLYTTLSPCDMCAGAVLLYGIPRCVVGENDTFLG-AEAHLRARGV 120
           LEN GRL G VYK  TLYTTLSPCDMC GA+L+YGIPR V+GE+  F    EA+L +R V
Sbjct: 64  LENCGRLEGKVYKDTTLYTTLSPCDMCTGAILMYGIPRVVIGESVNFKSPGEAYLASRNV 123

Query: 121 EVTVLQDARCRALMQQFVAARPQDWNEDI 149
           +V  + D RC+ +M++F+  RPQDW EDI
Sbjct: 124 QVVQMDDERCKTIMKKFIDERPQDWFEDI 152

>Scas_690.23
          Length = 256

 Score = 45.1 bits (105), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 42/107 (39%), Gaps = 9/107 (8%)

Query: 2   AQWDRKGMEIAYQEALQGYAEGGVPIGGCLIDQTDGTVLGRGRNMRFQRASATLHGETAA 61
           A W    ME A + A         P+    + +    ++  G N   +  +   H E   
Sbjct: 9   ASW----MESAIKLARYALDHDETPVASIFVHEPTNKIIAYGLNDTNKSLTGIAHAEFMG 64

Query: 62  LENAGRLPG-----HVYKHCTLYTTLSPCDMCAGAVLLYGIPRCVVG 103
           +E    + G      ++K   LY T+ PC MCA A+   GI + V G
Sbjct: 65  IEQIKAMVGSEHLTEIFKDTVLYVTVEPCVMCASALRQLGIKKVVFG 111

>ACR075C [1122] [Homologous to ScYJL035C (TAD2) - SH]
           (497467..498204) [738 bp, 245 aa]
          Length = 245

 Score = 44.3 bits (103), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 40/99 (40%), Gaps = 4/99 (4%)

Query: 9   MEIAYQEALQGYAEGGVPIGGCLIDQTDGTVLGRGRNMRFQRASATLHGETAALENAGRL 68
           M  A + A      G  P+    +      ++  G N   +  +   H E  A+     L
Sbjct: 8   MRTAIRLARYALDHGETPVACVFVHTPSDQIIAYGMNDTNRSLTGIAHAEFGAIAQVQEL 67

Query: 69  PGH----VYKHCTLYTTLSPCDMCAGAVLLYGIPRCVVG 103
            G     ++K  T+Y T+ PC MCA A+   GI R + G
Sbjct: 68  FGEQDASIFKEVTVYVTVEPCVMCASALKQLGIGRVIFG 106

>CAGL0J01023g complement(100059..100838) similar to sp|P47058
           Saccharomyces cerevisiae YJL035c TAD2, hypothetical
           start
          Length = 259

 Score = 42.4 bits (98), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 49/115 (42%), Gaps = 11/115 (9%)

Query: 7   KGMEIAYQEALQGYAEGGVPIGGCLIDQTDGTVLGRGRNMRFQRASATLHGETAA---LE 63
           K ++ A + A      G  P+    + +   +V+  G N      S T H E  A   L 
Sbjct: 6   KHIDSALKLARYALDHGETPVACVFVHEKSDSVVAYGLNDTNDSLSGTAHAEFVAMRMLR 65

Query: 64  NAGRLPGH-------VYKHCTLYTTLSPCDMCAGAVLLYGIPRCVVG-ENDTFLG 110
           +A +  G+       ++K    Y T+ PC MCA A+   GI + V G  ND F G
Sbjct: 66  DAVQAQGYASVQLKQLFKEIVCYVTVEPCIMCASALKQMGIHKIVFGCGNDRFGG 120

>YJL035C (TAD2) [2876] chr10 complement(380165..380917) Subunit
           tRNA[Ala]-specific adenosine deaminase [753 bp, 250 aa]
          Length = 250

 Score = 41.6 bits (96), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 40/102 (39%), Gaps = 5/102 (4%)

Query: 7   KGMEIAYQEALQGYAEGGVPIGGCLIDQTDGTVLGRGRNMRFQRASATLHGETAALENAG 66
           K M  A + A         P+    +    G V+  G N   +  +   H E   ++   
Sbjct: 5   KHMRTAVRLARYALDHDETPVACIFVHTPTGQVMAYGMNDTNKSLTGVAHAEFMGIDQIK 64

Query: 67  RLPGH-----VYKHCTLYTTLSPCDMCAGAVLLYGIPRCVVG 103
            + G      V+K  TLY T+ PC MCA A+    I + V G
Sbjct: 65  AMLGSRGVVDVFKDITLYVTVEPCIMCASALKQLDIGKVVFG 106

>Kwal_23.2894
          Length = 247

 Score = 38.5 bits (88), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 36/91 (39%), Gaps = 5/91 (5%)

Query: 25  VPIGGCLIDQTDGTVLGRGRNMRFQRASATLHGETAALENA----GRLPGHVYKHCTLYT 80
            P+    +      +L  G N   +  +   H E   +       G     VYK   LY 
Sbjct: 26  TPVACIFVHAPTNQILAYGMNDTNRSLTGIAHAEFMGISQIQAKFGVQNTSVYKDIILYV 85

Query: 81  TLSPCDMCAGAVLLYGIPRCVVG-ENDTFLG 110
           T+ PC MCA A+   GI + + G  ND F G
Sbjct: 86  TVEPCIMCASALKQLGIQKVIFGCGNDRFGG 116

>KLLA0C10989g complement(944739..945455) similar to sp|P47058
           Saccharomyces cerevisiae YJL035c TAD2 tRNA-specific
           adenosine deaminase 2 singleton, start by similarity
          Length = 238

 Score = 36.2 bits (82), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 32/82 (39%), Gaps = 5/82 (6%)

Query: 26  PIGGCLIDQTDGTVLGRGRNMRFQRASATLHGETAAL----ENAGRLPGHVYKHCTLYTT 81
           P+    +      V+  G N   +  S   H E   +    E  G  P  +     LY T
Sbjct: 25  PVACIFVHSKLNKVIAYGMNGTNESISGISHAEFMGIKQIQEKYGTDPK-ILSEVVLYVT 83

Query: 82  LSPCDMCAGAVLLYGIPRCVVG 103
           + PC MCA A+   GI + V G
Sbjct: 84  VEPCIMCASALKQLGIKKVVFG 105

>AFR023W [3215] [Homologous to ScYHR144C (DCD1) - SH]
           complement(483186..484088) [903 bp, 300 aa]
          Length = 300

 Score = 32.7 bits (73), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 37/79 (46%), Gaps = 11/79 (13%)

Query: 55  LHGETAALENAGRLPGHVYKHCTLYTTLSPCDMCAGAVLLYGIPRCVVG-----ENDTFL 109
           LH E  AL  AGR    V +   LY    PC  C+  ++  GI   V       ++D+F 
Sbjct: 220 LHAEENALLEAGR--ERVGEGAVLYCDTCPCLTCSVKIVQTGITEVVYSQTYRMDSDSF- 276

Query: 110 GAEAHLRARGVEVTVLQDA 128
                LRA GV+V  LQDA
Sbjct: 277 ---KVLRAGGVKVRQLQDA 292

>CAGL0A00847g complement(86551..87540) similar to sp|Q9URQ3
           Saccharomyces cerevisiae YLR316c TAD3, hypothetical
           start
          Length = 329

 Score = 32.7 bits (73), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 53  ATLHGETAALENAGRLP-GHVYKHCTLYTTLSPCDMCAGAVLLYGIPRCVVGE 104
           A    +  +LE+   +P  ++     +YTT  PC MC+ A++   I RC+  E
Sbjct: 228 ANTEKKRRSLEDCNNVPQNYLCLDFDVYTTHEPCSMCSMALIHSRIKRCIFIE 280

>Kwal_47.17610
          Length = 321

 Score = 30.8 bits (68), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 16/24 (66%)

Query: 78  LYTTLSPCDMCAGAVLLYGIPRCV 101
           +YTT  PC MCA A++   I RC+
Sbjct: 246 VYTTHEPCSMCAMALIHSRIKRCI 269

>AFR493C [3685] [Homologous to ScYLR316C (TAD3) - SH]
           (1325485..1326459) [975 bp, 324 aa]
          Length = 324

 Score = 30.8 bits (68), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%)

Query: 64  NAGRLPGHVYKHCTLYTTLSPCDMCAGAVLLYGIPRCV 101
           + GR   ++     +YTT  PC MCA A++   I RC+
Sbjct: 235 SVGRTDTYLCLDFDVYTTHEPCSMCAMALIHSRIKRCI 272

>ACL069C [980] [Homologous to ScYHL032C (GUT1) - SH]
           (232439..234373) [1935 bp, 644 aa]
          Length = 644

 Score = 30.0 bits (66), Expect = 0.65,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 4/48 (8%)

Query: 6   RKGMEIAYQEALQGYAEGGVPIGGCLIDQTDGTVLGRGRNMRFQRASA 53
           +K +  A  + L  +++ G+PI GCL DQ+   V      M F+  SA
Sbjct: 306 KKKLTEAAWDVLTSFSQSGIPIQGCLGDQSSSLV----GQMAFKAGSA 349

>YHR144C (DCD1) [2432] chr8 complement(387789..388727)
           Deoxycytidylate deaminase [939 bp, 312 aa]
          Length = 312

 Score = 29.6 bits (65), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 29/65 (44%), Gaps = 5/65 (7%)

Query: 41  GRGRNMRFQRASATLHGETAALENAGRLPGHVYKHCTLYTTLSPCDMCAGAVLLYGIPRC 100
           G  RN+        LH E  AL  AGR    V ++ TLY    PC  C+  ++  GI   
Sbjct: 221 GDSRNLH---TCLCLHAEENALLEAGR--DRVGQNATLYCDTCPCLTCSVKIVQTGISEV 275

Query: 101 VVGEN 105
           V  ++
Sbjct: 276 VYSQS 280

>CAGL0G05852g 565237..566160 similar to sp|P06773 Saccharomyces
           cerevisiae YHR144c DCD1 deoxycytidylate deaminase, start
           by similarity
          Length = 307

 Score = 28.9 bits (63), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 31/69 (44%), Gaps = 3/69 (4%)

Query: 55  LHGETAALENAGRLPGHVYKHCTLYTTLSPCDMCAGAVLLYGIPRCVVGENDTFLGAEAH 114
           LH E  AL  AGR    V ++ TLY    PC  C+  ++  GI   V  +      A   
Sbjct: 227 LHAEENALLEAGR--DRVGQNATLYCDTCPCLTCSVKIVQTGITEVVYSQTYRMDDASFK 284

Query: 115 -LRARGVEV 122
            LR  G++V
Sbjct: 285 VLREAGIKV 293

>Scas_670.29*
          Length = 357

 Score = 28.9 bits (63), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 16/24 (66%)

Query: 78  LYTTLSPCDMCAGAVLLYGIPRCV 101
           +YTT  PC MC+ A++   I RC+
Sbjct: 282 VYTTHEPCSMCSMALIHSRIRRCI 305

>Sklu_2368.3 YHR144C, Contig c2368 5164-6153
          Length = 329

 Score = 28.1 bits (61), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 2/51 (3%)

Query: 55  LHGETAALENAGRLPGHVYKHCTLYTTLSPCDMCAGAVLLYGIPRCVVGEN 105
           LH E  AL  AGR    V  + TLY    PC  C+  ++  GI   V  ++
Sbjct: 249 LHAEENALLEAGR--DRVGSNATLYCDTCPCLTCSVKIVQTGIREVVYSQS 297

>Scas_677.24
          Length = 316

 Score = 28.1 bits (61), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 22/50 (44%), Gaps = 2/50 (4%)

Query: 55  LHGETAALENAGRLPGHVYKHCTLYTTLSPCDMCAGAVLLYGIPRCVVGE 104
           LH E  AL  AGR    V    TLY    PC  C+  ++  GI   V  +
Sbjct: 236 LHAEENALLEAGR--DRVGVKATLYCDTCPCLTCSVKIVQTGIKEVVYSQ 283

>KLLA0C18403g 1627733..1628719 some similarities with sp|Q9URQ3
           Saccharomyces cerevisiae YLR316c TAD3 subunit of
           tRNA-specific adenosine-34 deaminase singleton,
           hypothetical start
          Length = 328

 Score = 28.1 bits (61), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 9/24 (37%), Positives = 16/24 (66%)

Query: 78  LYTTLSPCDMCAGAVLLYGIPRCV 101
           +YT+  PC MC+ A++   + RC+
Sbjct: 253 VYTSHEPCSMCSMALIHSRVKRCI 276

>Kwal_33.13317
          Length = 486

 Score = 27.7 bits (60), Expect = 4.5,   Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 5/54 (9%)

Query: 101 VVGENDTFLGAEAHLRARGVEVTVLQDARC-----RALMQQFVAARPQDWNEDI 149
           V+    TF  A+++LR +G +     DA C     R L    VA    ++NEDI
Sbjct: 329 VIKPAQTFFSAQSYLRYQGKKFIERFDANCYISITRKLDTHDVARDRPEYNEDI 382

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.137    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,457,349
Number of extensions: 156548
Number of successful extensions: 283
Number of sequences better than 10.0: 25
Number of HSP's gapped: 278
Number of HSP's successfully gapped: 25
Length of query: 149
Length of database: 16,596,109
Length adjustment: 92
Effective length of query: 57
Effective length of database: 13,411,253
Effective search space: 764441421
Effective search space used: 764441421
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 57 (26.6 bits)