Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL324W1281266807e-94
Scas_718.5d1551252643e-30
KLLA0B08547g1211232223e-24
KLLA0B03454g47272760.023
AEL278W47661750.032
CAGL0G10021g39456700.12
YPR186C (PZF1)42985670.30
Kwal_23.540042956621.7
YMR180C (CTL1)32042602.8
Sklu_2389.276765594.1
KLLA0A10373g20690576.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL324W
         (126 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL324W [1417] [Homologous to NOHBY] complement(127252..127638) ...   266   7e-94
Scas_718.5d                                                           106   3e-30
KLLA0B08547g 756147..756512 no similarity, hypothetical start          90   3e-24
KLLA0B03454g complement(314015..315433) some similarities with s...    34   0.023
AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH] complement(...    33   0.032
CAGL0G10021g complement(959154..960338) similar to sp|P39933 Sac...    32   0.12 
YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA polym...    30   0.30 
Kwal_23.5400                                                           28   1.7  
YMR180C (CTL1) [4135] chr13 complement(622250..623212) RNA 5'-tr...    28   2.8  
Sklu_2389.2 YJL056C, Contig c2389 3525-5828                            27   4.1  
KLLA0A10373g complement(907244..907864) some similarities with c...    27   6.5  

>ADL324W [1417] [Homologous to NOHBY] complement(127252..127638)
           [387 bp, 128 aa]
          Length = 128

 Score =  266 bits (680), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 126/126 (100%), Positives = 126/126 (100%)

Query: 1   MPKRLRTEEYSCNQEDERSDSQVIVCNDPPCSGARISMHIYPSHVAEHHDNVCAACNKNM 60
           MPKRLRTEEYSCNQEDERSDSQVIVCNDPPCSGARISMHIYPSHVAEHHDNVCAACNKNM
Sbjct: 1   MPKRLRTEEYSCNQEDERSDSQVIVCNDPPCSGARISMHIYPSHVAEHHDNVCAACNKNM 60

Query: 61  ITERMLQLHLQELHDPFNSNKALECYEADCMQQFQTHSKRREHLITVHEYPMNARLDIVY 120
           ITERMLQLHLQELHDPFNSNKALECYEADCMQQFQTHSKRREHLITVHEYPMNARLDIVY
Sbjct: 61  ITERMLQLHLQELHDPFNSNKALECYEADCMQQFQTHSKRREHLITVHEYPMNARLDIVY 120

Query: 121 TGYNDT 126
           TGYNDT
Sbjct: 121 TGYNDT 126

>Scas_718.5d
          Length = 155

 Score =  106 bits (264), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 52/125 (41%), Positives = 74/125 (59%), Gaps = 4/125 (3%)

Query: 3   KRLRTEEYSCNQEDERSDSQV--IVCNDPPCSGARISMHIYPSHVAEHHDNVCAACNKNM 60
           K    E      EDE +D+    I+CN+PPC    I +  YP HV++ HDN+C  C+ N+
Sbjct: 29  KWAEEEVVGTTAEDEDNDNSTSRILCNEPPCVNNLIPLDSYPLHVSQFHDNICTKCDANL 88

Query: 61  ITERMLQLHLQELHDPF--NSNKALECYEADCMQQFQTHSKRREHLITVHEYPMNARLDI 118
           +T+ +L+LHL E H+PF  +S++ L C+E DC Q F T   R +HL   H YP     +I
Sbjct: 89  VTQYLLELHLVECHNPFVSSSHQPLHCFEKDCSQVFPTQMDRIDHLKNFHNYPDFYNFNI 148

Query: 119 VYTGY 123
           +YTGY
Sbjct: 149 IYTGY 153

>KLLA0B08547g 756147..756512 no similarity, hypothetical start
          Length = 121

 Score = 90.1 bits (222), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 69/123 (56%), Gaps = 4/123 (3%)

Query: 1   MPKRLRTEEYSCNQEDERSDSQVIVCNDPPCSGARISMHIYPSHVAEHHDNVCAACNKNM 60
           M KR  +EE+    E    +   ++C+DPPC    + + +YPSHV++ H+NVC  C +N 
Sbjct: 1   MSKRRSSEEHCGGYE---LNGNAVLCSDPPCDHEWVPIELYPSHVSQMHENVCTQCLRNF 57

Query: 61  ITERMLQLHLQELHDPF-NSNKALECYEADCMQQFQTHSKRREHLITVHEYPMNARLDIV 119
            +E  ++LH++E H+PF N N  L C E DC   F   ++R +HL   H Y      DI+
Sbjct: 58  ASEYWMELHIEEFHNPFKNGNYRLRCLEQDCSMTFSNSNERIDHLKRHHYYSDQFDFDIL 117

Query: 120 YTG 122
            +G
Sbjct: 118 NSG 120

>KLLA0B03454g complement(314015..315433) some similarities with
           sp|P39933 Saccharomyces cerevisiae YPR186c TFC2 TFIIIA
           (transcription initiation factor), hypothetical start
          Length = 472

 Score = 33.9 bits (76), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 32/72 (44%), Gaps = 9/72 (12%)

Query: 44  HVAEHHDN---VCAACNKNMITERMLQLHLQELHDPFNSNKALECYEADCMQQFQTHSKR 100
           H+  H D+    C+ C K + T + L+ H           K+  C    C + F  H + 
Sbjct: 155 HMFSHTDDKPFTCSICGKGVTTRQQLKRH------EITHTKSFHCSYEGCNESFYKHPQL 208

Query: 101 REHLITVHEYPM 112
           R H+++VHE  +
Sbjct: 209 RSHILSVHEKKL 220

 Score = 27.3 bits (59), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 34/81 (41%), Gaps = 6/81 (7%)

Query: 33  GARISMHIYP---SHVAEHHDN--VCAACNKNMITERMLQLHLQELHDPFNSNKALECYE 87
           G   S + +P   SH+   H+    C  CNK       L+ H+ + H+P  S    +C  
Sbjct: 197 GCNESFYKHPQLRSHILSVHEKKLTCPHCNKTFQRPYRLKNHIDKHHNP-ESTGMYQCDF 255

Query: 88  ADCMQQFQTHSKRREHLITVH 108
             C   F T S  ++H+   H
Sbjct: 256 LSCTDVFSTWSSLQQHIKQCH 276

>AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH]
           complement(117043..118473) [1431 bp, 476 aa]
          Length = 476

 Score = 33.5 bits (75), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 26/61 (42%), Gaps = 6/61 (9%)

Query: 53  CAACNKNMITERMLQLHLQELHDPFNSNKALECYEADCMQQFQTHSKRREHLITVHEYPM 112
           C  C K + T + L+ H           K+ +C    C + F  H + R H++ VHE  +
Sbjct: 180 CTVCGKGVTTRQQLRRH------EITHTKSFKCPHEGCGEAFYKHPQLRSHVLAVHEQKL 233

Query: 113 N 113
            
Sbjct: 234 T 234

 Score = 33.1 bits (74), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 3/68 (4%)

Query: 43  SHVAEHHDN--VCAACNKNMITERMLQLHLQELHDPFNSNKALECYEADCMQQFQTHSKR 100
           SHV   H+    C  C+K       L+ H+ + H P +  +  +C  A C+Q F+T S  
Sbjct: 223 SHVLAVHEQKLTCTHCDKRFQRPYRLKTHIAKHHGPASQFR-YQCTNAGCVQCFETWSAL 281

Query: 101 REHLITVH 108
           ++HL T H
Sbjct: 282 QQHLHTDH 289

>CAGL0G10021g complement(959154..960338) similar to sp|P39933
           Saccharomyces cerevisiae YPR186c TFC2, hypothetical
           start
          Length = 394

 Score = 31.6 bits (70), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 6/56 (10%)

Query: 53  CAACNKNMITERMLQLHLQELHDPFNSNKALECYEADCMQQFQTHSKRREHLITVH 108
           C+ C K +IT + L+ H           K+  C    C + F  H + R H++ VH
Sbjct: 97  CSFCGKGLITRQQLKRH------EVTHTKSFNCEYEGCNESFYKHPQLRAHILAVH 146

 Score = 28.1 bits (61), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 37/83 (44%), Gaps = 4/83 (4%)

Query: 26  CNDPPCSGARISMHIYPSHVAEHHDNVCAACNKNMITERMLQLHLQELHDPFNSNKALEC 85
           CN+      ++  HI   H+       C  CNK+      L+ H+ + H+P   N A +C
Sbjct: 128 CNESFYKHPQLRAHILAVHL---QSLKCHECNKSFQRPYRLKNHIAKHHNPDVVN-AYQC 183

Query: 86  YEADCMQQFQTHSKRREHLITVH 108
             + C + F+T S  R H+   H
Sbjct: 184 TFSVCSKSFKTWSALRLHVKNDH 206

>YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA
           polymerase III transcription initiation factor TFIIIA,
           has nine C2H2-type zinc fingers [1290 bp, 429 aa]
          Length = 429

 Score = 30.4 bits (67), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 36/85 (42%), Gaps = 9/85 (10%)

Query: 31  CSGARISMHIYPSHVAEHHDNV---CAACNKNMITERMLQLHLQELHDPFNSNKALECYE 87
           C+ + +       H+  H D     C+ C K + T + L+ H           K+  C E
Sbjct: 85  CAKSFVKKSHLERHLYTHSDTKPFQCSYCGKGVTTRQQLKRH------EVTHTKSFICPE 138

Query: 88  ADCMQQFQTHSKRREHLITVHEYPM 112
             C  +F  H + R H+++VH + +
Sbjct: 139 EGCNLRFYKHPQLRAHILSVHLHKL 163

 Score = 30.4 bits (67), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 44/97 (45%), Gaps = 9/97 (9%)

Query: 17  ERSDSQVIVCNDPPCS-----GARISMHIYPSHVAEHHDNVCAACNKNMITERMLQLHLQ 71
           E + ++  +C +  C+       ++  HI   H+   H   C  CNK+      L+ H+ 
Sbjct: 127 EVTHTKSFICPEEGCNLRFYKHPQLRAHILSVHL---HKLTCPHCNKSFQRPYRLRNHIS 183

Query: 72  ELHDPFNSNKALECYEADCMQQFQTHSKRREHLITVH 108
           + HDP   N   +C  A C ++F+  S+ + H+   H
Sbjct: 184 KHHDPEVEN-PYQCTFAGCCKEFRIWSQLQSHIKNDH 219

>Kwal_23.5400
          Length = 429

 Score = 28.5 bits (62), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 28/56 (50%), Gaps = 1/56 (1%)

Query: 53  CAACNKNMITERMLQLHLQELHDPFNSNKALECYEADCMQQFQTHSKRREHLITVH 108
           C  C K       L+ H+ + H+P +  +  +C +  C++ F+T S  ++H+   H
Sbjct: 166 CEICGKRFQRPYRLKNHIAKHHNP-DVVQKYQCSQGSCIEAFKTWSALQQHMKETH 220

>YMR180C (CTL1) [4135] chr13 complement(622250..623212) RNA
          5'-triphosphatase with manganese- or cobalt-dependent
          NTPase activities [963 bp, 320 aa]
          Length = 320

 Score = 27.7 bits (60), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 19/42 (45%)

Query: 42 PSHVAEHHDNVCAACNKNMITERMLQLHLQELHDPFNSNKAL 83
          PS+    H+NV A      +  +   LH+ E   P  S +AL
Sbjct: 8  PSNSRNSHENVGAKKADANVASKFRSLHISETTKPLTSTRAL 49

>Sklu_2389.2 YJL056C, Contig c2389 3525-5828
          Length = 767

 Score = 27.3 bits (59), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 7/65 (10%)

Query: 53  CAACNKNMITERMLQLHLQELHDPFNSNKALECYEADCMQQFQTHSKRREHLIT-VHEYP 111
           C  C K   TE +LQ H++      +  +  +C    C +QF T S  R H+ T   E P
Sbjct: 660 CPHCTKKFSTEDILQQHIRT----HSGERPFKC--TYCTKQFATSSSLRIHIRTHTGEKP 713

Query: 112 MNARL 116
           +  ++
Sbjct: 714 LKCKI 718

>KLLA0A10373g complement(907244..907864) some similarities with
           ca|CA1157|CaPZF1 Candida albicans TFIIIA (transcription
           initiation factor) (by homology), hypothetical start
          Length = 206

 Score = 26.6 bits (57), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 34/90 (37%), Gaps = 11/90 (12%)

Query: 26  CNDPPCSGARISMHIYPSHVAEH---HDNV----CAACNKNMITERMLQLHLQELHDPFN 78
           C +P C  A +     PSH+  H   H  V    C+ C K   T++  Q H Q      +
Sbjct: 40  CPEPGCDKAFLR----PSHLRVHMLSHSKVKPYNCSVCGKGFATKQQFQRHQQTHTQNQD 95

Query: 79  SNKALECYEADCMQQFQTHSKRREHLITVH 108
                +C    C     +     EH++ +H
Sbjct: 96  DTSTYQCGYYGCPFNAPSKEALNEHVLELH 125

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.131    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,434,551
Number of extensions: 168119
Number of successful extensions: 433
Number of sequences better than 10.0: 23
Number of HSP's gapped: 428
Number of HSP's successfully gapped: 30
Length of query: 126
Length of database: 16,596,109
Length adjustment: 89
Effective length of query: 37
Effective length of database: 13,515,107
Effective search space: 500058959
Effective search space used: 500058959
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 55 (25.8 bits)