Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL323C34133517920.0
Sklu_1926.434533412751e-177
Scas_667.2033833512461e-173
Kwal_27.1259033833612441e-173
YPR056W (TFB4)33833712361e-172
CAGL0D01650g33531911531e-159
KLLA0B08569g33734311441e-158
Kwal_55.19697176044730.54
CAGL0L09691g82447653.7
Scas_588.9*20636625.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL323C
         (335 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL323C [1418] [Homologous to ScYPR056W (TFB4) - SH] (127631..12...   694   0.0  
Sklu_1926.4 YPR056W, Contig c1926 2998-4035 reverse complement        495   e-177
Scas_667.20                                                           484   e-173
Kwal_27.12590                                                         483   e-173
YPR056W (TFB4) [5486] chr16 (671121..672137) RNA polymerase II t...   480   e-172
CAGL0D01650g complement(172035..173042) highly similar to tr|Q12...   448   e-159
KLLA0B08569g complement(756558..757571) similar to sgd|S0006260 ...   445   e-158
Kwal_55.19697                                                          33   0.54 
CAGL0L09691g complement(1039799..1042273) some similarities with...    30   3.7  
Scas_588.9*                                                            28   5.8  

>ADL323C [1418] [Homologous to ScYPR056W (TFB4) - SH]
           (127631..128656) [1026 bp, 341 aa]
          Length = 341

 Score =  694 bits (1792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/335 (100%), Positives = 335/335 (100%)

Query: 1   MDAIADSTFQINKSKVQLVEETPSLLTLVIDTNPKLWAEFDREVGKKGQLMQVLKSTIVF 60
           MDAIADSTFQINKSKVQLVEETPSLLTLVIDTNPKLWAEFDREVGKKGQLMQVLKSTIVF
Sbjct: 1   MDAIADSTFQINKSKVQLVEETPSLLTLVIDTNPKLWAEFDREVGKKGQLMQVLKSTIVF 60

Query: 61  LNAHLSFNNSNQVSVIAACSRGIKYLYPQADDKEGSTKKKKSEDRSIINRNMYRGFRNVD 120
           LNAHLSFNNSNQVSVIAACSRGIKYLYPQADDKEGSTKKKKSEDRSIINRNMYRGFRNVD
Sbjct: 61  LNAHLSFNNSNQVSVIAACSRGIKYLYPQADDKEGSTKKKKSEDRSIINRNMYRGFRNVD 120

Query: 121 EAVVEELYRVFQQESKQLEDGVPQPFRSTLSGAMSAGLTYINRITHETEGVSLKSRLLVI 180
           EAVVEELYRVFQQESKQLEDGVPQPFRSTLSGAMSAGLTYINRITHETEGVSLKSRLLVI
Sbjct: 121 EAVVEELYRVFQQESKQLEDGVPQPFRSTLSGAMSAGLTYINRITHETEGVSLKSRLLVI 180

Query: 181 TCGSSASKDEVFQYIPIMNCIFSATKMKCPIDVVKVGGVKESTFLQQATDATNGNYLHVA 240
           TCGSSASKDEVFQYIPIMNCIFSATKMKCPIDVVKVGGVKESTFLQQATDATNGNYLHVA
Sbjct: 181 TCGSSASKDEVFQYIPIMNCIFSATKMKCPIDVVKVGGVKESTFLQQATDATNGNYLHVA 240

Query: 241 NTDGLIQYLSTAMFIDPSLRQWVVKPNQSSVDFRTSCYLTGKVVAIGFVCSVCLCVLSII 300
           NTDGLIQYLSTAMFIDPSLRQWVVKPNQSSVDFRTSCYLTGKVVAIGFVCSVCLCVLSII
Sbjct: 241 NTDGLIQYLSTAMFIDPSLRQWVVKPNQSSVDFRTSCYLTGKVVAIGFVCSVCLCVLSII 300

Query: 301 PPGNKCPACDSEFDEKVVAKLSRKPVITGTLRKKK 335
           PPGNKCPACDSEFDEKVVAKLSRKPVITGTLRKKK
Sbjct: 301 PPGNKCPACDSEFDEKVVAKLSRKPVITGTLRKKK 335

>Sklu_1926.4 YPR056W, Contig c1926 2998-4035 reverse complement
          Length = 345

 Score =  495 bits (1275), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 236/334 (70%), Positives = 273/334 (81%), Gaps = 5/334 (1%)

Query: 1   MDAIADSTFQINKSKVQLVEETPSLLTLVIDTNPKLWAEFDREVGKKGQLMQVLKSTIVF 60
           MDAI+DSTFQ  KSK  + EE PSLLT+V+DT PKLWAE D+E   KG L+  L+S IVF
Sbjct: 1   MDAISDSTFQNTKSKTSITEENPSLLTVVVDTTPKLWAELDKESNSKGNLISALQSLIVF 60

Query: 61  LNAHLSFNNSNQVSVIAACSRGIKYLYPQADDKEGSTKKKKS-----EDRSIINRNMYRG 115
           LNAHL+FNNSNQV+VIAA S G+KYLYP+    EG+     S     +D SIIN +MYR 
Sbjct: 61  LNAHLAFNNSNQVAVIAAHSTGLKYLYPKTATTEGTGASSSSVVSGRKDLSIINNDMYRQ 120

Query: 116 FRNVDEAVVEELYRVFQQESKQLEDGVPQPFRSTLSGAMSAGLTYINRITHETEGVSLKS 175
           FRNVDE VVEELY++FQQE ++         RSTLSGA+SAGLTYINR+  E E ++LKS
Sbjct: 121 FRNVDETVVEELYKLFQQEKEENNSTSNGVGRSTLSGAISAGLTYINRVNKENENITLKS 180

Query: 176 RLLVITCGSSASKDEVFQYIPIMNCIFSATKMKCPIDVVKVGGVKESTFLQQATDATNGN 235
           RLLV TCGSS  +DE+FQYIPIMNCIF+ATKMKCPIDVVK+GGV+ESTFLQQATDATNG 
Sbjct: 181 RLLVTTCGSSGGRDEIFQYIPIMNCIFTATKMKCPIDVVKIGGVQESTFLQQATDATNGV 240

Query: 236 YLHVANTDGLIQYLSTAMFIDPSLRQWVVKPNQSSVDFRTSCYLTGKVVAIGFVCSVCLC 295
           YLHV +T+GLIQYL TAMFIDPSLR  +VKPNQ SVDFRTSC+LTG+VVA+GFVCSVCLC
Sbjct: 241 YLHVDSTEGLIQYLCTAMFIDPSLRHVIVKPNQGSVDFRTSCFLTGRVVAVGFVCSVCLC 300

Query: 296 VLSIIPPGNKCPACDSEFDEKVVAKLSRKPVITG 329
           VLSIIPPGNKCPACD+EFDE+V+ KL RKPV+ G
Sbjct: 301 VLSIIPPGNKCPACDAEFDERVITKLKRKPVVPG 334

>Scas_667.20
          Length = 338

 Score =  484 bits (1246), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 235/335 (70%), Positives = 277/335 (82%), Gaps = 7/335 (2%)

Query: 1   MDAIADSTFQINKSKVQLVEETPSLLTLVIDTNPKLWAEFDREVGKKGQLMQVLKSTIVF 60
           MDAIAD TFQ  K +  + EETPSLLT+++D  PKLWAE D E+ +KG L+ VLKS +VF
Sbjct: 1   MDAIADPTFQHTKVRSSITEETPSLLTVIVDITPKLWAELDEEINEKGNLINVLKSLLVF 60

Query: 61  LNAHLSFNNSNQVSVIAACSRGIKYLYPQAD-DKEGSTKKKKSEDRSIINRNMYRGFRNV 119
           LNAHL+FN+SNQV+VIAA S+GIKYL+P+     +G    KK  D SIIN++MYR FRNV
Sbjct: 61  LNAHLAFNSSNQVAVIAAHSQGIKYLFPKNSISVKGVNSGKK--DLSIINKDMYRRFRNV 118

Query: 120 DEAVVEELYRVFQQESKQLEDGVPQPFRSTLSGAMSAGLTYINRITHETEGVSLKSRLLV 179
           DE +V+ELY +F++E KQ+ + V Q  +STLSGAMSAGLTYINR+T E E +SLKSRL+V
Sbjct: 119 DETLVDELYALFEEELKQV-NTVTQ--KSTLSGAMSAGLTYINRVTKELEAISLKSRLMV 175

Query: 180 ITCGSSA-SKDEVFQYIPIMNCIFSATKMKCPIDVVKVGGVKESTFLQQATDATNGNYLH 238
           +TCG    SKDE+FQYIPIMNCIFSATK+KCPIDVVK+GG KESTFLQQ TDATNG YLH
Sbjct: 176 LTCGGKGESKDEIFQYIPIMNCIFSATKIKCPIDVVKIGGSKESTFLQQTTDATNGAYLH 235

Query: 239 VANTDGLIQYLSTAMFIDPSLRQWVVKPNQSSVDFRTSCYLTGKVVAIGFVCSVCLCVLS 298
           V +T GLIQYL+TAMFIDPSLRQ +VKPN  SVDFRTSCYLTGKVVA+GF+CSVCLCVLS
Sbjct: 236 VESTKGLIQYLATAMFIDPSLRQIIVKPNHGSVDFRTSCYLTGKVVAVGFICSVCLCVLS 295

Query: 299 IIPPGNKCPACDSEFDEKVVAKLSRKPVITGTLRK 333
           IIPPGNKCPACDSEFDE V+AKL +KPV+    +K
Sbjct: 296 IIPPGNKCPACDSEFDEHVIAKLKKKPVVPRVAKK 330

>Kwal_27.12590
          Length = 338

 Score =  483 bits (1244), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 233/336 (69%), Positives = 271/336 (80%), Gaps = 5/336 (1%)

Query: 1   MDAIADSTFQINKSKVQLVEETPSLLTLVIDTNPKLWAEFDREVGKKGQLMQVLKSTIVF 60
           MDAI+D +FQ  KSK+ + EE PSLLT+++DT PK+WAE D+E  ++G L+  L+S IVF
Sbjct: 1   MDAISDPSFQNTKSKIAVAEELPSLLTVIVDTMPKVWAELDKEGSQEGSLISALQSLIVF 60

Query: 61  LNAHLSFNNSNQVSVIAACSRGIKYLYPQADDKEGSTKKKKSEDRSIINRNMYRGFRNVD 120
           LNAHLSFN++NQV+VIAA S GIKYL+P     +      KS D SIIN NMYR FRNVD
Sbjct: 61  LNAHLSFNSANQVAVIAAHSTGIKYLFPTPPSSQ-EEPAAKSPDLSIINSNMYRQFRNVD 119

Query: 121 EAVVEELYRVFQQESKQLEDGVPQPF-RSTLSGAMSAGLTYINRITHETEGVSLKSRLLV 179
           E V+EELY++ Q E K+    +P  F +STLSGAMSAG TYINR+  E    SLK+RL+V
Sbjct: 120 ETVLEELYKLLQDEKKR---KIPSGFQKSTLSGAMSAGFTYINRVIKEQSTASLKARLMV 176

Query: 180 ITCGSSASKDEVFQYIPIMNCIFSATKMKCPIDVVKVGGVKESTFLQQATDATNGNYLHV 239
           +TCGSS  KDE+FQYIPIMNCIFSATK+KCPIDVVK+GG +ESTFLQQATDATNG YLHV
Sbjct: 177 MTCGSSGGKDEIFQYIPIMNCIFSATKLKCPIDVVKIGGSQESTFLQQATDATNGVYLHV 236

Query: 240 ANTDGLIQYLSTAMFIDPSLRQWVVKPNQSSVDFRTSCYLTGKVVAIGFVCSVCLCVLSI 299
            +T+GLIQYL+TAMFIDPSLR  VVKPNQ SVDFRTSCYLTGKVVA+GFVCSVCLCVLSI
Sbjct: 237 PSTEGLIQYLTTAMFIDPSLRPIVVKPNQGSVDFRTSCYLTGKVVAVGFVCSVCLCVLSI 296

Query: 300 IPPGNKCPACDSEFDEKVVAKLSRKPVITGTLRKKK 335
           IPPGNKCPACDSEFDE V  KL R+PV+ G   KKK
Sbjct: 297 IPPGNKCPACDSEFDEHVTTKLKRRPVVPGIAAKKK 332

>YPR056W (TFB4) [5486] chr16 (671121..672137) RNA polymerase II
           transcription initiation factor TFIIH (factor b), 37 kDa
           subunit [1017 bp, 338 aa]
          Length = 338

 Score =  480 bits (1236), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 227/337 (67%), Positives = 277/337 (82%), Gaps = 5/337 (1%)

Query: 1   MDAIADSTFQINKSKVQLVEETPSLLTLVIDTNPKLWAEFDREVGKKGQLMQVLKSTIVF 60
           MDAI+D TF+  +S+ Q+ EE+PSLLT++I+  PKLW  FD E  +KG +++VL++ IVF
Sbjct: 1   MDAISDPTFKHARSRKQVTEESPSLLTVIIEIAPKLWTTFDEEGNEKGSIIKVLEALIVF 60

Query: 61  LNAHLSFNNSNQVSVIAACSRGIKYLYPQADD--KEGSTKKKKSEDRSIINRNMYRGFRN 118
           LNAHL+FN++N+V+VIAA S+GIKYLYP++    K   ++ K   D  IIN +MYR FRN
Sbjct: 61  LNAHLAFNSANKVAVIAAYSQGIKYLYPESTSALKASESENKTRSDLKIINSDMYRRFRN 120

Query: 119 VDEAVVEELYRVFQQESKQLEDGVPQPFRSTLSGAMSAGLTYINRITHETEGVSLKSRLL 178
           VDE +VEE+Y++F+ E KQ+E       RSTL+GAMSAGLTY+NRI+ E+   SLKSRLL
Sbjct: 121 VDETLVEEIYKLFELEKKQIEQNSQ---RSTLAGAMSAGLTYVNRISKESVTTSLKSRLL 177

Query: 179 VITCGSSASKDEVFQYIPIMNCIFSATKMKCPIDVVKVGGVKESTFLQQATDATNGNYLH 238
           V+TCGS +SKDE+FQYIPIMNCIFSATKMKCPIDVVK+GG KESTFLQQ TDATNG YLH
Sbjct: 178 VLTCGSGSSKDEIFQYIPIMNCIFSATKMKCPIDVVKIGGSKESTFLQQTTDATNGVYLH 237

Query: 239 VANTDGLIQYLSTAMFIDPSLRQWVVKPNQSSVDFRTSCYLTGKVVAIGFVCSVCLCVLS 298
           V +T+GLIQYL+TAMFIDPSLR  +VKPN  SVDFRTSCYLTG+VVA+GF+CSVCLCVLS
Sbjct: 238 VESTEGLIQYLATAMFIDPSLRPIIVKPNHGSVDFRTSCYLTGRVVAVGFICSVCLCVLS 297

Query: 299 IIPPGNKCPACDSEFDEKVVAKLSRKPVITGTLRKKK 335
           IIPPGNKCPACDS+FDE V+AKL RKPV+     KKK
Sbjct: 298 IIPPGNKCPACDSQFDEHVIAKLKRKPVVPRLKAKKK 334

>CAGL0D01650g complement(172035..173042) highly similar to tr|Q12004
           Saccharomyces cerevisiae YPR056w TFB4, start by
           similarity
          Length = 335

 Score =  448 bits (1153), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 210/319 (65%), Positives = 260/319 (81%), Gaps = 4/319 (1%)

Query: 1   MDAIADSTFQINKSKVQLVEETPSLLTLVIDTNPKLWAEFDREVGKKGQLMQVLKSTIVF 60
           MDAIAD  FQ  K +    E+ PSLLT+V+D +P+LWAEFD   G+K  +  VLKS IVF
Sbjct: 1   MDAIADPNFQQTKLRSTATEDIPSLLTVVLDISPRLWAEFDHRSGEKQSVTTVLKSLIVF 60

Query: 61  LNAHLSFNNSNQVSVIAACSRGIKYLYPQADDKEGSTKKKKSEDRSIINRNMYRGFRNVD 120
           LN+HL+FN++NQV+VIAA S+GI+YLYP++ D         S+D SII+ +MYR FRNVD
Sbjct: 61  LNSHLAFNSANQVAVIAAFSQGIQYLYPRSSDT-SEQNAGNSKDLSIISSHMYRRFRNVD 119

Query: 121 EAVVEELYRVFQQESKQLEDGVPQPFRSTLSGAMSAGLTYINRITHETEGVSLKSRLLVI 180
           E ++EE Y+++Q+E   ++  V    +STLSGAM+A LTY NR+T E E +SL+SRLLVI
Sbjct: 120 ETLIEEFYKLYQREESLIDKPVQ---KSTLSGAMAAALTYTNRLTKEFESISLRSRLLVI 176

Query: 181 TCGSSASKDEVFQYIPIMNCIFSATKMKCPIDVVKVGGVKESTFLQQATDATNGNYLHVA 240
           TCGSS  KDE+FQYIPIMNCIFSATK+KCPIDV+K+GG K+STFLQQ TDATNG Y+H+ 
Sbjct: 177 TCGSSREKDEIFQYIPIMNCIFSATKLKCPIDVIKIGGNKQSTFLQQTTDATNGVYIHLE 236

Query: 241 NTDGLIQYLSTAMFIDPSLRQWVVKPNQSSVDFRTSCYLTGKVVAIGFVCSVCLCVLSII 300
           +T+G+IQYLSTAM IDPSLRQ +V+P Q SVDFRTSCYLTGKVVAIG++CSVCLCVLSII
Sbjct: 237 STNGIIQYLSTAMSIDPSLRQIIVRPTQGSVDFRTSCYLTGKVVAIGYICSVCLCVLSII 296

Query: 301 PPGNKCPACDSEFDEKVVA 319
           PPGNKCPACDS+FDE+V+A
Sbjct: 297 PPGNKCPACDSQFDERVIA 315

>KLLA0B08569g complement(756558..757571) similar to sgd|S0006260
           Saccharomyces cerevisiae YPR056w TFB4 component of RNA
           polymerase transcription initiation TFIIH factor, start
           by similarity
          Length = 337

 Score =  445 bits (1144), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 218/343 (63%), Positives = 264/343 (76%), Gaps = 19/343 (5%)

Query: 1   MDAIADSTFQINKSKVQLVEETPSLLTLVIDTNPKLWAEFDRE--------VGKKGQLMQ 52
           MDAIAD+ FQ  KSK Q +E+TPSLLT+V+DT+   W +  ++           + QL++
Sbjct: 1   MDAIADTVFQGTKSKTQEIEDTPSLLTVVVDTSIHSWVQLTKQQSGSGSEGSSGEKQLIE 60

Query: 53  VLKSTIVFLNAHLSFNNSNQVSVIAACSRGIKYLYPQADDKEGSTKKKKSEDRSIINRNM 112
            LKS +VFLNAHL+FN+ NQV +IAA S G+KYLYP AD K            S+++ +M
Sbjct: 61  ALKSIVVFLNAHLAFNSGNQVCLIAAHSEGMKYLYPSADSKP---------SMSMVSSDM 111

Query: 113 YRGFRNVDEAVVEELYRVFQQESKQLEDGVPQPFRSTLSGAMSAGLTYINRITHETEGVS 172
           YRGFRNVDE VVE+ YR+F++E +  E  V    +S+LSGAMS+ LTY+NRI  E E  S
Sbjct: 112 YRGFRNVDEIVVEQWYRLFKEELEGQESKVS--MKSSLSGAMSSALTYVNRILKENENTS 169

Query: 173 LKSRLLVITCGSSASKDEVFQYIPIMNCIFSATKMKCPIDVVKVGGVKESTFLQQATDAT 232
           L+SRLLVITCG+S  KDE+FQYIPIMNCIFSATKMKC IDVVK+GG  ESTFLQQATDAT
Sbjct: 170 LRSRLLVITCGTSQGKDEIFQYIPIMNCIFSATKMKCSIDVVKIGGGIESTFLQQATDAT 229

Query: 233 NGNYLHVANTDGLIQYLSTAMFIDPSLRQWVVKPNQSSVDFRTSCYLTGKVVAIGFVCSV 292
           +G YLHV NT GLIQYLSTAMFIDPSLR  ++KPNQ SVDFRTSC+LTGKVVA+GFVCSV
Sbjct: 230 SGVYLHVENTRGLIQYLSTAMFIDPSLRNVIIKPNQGSVDFRTSCFLTGKVVAVGFVCSV 289

Query: 293 CLCVLSIIPPGNKCPACDSEFDEKVVAKLSRKPVITGTLRKKK 335
           CLCVLS+IPPG KCPACDS FD K++A+L RKPV++  + KKK
Sbjct: 290 CLCVLSVIPPGQKCPACDSPFDSKIIARLRRKPVLSNGVPKKK 332

>Kwal_55.19697
          Length = 1760

 Score = 32.7 bits (73), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (56%)

Query: 39  EFDREVGKKGQLMQVLKSTIVFLNAHLSFNNSNQVSVIAACSRG 82
           EF RE+  K +L+++L+  +  L + L F NS Q S  AA +  
Sbjct: 288 EFTREMSLKQRLVELLEGQVSALKSELEFKNSPQASTDAATTES 331

>CAGL0L09691g complement(1039799..1042273) some similarities with
           sp|P25502 Saccharomyces cerevisiae YKL015w PUT3 positive
           activator of the proline utilisation pathway,
           hypothetical start
          Length = 824

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 6/47 (12%)

Query: 197 IMNCIFSATKMKCPIDVVKVGGVKE---STFLQQATDATNGNYLHVA 240
           + NC+FS  +++C   V K GG++     +F  Q  D T  +Y ++ 
Sbjct: 362 LFNCLFSGERLEC---VTKEGGIEALLLYSFYLQVLDCTVASYFYIG 405

>Scas_588.9*
          Length = 206

 Score = 28.5 bits (62), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 25/36 (69%), Gaps = 2/36 (5%)

Query: 103 EDRSIINRNMYRGFRNVDEAVVEELYRVFQQESKQL 138
           EDR+  N  MY+  R+++++++EE  +VF QE + L
Sbjct: 172 EDRT--NEVMYQEARDLNKSLLEEYMKVFPQEKQWL 205

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.133    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,604,906
Number of extensions: 442855
Number of successful extensions: 1369
Number of sequences better than 10.0: 17
Number of HSP's gapped: 1372
Number of HSP's successfully gapped: 17
Length of query: 335
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 233
Effective length of database: 13,065,073
Effective search space: 3044162009
Effective search space used: 3044162009
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)