Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL326W25925413530.0
KLLA0B08481g2602549171e-126
Kwal_27.126022572549061e-124
Scas_667.232582548881e-121
YPR060C (ARO7)2562548761e-119
CAGL0K12232g2602598241e-111
KLLA0E15356g69344634.5
Kwal_23.342672663635.1
ACL041C765156635.1
YPL193W (RSA1)381161625.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL326W
         (254 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL326W [1415] [Homologous to ScYPR060C (ARO7) - SH] complement(...   525   0.0  
KLLA0B08481g 752482..753264 highly similar to sp|P32178 Saccharo...   357   e-126
Kwal_27.12602                                                         353   e-124
Scas_667.23                                                           346   e-121
YPR060C (ARO7) [5489] chr16 complement(674856..675626) Chorismat...   342   e-119
CAGL0K12232g complement(1194973..1195755) highly similar to sp|P...   322   e-111
KLLA0E15356g complement(1359509..1361590) some similarities with...    29   4.5  
Kwal_23.3426                                                           29   5.1  
ACL041C [1008] [Homologous to ScYER075C (PTP3) - SH] (289645..29...    29   5.1  
YPL193W (RSA1) [5254] chr16 (181402..182547) Nucleoplasmic prote...    28   5.4  

>ADL326W [1415] [Homologous to ScYPR060C (ARO7) - SH]
           complement(124969..125748) [780 bp, 259 aa]
          Length = 259

 Score =  525 bits (1353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/254 (100%), Positives = 254/254 (100%)

Query: 1   MDFLDPKSVLNLDHIRHELVRMEDTIIFNFIERSYFPTCPVVYHANHERLPLPDFDGSFL 60
           MDFLDPKSVLNLDHIRHELVRMEDTIIFNFIERSYFPTCPVVYHANHERLPLPDFDGSFL
Sbjct: 1   MDFLDPKSVLNLDHIRHELVRMEDTIIFNFIERSYFPTCPVVYHANHERLPLPDFDGSFL 60

Query: 61  DWAHMHMEMTQSQLRRFEAPDQVPFYPGSILPPILPPVQYPKLLAPYAPQINYNDRIKAI 120
           DWAHMHMEMTQSQLRRFEAPDQVPFYPGSILPPILPPVQYPKLLAPYAPQINYNDRIKAI
Sbjct: 61  DWAHMHMEMTQSQLRRFEAPDQVPFYPGSILPPILPPVQYPKLLAPYAPQINYNDRIKAI 120

Query: 121 YLDSVVPLVSLGEGTSWENLGSVTSCDIDCLQALSRRIHFGKFVAEAKFQLEPEKYTALI 180
           YLDSVVPLVSLGEGTSWENLGSVTSCDIDCLQALSRRIHFGKFVAEAKFQLEPEKYTALI
Sbjct: 121 YLDSVVPLVSLGEGTSWENLGSVTSCDIDCLQALSRRIHFGKFVAEAKFQLEPEKYTALI 180

Query: 181 KNRDVDGIMDSITNKFVEDKILKRLQAKATVYGVDPLDRNCSKRVTPEYLAKIYKEYVIP 240
           KNRDVDGIMDSITNKFVEDKILKRLQAKATVYGVDPLDRNCSKRVTPEYLAKIYKEYVIP
Sbjct: 181 KNRDVDGIMDSITNKFVEDKILKRLQAKATVYGVDPLDRNCSKRVTPEYLAKIYKEYVIP 240

Query: 241 ITKEVEVEYLLRRL 254
           ITKEVEVEYLLRRL
Sbjct: 241 ITKEVEVEYLLRRL 254

>KLLA0B08481g 752482..753264 highly similar to sp|P32178
           Saccharomyces cerevisiae YPR060c ARO7 chorismate mutase
           singleton, start by similarity
          Length = 260

 Score =  357 bits (917), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 168/254 (66%), Positives = 205/254 (80%)

Query: 1   MDFLDPKSVLNLDHIRHELVRMEDTIIFNFIERSYFPTCPVVYHANHERLPLPDFDGSFL 60
           MDF  P++VL+L +IR ELV+MEDTIIFNFIERS+F TC  VY +N   + LPDFDGSFL
Sbjct: 1   MDFFKPETVLDLQNIRDELVKMEDTIIFNFIERSHFATCSSVYESNVPEIKLPDFDGSFL 60

Query: 61  DWAHMHMEMTQSQLRRFEAPDQVPFYPGSILPPILPPVQYPKLLAPYAPQINYNDRIKAI 120
           DWA M ME+  SQLRRFE+PD+ PF+P  IL PI+P + YPK+LA YA QINYND+IK+I
Sbjct: 61  DWALMKMEIVHSQLRRFESPDETPFFPDKILKPIIPSLNYPKILASYANQINYNDKIKSI 120

Query: 121 YLDSVVPLVSLGEGTSWENLGSVTSCDIDCLQALSRRIHFGKFVAEAKFQLEPEKYTALI 180
           Y+ ++VPL+S  +  +WEN GSV + DI+ LQ+LSRRIHFGKFVAEAKFQ E EK+T LI
Sbjct: 121 YIKTIVPLLSKRDINTWENFGSVATRDIEALQSLSRRIHFGKFVAEAKFQSEKEKFTKLI 180

Query: 181 KNRDVDGIMDSITNKFVEDKILKRLQAKATVYGVDPLDRNCSKRVTPEYLAKIYKEYVIP 240
            ++DVDGIM +ITN  VE+KIL+RL  KATVYGVDP +    +++TPEYL KIYKE VIP
Sbjct: 181 LDQDVDGIMTAITNSKVEEKILQRLNVKATVYGVDPTNEKGDRKITPEYLVKIYKEIVIP 240

Query: 241 ITKEVEVEYLLRRL 254
           ITKEVEV+YLLRRL
Sbjct: 241 ITKEVEVDYLLRRL 254

>Kwal_27.12602
          Length = 257

 Score =  353 bits (906), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 166/254 (65%), Positives = 204/254 (80%)

Query: 1   MDFLDPKSVLNLDHIRHELVRMEDTIIFNFIERSYFPTCPVVYHANHERLPLPDFDGSFL 60
           MDFL P++VL+L +IR ELV+MEDTIIFNFIERS+FPTCP VY      LPLPDFDGSFL
Sbjct: 1   MDFLKPETVLDLSNIRDELVKMEDTIIFNFIERSHFPTCPTVYKEKDPNLPLPDFDGSFL 60

Query: 61  DWAHMHMEMTQSQLRRFEAPDQVPFYPGSILPPILPPVQYPKLLAPYAPQINYNDRIKAI 120
           DWA MH E+T SQLRRFE+PDQ PF+P  IL PILP + YP++L+ YA +IN N  IKA+
Sbjct: 61  DWALMHSEITHSQLRRFESPDQTPFFPDKILKPILPSIHYPRVLSSYAAEINLNQEIKAV 120

Query: 121 YLDSVVPLVSLGEGTSWENLGSVTSCDIDCLQALSRRIHFGKFVAEAKFQLEPEKYTALI 180
           Y++ ++P+VS  +G SWEN GSV + DI+CLQ+LSRRIHFGKFVAEAKFQ +   Y+ +I
Sbjct: 121 YIEQIIPMVSKFDGESWENFGSVATIDIECLQSLSRRIHFGKFVAEAKFQADRALYSKMI 180

Query: 181 KNRDVDGIMDSITNKFVEDKILKRLQAKATVYGVDPLDRNCSKRVTPEYLAKIYKEYVIP 240
           K RD+DGI  SITN  VE+KIL+RL  KA VYGVDP ++   +++TPEYL KIYKE VIP
Sbjct: 181 KERDLDGIYRSITNSAVEEKILERLCLKAEVYGVDPSNKEGYRKITPEYLVKIYKELVIP 240

Query: 241 ITKEVEVEYLLRRL 254
           +TK+VEV+YLLRRL
Sbjct: 241 LTKKVEVDYLLRRL 254

>Scas_667.23
          Length = 258

 Score =  346 bits (888), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 165/254 (64%), Positives = 198/254 (77%)

Query: 1   MDFLDPKSVLNLDHIRHELVRMEDTIIFNFIERSYFPTCPVVYHANHERLPLPDFDGSFL 60
           MDFL P +VLNL +IR ELV+MEDTIIF FIERS+F TC  VY  NH  + +P+FDGSFL
Sbjct: 1   MDFLKPDTVLNLQNIRAELVKMEDTIIFQFIERSHFATCSSVYQPNHPGVSIPNFDGSFL 60

Query: 61  DWAHMHMEMTQSQLRRFEAPDQVPFYPGSILPPILPPVQYPKLLAPYAPQINYNDRIKAI 120
           DWA +H+E+T SQLRRFE+PD+ PF+P  IL PILP + YP +LA YA ++NYND+IK +
Sbjct: 61  DWALLHLEITHSQLRRFESPDETPFFPNEILKPILPSINYPPILASYASEVNYNDKIKKV 120

Query: 121 YLDSVVPLVSLGEGTSWENLGSVTSCDIDCLQALSRRIHFGKFVAEAKFQLEPEKYTALI 180
           Y+D +VPL+S  +G   EN GSV + D + LQ LSRRIHFGKFVAEAKFQ   E Y  LI
Sbjct: 121 YIDRIVPLISKYDGDQKENYGSVATRDCEVLQNLSRRIHFGKFVAEAKFQSAKELYIELI 180

Query: 181 KNRDVDGIMDSITNKFVEDKILKRLQAKATVYGVDPLDRNCSKRVTPEYLAKIYKEYVIP 240
           KN+DV+GIM  ITN  VE+KIL+RL  KA VYGVDP ++   +R+TPEYL KIYKE VIP
Sbjct: 181 KNKDVEGIMKHITNSAVEEKILERLTKKAEVYGVDPTNKEGERRITPEYLVKIYKEIVIP 240

Query: 241 ITKEVEVEYLLRRL 254
           ITKEVEVEYLLRRL
Sbjct: 241 ITKEVEVEYLLRRL 254

>YPR060C (ARO7) [5489] chr16 complement(674856..675626) Chorismate
           mutase, required for the synthesis of both phenylalanine
           and tyrosine [771 bp, 256 aa]
          Length = 256

 Score =  342 bits (876), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 159/254 (62%), Positives = 201/254 (79%)

Query: 1   MDFLDPKSVLNLDHIRHELVRMEDTIIFNFIERSYFPTCPVVYHANHERLPLPDFDGSFL 60
           MDF  P++VLNL +IR ELVRMED+IIF FIERS+F TCP VY ANH  L +P+F GSFL
Sbjct: 1   MDFTKPETVLNLQNIRDELVRMEDSIIFKFIERSHFATCPSVYEANHPGLEIPNFKGSFL 60

Query: 61  DWAHMHMEMTQSQLRRFEAPDQVPFYPGSILPPILPPVQYPKLLAPYAPQINYNDRIKAI 120
           DWA  ++E+  S++RRFE+PD+ PF+P  I    LP + YP++LAPYAP++NYND+IK +
Sbjct: 61  DWALSNLEIAHSRIRRFESPDETPFFPDKIQKSFLPSINYPQILAPYAPEVNYNDKIKKV 120

Query: 121 YLDSVVPLVSLGEGTSWENLGSVTSCDIDCLQALSRRIHFGKFVAEAKFQLEPEKYTALI 180
           Y++ ++PL+S  +G    N GSV + DI+CLQ+LSRRIHFGKFVAEAKFQ +   YT LI
Sbjct: 121 YIEKIIPLISKRDGDDKNNFGSVATRDIECLQSLSRRIHFGKFVAEAKFQSDIPLYTKLI 180

Query: 181 KNRDVDGIMDSITNKFVEDKILKRLQAKATVYGVDPLDRNCSKRVTPEYLAKIYKEYVIP 240
           K++DV+GIM +ITN  VE+KIL+RL  KA VYGVDP + +  +R+TPEYL KIYKE VIP
Sbjct: 181 KSKDVEGIMKNITNSAVEEKILERLTKKAEVYGVDPTNESGERRITPEYLVKIYKEIVIP 240

Query: 241 ITKEVEVEYLLRRL 254
           ITKEVEVEYLLRRL
Sbjct: 241 ITKEVEVEYLLRRL 254

>CAGL0K12232g complement(1194973..1195755) highly similar to
           sp|P32178 Saccharomyces cerevisiae YPR060c ARO7
           chorismate mutase, start by similarity
          Length = 260

 Score =  322 bits (824), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 159/259 (61%), Positives = 198/259 (76%), Gaps = 5/259 (1%)

Query: 1   MDFLDPKSVLNLDHIRHELVRMEDTIIFNFIERSYFPTCPVVYHANHERLPLPDFDGSFL 60
           MDF  P++VLNL +IR ELV+MED+IIF FIERS+FP C  VY  NH  L +PDF GSFL
Sbjct: 1   MDFTKPETVLNLQNIRDELVKMEDSIIFKFIERSHFPVCAPVYAPNHPDLNIPDFTGSFL 60

Query: 61  DWAHMHMEMTQSQLRRFEAPDQVPFYPGSILPPILPPVQYPKLLAPYAPQ-INYNDRIKA 119
           DWA + ME+T S+LRRF++PD+ PF+P  I  PILP + YPK+L   A + +NYN++IK+
Sbjct: 61  DWALLQMEITHSKLRRFDSPDETPFFPNDIQEPILPRINYPKILHEKASKPVNYNEKIKS 120

Query: 120 IYLDSVVPLVSLGEGTSWENLGSVTSCDIDCLQALSRRIHFGKFVAEAKFQLEPEKYTAL 179
           IY+  +VPL+S  +G S EN GSV + D++CLQ+LSRRIHFGKFVAEAKFQ + + YT +
Sbjct: 121 IYIKEIVPLISNSDGDSKENYGSVATRDMECLQSLSRRIHFGKFVAEAKFQSDIDLYTKM 180

Query: 180 IKNRDVDGIMDSITNKFVEDKILKRLQAKATVYGVDPL----DRNCSKRVTPEYLAKIYK 235
           I+ +DVDGIM SITN  VE+KIL+RL  KA VYGVDP          +R+TPEYL KIYK
Sbjct: 181 IREKDVDGIMSSITNAAVEEKILERLVRKADVYGVDPTTPVDSSEKVRRITPEYLVKIYK 240

Query: 236 EYVIPITKEVEVEYLLRRL 254
           E VIPITKEVEV+YLLRRL
Sbjct: 241 EIVIPITKEVEVDYLLRRL 259

>KLLA0E15356g complement(1359509..1361590) some similarities with
           sp|Q8NIZ7 Neurospora crassa Related to
           peptide-n4-(n-acetyl-beta-d-glucosaminyl)
           asparaginaseamidase N, hypothetical start
          Length = 693

 Score = 28.9 bits (63), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 127 PLVSLGEGTSWENLGSVTSCDIDCLQA-LSRRIHFGKFVAEAKF 169
           P++SL +  SW  +GSV   DID  ++ LS +   G+ V   K+
Sbjct: 555 PIISLVDKASWNLVGSVRMLDIDVSKSELSYKATVGRTVDRLKY 598

>Kwal_23.3426
          Length = 726

 Score = 28.9 bits (63), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 27/63 (42%)

Query: 135 TSWENLGSVTSCDIDCLQALSRRIHFGKFVAEAKFQLEPEKYTALIKNRDVDGIMDSITN 194
           + W  +G + S  ID L  LSRR          ++  E +    LIKN ++    D+  N
Sbjct: 518 SEWLVVGKLYSDAIDSLIVLSRRFLLNGKTNALRYLYESQDLDELIKNFEMQTFKDNNKN 577

Query: 195 KFV 197
            F 
Sbjct: 578 SFA 580

>ACL041C [1008] [Homologous to ScYER075C (PTP3) - SH]
           (289645..291942) [2298 bp, 765 aa]
          Length = 765

 Score = 28.9 bits (63), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 63/156 (40%), Gaps = 25/156 (16%)

Query: 72  SQLRRFEAPDQVPFYPGSILPPILPPVQYPKLLAPYAPQINYNDRIKAIYLDSVVPLVSL 131
           SQL +F+ P Q P   GS          +P++      + N N       L+S +  V +
Sbjct: 276 SQLFKFQLPTQRPLQNGS-------SHAFPRVFKMRHFEENSN-------LESYLGAVDI 321

Query: 132 GEGTSWENLGSVTSCDIDCLQALSRRIHFGKFVAEAKFQLEPEKYTALIKNRDVDGIMDS 191
            E          +  +    Q       F KF  +  FQLE  K T L K  ++D ++  
Sbjct: 322 NENRKLSEFDETSDSNGTRFQQ-----SFFKFPLKLSFQLEYAKITELYKQEEIDCVIP- 375

Query: 192 ITNKFVEDKILK--RLQAKATVYGVDPLDRNCSKRV 225
              K+++D +LK  ++Q       +D L+R    R+
Sbjct: 376 ---KWLQDLMLKPSKMQYVEQFQRLDILERTRLDRI 408

>YPL193W (RSA1) [5254] chr16 (181402..182547) Nucleoplasmic protein
           involved in assembly of 60S ribosomal subunits [1146 bp,
           381 aa]
          Length = 381

 Score = 28.5 bits (62), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 60/161 (37%), Gaps = 16/161 (9%)

Query: 47  HERLPLPDFDGSFLDW---AHMHMEMTQSQLRRFEAPD---QVPFYPGSILPPILPPVQ- 99
           H RLP P + G+  D    + +  + T S      +P      P+Y GS      P +  
Sbjct: 14  HSRLPKPTYSGTLSDGYDESKIKRQKTDSAFNAAYSPHMYPNSPYYEGSWNTGYTPQLHH 73

Query: 100 ---YPKLLAPYAPQINYNDRIKAIYLDSVVPLVSLGEGTSWE---NLGSVTSCDIDCLQA 153
              + +   P  P   YN      Y ++ +P V   +  S+    NL    S   +  QA
Sbjct: 74  VAPHNQYFHPIQPSTQYNYTSPPNYTENYIPPVH--QNISYAPALNLQKWPSSYCENTQA 131

Query: 154 LSRRIHFGKFVAEAKFQLEPEKYTALI-KNRDVDGIMDSIT 193
           L     +   ++     +   K   LI KNR  D  M+ I+
Sbjct: 132 LKNDKDYQTSISYEDVAIPTVKEIQLIEKNRGKDTFMNEIS 172

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.323    0.141    0.427 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,801,520
Number of extensions: 380340
Number of successful extensions: 1073
Number of sequences better than 10.0: 16
Number of HSP's gapped: 1070
Number of HSP's successfully gapped: 16
Length of query: 254
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 155
Effective length of database: 13,168,927
Effective search space: 2041183685
Effective search space used: 2041183685
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 60 (27.7 bits)