Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL322C50149225190.0
Sklu_1926.550950515350.0
Kwal_27.1258650949613061e-177
KLLA0E11297g51250912581e-170
YBR103W (SIF2)53552812301e-165
CAGL0K12188g53553411671e-156
Scas_718.6*54654210811e-142
AEL246C8151771657e-12
YNL317W (PFS2)4652511639e-12
Scas_720.955152561612e-11
CAGL0J03476g5172281593e-11
Kwal_23.63245142541583e-11
YCR072C5152901558e-11
AER263C5132661522e-10
AGL196C9352321532e-10
YDL145C (COP1)12011911496e-10
Scas_585.84602521478e-10
KLLA0E23529g8261771471e-09
Scas_707.227302521461e-09
AGL234W6292631461e-09
Scas_713.509832331461e-09
Sklu_2173.25152751432e-09
Scas_624.1112052291443e-09
YPR178W (PRP4)4651251423e-09
YNL006W (LST8)3032161403e-09
YBR198C (TAF5)7981781424e-09
KLLA0C08547g5152761414e-09
Kwal_27.115858231361408e-09
AFL009C4131061389e-09
ADL184W4492511371e-08
AAL009C3032161351e-08
CAGL0A00561g4122041361e-08
Sklu_2431.127491621381e-08
Kwal_23.50357442301372e-08
CAGL0L00781g6731981372e-08
Sklu_2442.23032161342e-08
CAGL0M05335g8062041372e-08
YCR084C (TUP1)7131511362e-08
CAGL0M04081g4552491333e-08
CAGL0I03718g12011601354e-08
KLLA0E24508g3272741314e-08
Sklu_2364.45551751334e-08
Kwal_0.2123032161305e-08
KLLA0D04840g3032161305e-08
Scas_721.328221621336e-08
KLLA0F10263g6822981326e-08
Kwal_47.175675901831301e-07
YFL009W (CDC4)7792881301e-07
KLLA0C08976g9112331301e-07
Kwal_56.2452612101351292e-07
AFL007C5511831282e-07
CAGL0H03729g3032161252e-07
ADR077C12041351282e-07
KLLA0E07073g4522491272e-07
AEL269C4552411262e-07
KLLA0E12287g3261461244e-07
KLLA0F27511g6231871254e-07
Kwal_23.53514742441244e-07
CAGL0L03201g5791641245e-07
AAR057W9222091255e-07
Kwal_55.220674512571236e-07
Sklu_2382.212612741256e-07
Scas_720.83d9151721246e-07
KLLA0E21263g4292581227e-07
Scas_695.153272201219e-07
CAGL0C01441g10051451231e-06
CAGL0E00561g8362781221e-06
YGL003C (CDH1)5661831221e-06
Kwal_27.122393161441201e-06
CAGL0L02629g7952451221e-06
Kwal_23.62409131701211e-06
Scas_397.24101091201e-06
YMR116C (ASC1)3192991182e-06
CAGL0M04279g9402311212e-06
AGL024W7562181202e-06
Kwal_47.175554171171192e-06
Scas_631.174741301192e-06
Kwal_23.57696272721202e-06
CAGL0C00737g8161211202e-06
KLLA0F13244g8141361183e-06
CAGL0E02805g8401851183e-06
KLLA0D07546g6471921183e-06
KLLA0F04884g12121351183e-06
KLLA0E18986g990931184e-06
CAGL0J01287g6101251174e-06
Scas_630.66212661174e-06
CAGL0K09284g9112091175e-06
AFL118W8322041175e-06
AER255C4672681165e-06
Kwal_26.77386112461165e-06
KLLA0A04928g8611861166e-06
Scas_592.4*3182981146e-06
YKR036C (CAF4)6592831166e-06
Scas_680.113471341146e-06
Scas_721.115*3182981146e-06
KLLA0D16390g9362321157e-06
YCR057C (PWP2)9231681158e-06
YMR146C (TIF34)3471301138e-06
YLR129W (DIP2)9432321158e-06
YIL046W (MET30)6401401141e-05
CAGL0C03608g6432861131e-05
Kwal_26.89534582581131e-05
CAGL0G04345g7112381131e-05
Sklu_2416.54592511121e-05
Scas_629.126712751131e-05
Kwal_33.154757831781131e-05
YMR102C8342361131e-05
Scas_603.55892521121e-05
Kwal_56.239209372321132e-05
ADL082C5692711122e-05
CAGL0L06952g3471341112e-05
CAGL0A00605g6402701112e-05
ACR166W3881431102e-05
YBL008W (HIR1)8401991112e-05
AEL314W7152431112e-05
YGL004C (RPN14)4171181102e-05
Scas_670.215951831102e-05
YLR222C (UTP13)8171211103e-05
Scas_704.406082081103e-05
Sklu_2291.4997981103e-05
YGL137W (SEC27)8891381103e-05
AFL056C9761061103e-05
ACR137W4251611093e-05
CAGL0H08932g9021381094e-05
Kwal_27.120537552591094e-05
AGR168W8251931085e-05
KLLA0B01958g8902131085e-05
Sklu_675.1308881065e-05
Scas_679.288151211085e-05
KLLA0E21879g3333261066e-05
Scas_658.14421361076e-05
AER448W7141171076e-05
Kwal_23.41189391691076e-05
Kwal_26.87764332471066e-05
YPL183C10131601077e-05
Kwal_33.13515398851058e-05
CAGL0F06853g3881431058e-05
Sklu_1645.25872111068e-05
Scas_702.168161901069e-05
Scas_721.73251311049e-05
ADR264C3461231041e-04
CAGL0D02090g277811031e-04
Sklu_1659.26131991051e-04
AGR207C3202031041e-04
CAGL0A02772g4411721041e-04
Scas_701.4512762771051e-04
Sklu_2172.62631831021e-04
KLLA0E07942g3901121031e-04
AFR199C3341421022e-04
KLLA0B02827g9422271032e-04
Kwal_34.15818349901012e-04
Scas_711.116951741022e-04
Scas_692.294562281022e-04
Kwal_27.111269961601032e-04
CAGL0K00275g7151861023e-04
CAGL0M06193g3161151003e-04
CAGL0G09845g5002041013e-04
YBL106C (SRO77)1010941014e-04
Kwal_56.223453962221004e-04
YBR175W (SWD3)315196985e-04
YJL112W (MDV1)714177996e-04
Kwal_14.884395154986e-04
AGR180W806121996e-04
Kwal_23.6429750267996e-04
CAGL0M02277g427166986e-04
Scas_465.4100294996e-04
KLLA0F11231g434149986e-04
CAGL0M09845g936165997e-04
YER066W18593957e-04
Scas_558.3725164987e-04
AER081C1023148987e-04
Sklu_2332.736798978e-04
Kwal_27.10385536136979e-04
KLLA0E04741g459214970.001
Kwal_56.244781296140970.001
ABL043W606143970.001
Sklu_2420.2441161960.001
KLLA0F22000g793184970.001
CAGL0M08646g337307950.001
YOR212W (STE4)42385950.001
Sklu_2423.1944170960.001
CAGL0B03575g419218950.001
Sklu_2318.1711167960.001
AFL014C557191950.001
CAGL0L02761g419224950.002
YLR409C (UTP21)939135950.002
Sklu_1963.2314172940.002
Kwal_56.23895367176940.002
KLLA0F07403g347141930.002
Kwal_14.1710574140940.002
Sklu_2317.3368139930.002
ACL116W80485940.002
CAGL0K11638g592107940.002
Kwal_27.1078536786920.003
AGL301C36156920.003
Sklu_2364.2411110920.004
YPL151C (PRP46)451159920.004
AGL190W370135910.004
Kwal_27.10573101592920.004
CAGL0G03399g369154910.004
Kwal_26.757021880890.004
ADR108C299117900.005
Sklu_1880.3471319910.005
KLLA0D06787g436220900.005
YDR364C (CDC40)455165900.005
YKL021C (MAK11)468107900.006
YDR267C330253900.006
Scas_700.27*433133900.006
Scas_719.52628140900.007
CAGL0F07337g621112900.007
Kwal_27.12667721173900.007
Scas_717.68908115900.007
Scas_510.5362106890.008
Scas_657.13411181880.009
Sklu_2406.1142685880.010
KLLA0D00814g408158880.011
KLLA0F21406g705169880.011
YER107C (GLE2)36585870.011
ACR017W423147880.011
YDR142C (PEX7)37583870.012
ACR097W467123870.013
KLLA0A08866g42380870.013
Scas_605.1842485870.013
Scas_571.4601151870.014
Kwal_47.17465800145880.014
KLLA0B14410g706162870.015
KLLA0E20779g37197860.016
Scas_719.30940109870.017
Kwal_47.17827523112860.021
Kwal_26.8628422216850.022
Kwal_55.21450503104850.023
Kwal_26.8975445322850.024
YCL039W (GID7)745101860.024
KLLA0D02530g707215850.025
AAR102C591209850.027
CAGL0L09647g429129840.028
YDL195W (SEC31)1273165850.028
Kwal_56.23685110285850.029
KLLA0E03982g372152840.029
AER114W633132850.030
Scas_715.351034151850.033
YMR092C (AIP1)615110840.035
KLLA0F13772g52099840.035
CAGL0H00781g51392840.037
Scas_660.7*603158840.037
KLLA0E19613g572101840.037
KLLA0F19734g1133180840.041
ABL024W734113840.042
Sklu_2435.13575413830.042
YAR003W (SWD1)42661830.044
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL322C
         (492 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH] (128830..13...   974   0.0  
Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement        595   0.0  
Kwal_27.12586                                                         507   e-177
KLLA0E11297g complement(994770..996308) similar to sp|P38262 Sac...   489   e-170
YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in t...   478   e-165
CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces...   454   e-156
Scas_718.6*                                                           421   e-142
AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH] (172849..1...    68   7e-12
YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation facto...    67   9e-12
Scas_720.95                                                            67   2e-11
CAGL0J03476g 331933..333486 highly similar to sp|P25382 Saccharo...    66   3e-11
Kwal_23.6324                                                           65   3e-11
YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein ...    64   8e-11
AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)...    63   2e-10
AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH] (328838..33...    64   2e-10
YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer (C...    62   6e-10
Scas_585.8                                                             61   8e-10
KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces...    61   1e-09
Scas_707.22                                                            61   1e-09
AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH] complement(...    61   1e-09
Scas_713.50                                                            61   1e-09
Sklu_2173.2 YCR072C, Contig c2173 2732-4279                            60   2e-09
Scas_624.11                                                            60   3e-09
YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associa...    59   3e-09
YNL006W (LST8) [4579] chr14 (620066..620977) Protein required fo...    59   3e-09
YBR198C (TAF5) [381] chr2 complement(616084..618480) Component o...    59   4e-09
KLLA0C08547g 749737..751284 highly similar to sp|P25382 Saccharo...    59   4e-09
Kwal_27.11585                                                          59   8e-09
AFL009C [3184] [Homologous to ScYGL004C - SH] (420007..421248) [...    58   9e-09
ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH] complement(...    57   1e-08
AAL009C [178] [Homologous to ScYNL006W (LST8) - SH] (325785..326...    57   1e-08
CAGL0A00561g complement(63710..64948) similar to sp|P53196 Sacch...    57   1e-08
Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement      58   1e-08
Kwal_23.5035                                                           57   2e-08
CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces cer...    57   2e-08
Sklu_2442.2 YNL006W, Contig c2442 3831-4742                            56   2e-08
CAGL0M05335g complement(569132..571552) similar to sp|P38129 Sac...    57   2e-08
YCR084C (TUP1) [608] chr3 complement(260307..262448) General rep...    57   2e-08
CAGL0M04081g complement(450572..451939) highly similar to sp|P42...    56   3e-08
CAGL0I03718g complement(317565..321170) highly similar to sp|P53...    57   4e-08
KLLA0E24508g complement(2175775..2176758) similar to sp|P38123 S...    55   4e-08
Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement         56   4e-08
Kwal_0.212                                                             55   5e-08
KLLA0D04840g 413362..414273 highly similar to sp|P41318 Saccharo...    55   5e-08
Scas_721.32                                                            56   6e-08
KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA Kluy...    55   6e-08
Kwal_47.17567                                                          55   1e-07
YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and co...    55   1e-07
KLLA0C08976g 784536..787271 highly similar to sgd|S0000653 Sacch...    55   1e-07
Kwal_56.24526                                                          54   2e-07
AFL007C [3186] [Homologous to ScYGL003C (CDH1) - SH] (424004..42...    54   2e-07
CAGL0H03729g 342948..343859 highly similar to sp|P41318 Saccharo...    53   2e-07
ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH] (843171..84...    54   2e-07
KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces c...    54   2e-07
AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH] (134760..13...    53   2e-07
KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to ...    52   4e-07
KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces...    53   4e-07
Kwal_23.5351                                                           52   4e-07
CAGL0L03201g complement(366795..368534) some similarities with s...    52   5e-07
AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH] complement(4...    53   5e-07
Kwal_55.22067                                                          52   6e-07
Sklu_2382.2 YDL195W, Contig c2382 2146-5931 reverse complement         53   6e-07
Scas_720.83d                                                           52   6e-07
KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces...    52   7e-07
Scas_695.15                                                            51   9e-07
CAGL0C01441g complement(156930..159947) similar to tr|Q08924 Sac...    52   1e-06
CAGL0E00561g 49750..52260 some similarities with sp|P16649 Sacch...    52   1e-06
YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of...    52   1e-06
Kwal_27.12239                                                          51   1e-06
CAGL0L02629g complement(307323..309710) similar to sp|P07834 Sac...    52   1e-06
Kwal_23.6240                                                           51   1e-06
Scas_397.2                                                             51   1e-06
YMR116C (ASC1) [4073] chr13 complement(499455..499877,500151..50...    50   2e-06
CAGL0M04279g 469040..471862 highly similar to sp|Q12220 Saccharo...    51   2e-06
AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -...    51   2e-06
Kwal_47.17555                                                          50   2e-06
Scas_631.17                                                            50   2e-06
Kwal_23.5769                                                           51   2e-06
CAGL0C00737g complement(75028..77478) similar to tr|Q05946 Sacch...    51   2e-06
KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomy...    50   3e-06
CAGL0E02805g complement(265137..267659) similar to sp|P32479 Sac...    50   3e-06
KLLA0D07546g complement(647984..649927) some similarities with s...    50   3e-06
KLLA0F04884g complement(478044..481682) similar to sp|P53622 Sac...    50   3e-06
KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomy...    50   4e-06
CAGL0J01287g 120215..122047 similar to sp|P46680 Saccharomyces c...    50   4e-06
Scas_630.6                                                             50   4e-06
CAGL0K09284g 914937..917672 highly similar to sp|P25635 Saccharo...    50   5e-06
AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH] complement...    50   5e-06
AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH] (1107932.....    49   5e-06
Kwal_26.7738                                                           49   5e-06
KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces c...    49   6e-06
Scas_592.4*                                                            49   6e-06
YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein t...    49   6e-06
Scas_680.11                                                            49   6e-06
Scas_721.115*                                                          49   6e-06
KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces...    49   7e-06
YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential p...    49   8e-06
YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translat...    48   8e-06
YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 sno...    49   8e-06
YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that ...    49   1e-05
CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces c...    48   1e-05
Kwal_26.8953                                                           48   1e-05
CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces c...    48   1e-05
Sklu_2416.5 YNL317W, Contig c2416 8692-10071                           48   1e-05
Scas_629.12                                                            48   1e-05
Kwal_33.15475                                                          48   1e-05
YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protei...    48   1e-05
Scas_603.5                                                             48   1e-05
Kwal_56.23920                                                          48   2e-05
ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH] (538948..5...    48   2e-05
CAGL0L06952g complement(780793..781836) highly similar to sp|P40...    47   2e-05
CAGL0A00605g complement(67281..69203) similar to sp|P53197 Sacch...    47   2e-05
ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH] complement...    47   2e-05
YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription...    47   2e-05
AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C (...    47   2e-05
YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein c...    47   2e-05
Scas_670.21                                                            47   2e-05
YLR222C (UTP13) [3622] chr12 complement(579320..581773) Componen...    47   3e-05
Scas_704.40                                                            47   3e-05
Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement         47   3e-05
YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741) Coat...    47   3e-05
AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146) [...    47   3e-05
ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH] complement...    47   3e-05
CAGL0H08932g join(871668..871685,872089..874779) highly similar ...    47   4e-05
Kwal_27.12053                                                          47   4e-05
AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH] complement(...    46   5e-05
KLLA0B01958g join(170646..170663,170896..173550) similar to sp|P...    46   5e-05
Sklu_675.1 YMR146C, Contig c675 761-1687                               45   5e-05
Scas_679.28                                                            46   5e-05
KLLA0E21879g complement(1944865..1945866) similar to sgd|S000267...    45   6e-05
Scas_658.1                                                             46   6e-05
AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH] complement(...    46   6e-05
Kwal_23.4118                                                           46   6e-05
Kwal_26.8776                                                           45   6e-05
YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protei...    46   7e-05
Kwal_33.13515                                                          45   8e-05
CAGL0F06853g 671942..673108 highly similar to sp|P20484 Saccharo...    45   8e-05
Sklu_1645.2 YGL116W, Contig c1645 887-2650 reverse complement          45   8e-05
Scas_702.16                                                            45   9e-05
Scas_721.7                                                             45   9e-05
ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH] (1158218.....    45   1e-04
CAGL0D02090g join(214357..214893,215564..215860) highly similar ...    44   1e-04
Sklu_1659.2 YMR092C, Contig c1659 410-2251                             45   1e-04
AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH] (1146710..1...    45   1e-04
CAGL0A02772g complement(289274..290599) similar to sp|P40968 Sac...    45   1e-04
Scas_701.45                                                            45   1e-04
Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement       44   1e-04
KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces c...    44   1e-04
AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH] (799876..80...    44   2e-04
KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces c...    44   2e-04
Kwal_34.15818                                                          44   2e-04
Scas_711.11                                                            44   2e-04
Scas_692.29                                                            44   2e-04
Kwal_27.11126                                                          44   2e-04
CAGL0K00275g complement(25300..27447) similar to sp|P36037 Sacch...    44   3e-04
CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces c...    43   3e-04
CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces c...    44   3e-04
YBL106C (SRO77) [97] chr2 complement(10847..13879) Protein that ...    44   4e-04
Kwal_56.22345                                                          43   4e-04
YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and...    42   5e-04
YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in...    43   6e-04
Kwal_14.884                                                            42   6e-04
AGR180W [4491] [Homologous to ScYLR222C - SH] complement(1090647...    43   6e-04
Kwal_23.6429                                                           43   6e-04
CAGL0M02277g complement(271836..273119) highly similar to sp|Q12...    42   6e-04
Scas_465.4                                                             43   6e-04
KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417 S...    42   6e-04
CAGL0M09845g 975007..977817 highly similar to sp|Q06078 Saccharo...    43   7e-04
YER066W (YER066W) [1497] chr5 (290240..290797) Protein containin...    41   7e-04
Scas_558.3                                                             42   7e-04
AER081C [2586] [Homologous to ScYLR409C - SH] (785301..788372) [...    42   7e-04
Sklu_2332.7 YER107C, Contig c2332 14211-15314 reverse complement       42   8e-04
Kwal_27.10385                                                          42   9e-04
KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces c...    42   0.001
Kwal_56.24478                                                          42   0.001
ABL043W [549] [Homologous to ScYMR092C (AIP1) - SH] complement(3...    42   0.001
Sklu_2420.2 YPL151C, Contig c2420 3924-5249                            42   0.001
KLLA0F22000g complement(2044973..2047354) similar to sp|P42935 S...    42   0.001
CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces c...    41   0.001
YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the...    41   0.001
Sklu_2423.1 YLR409C, Contig c2423 869-3703                             42   0.001
CAGL0B03575g complement(357525..358784) similar to sp|P39984 Sac...    41   0.001
Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement          42   0.001
AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH] (409496..4...    41   0.001
CAGL0L02761g complement(320826..322085) similar to sp|P18851 Sac...    41   0.002
YLR409C (UTP21) [3786] chr12 complement(934411..937230) Member o...    41   0.002
Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement         41   0.002
Kwal_56.23895                                                          41   0.002
KLLA0F07403g 697593..698636 similar to sp|P40217 Saccharomyces c...    40   0.002
Kwal_14.1710                                                           41   0.002
Sklu_2317.3 YDR142C, Contig c2317 5804-6910                            40   0.002
ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH] complement(1...    41   0.002
CAGL0K11638g complement(1123343..1125121) weakly similar to sp|Q...    41   0.002
Kwal_27.10785                                                          40   0.003
AGL301C [4011] [Homologous to ScYER107C (GLE2) - SH] (137221..13...    40   0.003
Sklu_2364.2 YGL004C, Contig c2364 1650-2885 reverse complement         40   0.004
YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative...    40   0.004
AGL190W [4122] [Homologous to ScYDR142C (PEX7) - SH] complement(...    40   0.004
Kwal_27.10573                                                          40   0.004
CAGL0G03399g complement(325879..326988) highly similar to sp|P40...    40   0.004
Kwal_26.7570                                                           39   0.004
ADR108C [1849] [Homologous to NOHBY] (899200..900099) [900 bp, 2...    39   0.005
Sklu_1880.3 YDR364C, Contig c1880 4293-5708                            40   0.005
KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1 ...    39   0.005
YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein...    39   0.005
YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein ...    39   0.006
YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Prote...    39   0.006
Scas_700.27*                                                           39   0.006
Scas_719.52                                                            39   0.007
CAGL0F07337g complement(714870..716735) similar to sp|P26309 Sac...    39   0.007
Kwal_27.12667                                                          39   0.007
Scas_717.68                                                            39   0.007
Scas_510.5                                                             39   0.008
Scas_657.13                                                            39   0.009
Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement      39   0.010
KLLA0D00814g complement(76687..77913) similar to sp|P39984 Sacch...    39   0.011
KLLA0F21406g complement(1996260..1998377) similar to sp|P47025 S...    39   0.011
YER107C (GLE2) [1539] chr5 complement(373444..374541) Nuclear po...    38   0.011
ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH] complement(...    39   0.011
YDR142C (PEX7) [987] chr4 complement(740467..741594) Peroxisomal...    38   0.012
ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH] complement(...    38   0.013
KLLA0A08866g 776960..778231 weakly similar to sp|P53196 Saccharo...    38   0.013
Scas_605.18                                                            38   0.013
Scas_571.4                                                             38   0.014
Kwal_47.17465                                                          39   0.014
KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces...    38   0.015
KLLA0E20779g complement(1841092..1842207) similar to sp|P40066 S...    38   0.016
Scas_719.30                                                            38   0.017
Kwal_47.17827                                                          38   0.021
Kwal_26.8628                                                           37   0.022
Kwal_55.21450                                                          37   0.023
Kwal_26.8975                                                           37   0.024
YCL039W (GID7) [504] chr3 (52645..54882) Protein of unknown func...    38   0.024
KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777....    37   0.025
AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH] (526057..527...    37   0.027
CAGL0L09647g 1032740..1034029 highly similar to sp|P35184 Saccha...    37   0.028
YDL195W (SEC31) [678] chr4 (107209..111030) Component (p150) of ...    37   0.028
Kwal_56.23685                                                          37   0.029
KLLA0E03982g 371642..372760 similar to sp|P39108 Saccharomyces c...    37   0.029
AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH] complement(...    37   0.030
Scas_715.35                                                            37   0.033
YMR092C (AIP1) [4050] chr13 complement(451631..453478) Actin int...    37   0.035
KLLA0F13772g 1276532..1278094 highly similar to sp|Q04305 Saccha...    37   0.035
CAGL0H00781g complement(77292..78833) similar to tr|Q12523 Sacch...    37   0.037
Scas_660.7*                                                            37   0.037
KLLA0E19613g complement(1733708..1735426) similar to sp|P21304 S...    37   0.037
KLLA0F19734g 1826828..1830229 similar to sgd|S0002535 Saccharomy...    37   0.041
ABL024W [568] [Homologous to ScYMR102C - SH; ScYKL121W - SH] com...    37   0.042
Sklu_2435.13 YPR137W, Contig c2435 18346-20073                         37   0.042
YAR003W (SWD1) [68] chr1 (155009..156289) Component of SET1 and ...    37   0.044
YEL056W (HAT2) [1372] chr5 (47168..48373) Histone acetyltransfer...    36   0.050
CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces cer...    37   0.052
Kwal_33.15591                                                          37   0.054
YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component o...    36   0.054
Kwal_33.15136                                                          36   0.057
Scas_693.22                                                            36   0.065
Scas_615.11                                                            36   0.066
Scas_699.5                                                             36   0.073
ADR242C [1983] [Homologous to ScYMR131C (RRB1) - SH] (1126443..1...    36   0.075
KLLA0E06391g complement(574273..577239) similar to sp|P38163 Sac...    36   0.079
ADR090W [1831] [Homologous to ScYDL195W (SEC31) - SH] complement...    36   0.080
YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa sub...    36   0.089
Sklu_2364.5 YAR003W, Contig c2364 9220-10515 reverse complement        35   0.091
Kwal_55.21144                                                          35   0.10 
KLLA0B11077g complement(970761..972464) similar to sgd|S0006341 ...    35   0.11 
Scas_693.36                                                            35   0.11 
Kwal_56.24332                                                          35   0.11 
AFL006C [3187] [Homologous to ScYAR003W (SWD1) - SH] (425925..42...    35   0.12 
CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces c...    35   0.12 
YGL116W (CDC20) [1869] chr7 (289810..291642) Activator of anapha...    35   0.12 
Kwal_56.24661                                                          35   0.14 
KLLA0C07425g complement(647673..649007) highly similar to sp|Q12...    35   0.14 
CAGL0G00704g 65805..67127 similar to sp|P39706 Saccharomyces cer...    35   0.15 
KLLA0F05159g 506007..509702 similar to sp|P38968 Saccharomyces c...    35   0.16 
CAGL0K03377g complement(306529..309465) similar to sp|Q03177 Sac...    35   0.16 
ACR091W [1138] [Homologous to ScYDR267C - SH] complement(520609....    34   0.17 
KLLA0E08415g 759718..760986 similar to sp|P53962 Saccharomyces c...    34   0.20 
Scas_659.9                                                             34   0.20 
KLLA0F10791g complement(991642..993279) similar to sp|P26309 Sac...    35   0.20 
CAGL0M05291g complement(566250..567509) similar to sp|P13712 Sac...    34   0.22 
Scas_512.3                                                             34   0.23 
Sklu_2226.6 YNL035C, Contig c2226 6858-8054 reverse complement         34   0.24 
Kwal_56.24596                                                          34   0.24 
YML102W (CAC2) [3869] chr13 (68294..69700) Chromatin assembly co...    34   0.27 
Sklu_2431.8 YBR195C, Contig c2431 12732-14009 reverse complement       34   0.27 
YOL138C (YOL138C) [4686] chr15 complement(61324..65349) Possible...    34   0.30 
YMR093W (UTP15) [4051] chr13 (454014..455555) Protein component ...    33   0.36 
ACL099W [950] [Homologous to ScYKL018W (SWD2) - SH] complement(1...    33   0.38 
YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing...    34   0.38 
Kwal_55.21559                                                          33   0.38 
YCR032W (BPH1) [566] chr3 (179515..186018) Probable acetic acid ...    34   0.42 
Scas_673.11                                                            33   0.43 
Scas_469.3                                                             33   0.44 
Kwal_14.1235                                                           33   0.48 
YOR272W (YTM1) [5058] chr15 (832810..834192) Microtubule-associa...    33   0.48 
CAGL0K05291g 515641..518787 similar to sp|Q12038 Saccharomyces c...    33   0.49 
AGR242C [4553] [Homologous to ScYIR012W (SQT1) - SH] (1203152..1...    33   0.50 
YPL007C (TFC8) [5430] chr16 complement(542077..543843) RNA Polym...    33   0.54 
Scas_589.13                                                            33   0.57 
CAGL0K03861g complement(359448..360989) highly similar to sp|Q04...    33   0.59 
CAGL0B01529g 137174..138283 highly similar to sp|P39108 Saccharo...    33   0.60 
Sklu_2430.9 YMR102C, Contig c2430 15497-18397                          33   0.62 
KLLA0F15598g 1439610..1441046 highly similar to sp|P33750 Saccha...    33   0.64 
Scas_660.8                                                             33   0.71 
Scas_661.19                                                            33   0.71 
Kwal_26.7655                                                           33   0.81 
CAGL0J04818g 455846..457810 highly similar to sp|Q06440 Saccharo...    32   0.87 
Kwal_23.5632                                                           32   0.96 
ACR162C [1209] [Homologous to ScYPL126W (NAN1) - SH] (637642..64...    32   1.00 
Scas_670.22                                                            32   1.0  
KLLA0E18139g 1608371..1609351 highly similar to sp|P36104 Saccha...    32   1.1  
Sklu_2092.4 YMR131C, Contig c2092 3964-5526                            32   1.1  
KLLA0F16038g complement(1487475..1490063) weakly similar to ca|C...    32   1.1  
CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024 Saccha...    32   1.1  
YHR046C (INM1) [2334] chr8 complement(197390..198277) Inositol m...    32   1.2  
CAGL0J00319g complement(22849..23733) highly similar to sp|P3871...    32   1.3  
Scas_442.2*                                                            32   1.3  
Scas_721.128                                                           32   1.3  
AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516...    32   1.3  
KLLA0A08822g 772565..774313 similar to sp|P53197 Saccharomyces c...    32   1.3  
Kwal_56.23207                                                          32   1.4  
Kwal_56.24163                                                          32   1.4  
AER280C [2782] [Homologous to ScYML102W (CAC2) - SH] (1148956..1...    32   1.5  
KLLA0D12760g complement(1090428..1091909) weakly similar to sgd|...    32   1.5  
Scas_685.11                                                            32   1.5  
YPL247C (YPL247C) [5203] chr16 complement(82625..84196) Protein ...    32   1.7  
KLLA0B07667g 667863..673862 weakly similar to sp|P25356 Saccharo...    32   1.7  
YMR049C (ERB1) [4011] chr13 complement(368093..370516) Protein w...    32   1.7  
Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement         32   1.8  
CAGL0D05588g 533235..534668 highly similar to sp|P33750 Saccharo...    32   1.8  
Kwal_56.24399                                                          31   1.8  
KLLA0D13222g complement(1132067..1134277) similar to sgd|S000273...    32   1.8  
Sklu_2114.2 YDR128W, Contig c2114 598-4020 reverse complement          32   1.9  
ADL316C [1425] [Homologous to ScYBR097W (VPS15) - SH] (141607..1...    32   1.9  
KLLA0D09086g 763408..764607 weakly similar to sgd|S0006289 Sacch...    31   2.0  
Scas_706.24                                                            31   2.2  
Sklu_1710.1 YDR267C, Contig c1710 17-739                               31   2.2  
Scas_542.5                                                             31   2.3  
CAGL0J07854g complement(765463..766761) similar to sp|P53851 Sac...    31   2.3  
CAGL0L09757g complement(1046898..1047878) highly similar to sp|P...    31   2.5  
Sklu_2423.8 YDL074C, Contig c2423 13513-15456 reverse complement       31   2.5  
Scas_684.7                                                             31   2.5  
Sklu_2133.4 YBR234C, Contig c2133 6409-7530                            31   2.6  
ABR101C [693] [Homologous to ScYMR049C (ERB1) - SH] (567357..569...    31   2.6  
YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein req...    31   2.6  
Kwal_14.1675                                                           31   2.8  
ABL044C [548] [Homologous to ScYMR093W - SH] (312378..313934) [1...    31   2.9  
KLLA0F08811g complement(819834..821744) some similarities with s...    31   3.1  
KLLA0F06754g complement(650475..651509) similar to sp|P53011 Sac...    30   3.5  
KLLA0B12804g 1117475..1120033 weakly similar to sp|Q03177 Saccha...    30   3.9  
YDR324C (UTP4) [1154] chr4 complement(1114426..1116756) Protein ...    30   4.0  
Kwal_26.7736                                                           30   4.0  
Kwal_0.40                                                              30   4.1  
AEL153W [2353] [Homologous to ScYJL069C - SH] complement(343247....    30   4.1  
KLLA0B11924g complement(1043344..1047582) similar to sp|P22219 S...    30   4.1  
Scas_649.10                                                            30   4.1  
ACR190C [1237] [Homologous to ScYBL106C (SRO77) - SH; ScYPR032W ...    30   4.6  
CAGL0G01628g complement(151262..152392) similar to sp|P53962 Sac...    30   4.6  
Scas_675.18                                                            30   5.1  
AEL286C [2219] [Homologous to ScYGR054W - SH] (103316..105193) [...    30   5.3  
YMR131C (RRB1) [4088] chr13 complement(533162..534697) Protein i...    30   5.6  
CAGL0J08998g 882655..886500 highly similar to sp|P38968 Saccharo...    30   5.6  
KLLA0C07513g complement(656060..657379) similar to sp|P39946 Sac...    30   5.6  
AFL022W [3171] [Homologous to ScYBR234C (ARC40) - SH] complement...    30   5.6  
AFL157C [3038] [Homologous to ScYPL247C - SH] (140404..141720) [...    30   5.9  
YBR195C (MSI1) [378] chr2 complement(610571..611839) Chromatin a...    30   6.2  
Sklu_1985.3 YLR196W, Contig c1985 4838-6544 reverse complement         30   6.2  
Scas_720.45                                                            30   6.3  
Sklu_2384.3 YKL018W, Contig c2384 6547-7533                            29   6.9  
AFR634W [3826] [Homologous to ScYNL253W - SH] complement(1593772...    29   7.8  
CAGL0D04884g 475678..477369 highly similar to tr|Q06506 Saccharo...    29   8.0  
CAGL0J01265g complement(118375..119928) highly similar to sp|Q04...    29   9.3  
Sklu_1870.2 YLR055C, Contig c1870 1126-2835 reverse complement         29   9.6  
Kwal_14.906                                                            29   9.6  
CAGL0J10340g complement(1008637..1009653) highly similar to sp|P...    29   9.8  

>ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH]
           (128830..130335) [1506 bp, 501 aa]
          Length = 501

 Score =  974 bits (2519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/492 (96%), Positives = 474/492 (96%)

Query: 1   MSITSEELNYLIWRYLQEAGHEVSALAMQEETRVLEFDEKYKEHIPLGTLVKLVQKGILY 60
           MSITSEELNYLIWRYLQEAGHEVSALAMQEETRVLEFDEKYKEHIPLGTLVKLVQKGILY
Sbjct: 1   MSITSEELNYLIWRYLQEAGHEVSALAMQEETRVLEFDEKYKEHIPLGTLVKLVQKGILY 60

Query: 61  TESEFLVQYNAQSEGADAEHYGKDFNLVQALEVDKQRFPELVAQGRFAXXXXXXXXXXXX 120
           TESEFLVQYNAQSEGADAEHYGKDFNLVQALEVDKQRFPELVAQGRFA            
Sbjct: 61  TESEFLVQYNAQSEGADAEHYGKDFNLVQALEVDKQRFPELVAQGRFALAHEREEPEAEP 120

Query: 121 XXXXXXSDDSFIKTLQCVQTFPPGYVSQWNPKHEGVFAYGERDSRAAVVTYSVADGLWNI 180
                 SDDSFIKTLQCVQTFPPGYVSQWNPKHEGVFAYGERDSRAAVVTYSVADGLWNI
Sbjct: 121 EVTRLESDDSFIKTLQCVQTFPPGYVSQWNPKHEGVFAYGERDSRAAVVTYSVADGLWNI 180

Query: 181 SETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNILSYHRAPIVC 240
           SETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNILSYHRAPIVC
Sbjct: 181 SETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNILSYHRAPIVC 240

Query: 241 IKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPG 300
           IKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPG
Sbjct: 241 IKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPG 300

Query: 301 IQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHV 360
           IQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHV
Sbjct: 301 IQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHV 360

Query: 361 FYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGK 420
           FYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGK
Sbjct: 361 FYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGK 420

Query: 421 FATGTLDGEVMVYDIQKLLQQLNHNGYHGTARSAEVARIPVVGDHRSAREGNYVTQISWS 480
           FATGTLDGEVMVYDIQKLLQQLNHNGYHGTARSAEVARIPVVGDHRSAREGNYVTQISWS
Sbjct: 421 FATGTLDGEVMVYDIQKLLQQLNHNGYHGTARSAEVARIPVVGDHRSAREGNYVTQISWS 480

Query: 481 QESTQLSVSYSL 492
           QESTQLSVSYSL
Sbjct: 481 QESTQLSVSYSL 492

>Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement
          Length = 509

 Score =  595 bits (1535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/505 (57%), Positives = 364/505 (72%), Gaps = 18/505 (3%)

Query: 1   MSITSEELNYLIWRYLQEAGHEVSALAMQEETRVLEFDEKYKEHIPLGTLVKLVQKGILY 60
           MS+TSEEL+YLIWRYLQE GHEV+ALA+QEE+RVLEFDEK++EHIPLG LV  VQ+GILY
Sbjct: 1   MSLTSEELSYLIWRYLQETGHEVTALALQEESRVLEFDEKFREHIPLGCLVNFVQRGILY 60

Query: 61  TESEFLVQYNAQSEGADAEHYGKDFNLVQALEVDKQRFPELVAQGRFAXXXXXXXXXXXX 120
           TES+ LV+Y+ +    D  HY ++FNLVQALEVDK ++P+LVA+GRFA            
Sbjct: 61  TESDLLVRYDGEVTPIDPSHYSENFNLVQALEVDKNKYPDLVAKGRFALENDQSWEEQHT 120

Query: 121 XXXXXXS-----DDSFIKTLQCVQTFPPGYVSQWNPKHEGVFAYGERDSRAAVVTYSVAD 175
                 +        FIKTLQ V  FP   +SQWNPK    FA+G RDS A VV +    
Sbjct: 121 DEPFEENLNGEVSPDFIKTLQAVHLFPSSTISQWNPKLFDFFAWGGRDSTAKVVKFECNS 180

Query: 176 GLWNISETVVL--------ADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKL 227
           G   + +T+ L        A  N+   NEVTCL W+P+G+SL+TGVE+GELR+WS  G L
Sbjct: 181 GKLAVLDTITLQHPFALSIASENSKTTNEVTCLSWSPSGESLITGVENGELRMWSFRGIL 240

Query: 228 QNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVD 287
           QN+ ++HR+P+V I+WN+D THVLT D DN+TIVWN L+GTA+QHF  K+    ESLG+D
Sbjct: 241 QNVFNFHRSPVVSIEWNADSTHVLTSDVDNITIVWNALTGTALQHFDLKDTTGNESLGID 300

Query: 288 ATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTL 347
             WI+ DKF IPG+QGSILVF+IG SKPIGKL GH+KTLT + YN  NKLLLSASDD TL
Sbjct: 301 VEWIETDKFVIPGLQGSILVFSIGESKPIGKLVGHTKTLTVLCYNSDNKLLLSASDDKTL 360

Query: 348 RVWRGGNLNPSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVDGV 407
           R WRGGN N S+ FYGH+QSIT A W+DDD +ISTSMDGS+RVWS+  N+ V  + VDGV
Sbjct: 361 RTWRGGNANSSNCFYGHTQSITYADWLDDDRLISTSMDGSVRVWSVKQNALVGLSVVDGV 420

Query: 408 PNFTGALSPDQGKFATGTLDGEVMVYDIQKLLQQLNHNGYHGTARSAEVARIPVVGDHRS 467
           P F G LS D+ KFATGTLDGEV VY+++KLL+ L+ +      +     RIP +GD++S
Sbjct: 421 PIFCGTLSSDKQKFATGTLDGEVSVYNVKKLLEVLDAD-----EKPIGPVRIPTIGDYQS 475

Query: 468 AREGNYVTQISWSQESTQLSVSYSL 492
            +EG+YV+ +SW ++ T ++VSYSL
Sbjct: 476 TKEGSYVSDLSWDKDGTNIAVSYSL 500

>Kwal_27.12586
          Length = 509

 Score =  507 bits (1306), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 256/496 (51%), Positives = 332/496 (66%), Gaps = 20/496 (4%)

Query: 1   MSITSEELNYLIWRYLQEAGHEVSALAMQEETRVLEFDEKYKEHIPLGTLVKLVQKGILY 60
           MSI+SEELNYLIWRYLQE+G EV+ALA+QEE+RVLEF+ K+ EHIP+GTLV  +QKGILY
Sbjct: 1   MSISSEELNYLIWRYLQESGKEVAALALQEESRVLEFESKFGEHIPIGTLVNFMQKGILY 60

Query: 61  TESEFLVQYNAQSEGADAEHYGKDFNLVQALEVDKQRFPELVAQGRFAXXXXXXXXXXX- 119
            ESE LV+Y+ +S   D +   +DFNLVQALE+DK++ PEL    RF+            
Sbjct: 61  AESELLVRYDRESTPVDPKRNAQDFNLVQALEIDKEKVPELEGVQRFSLDDNSVKSSTEY 120

Query: 120 -----XXXXXXXSDDSFIKTLQCVQTFPPGYVSQWNPKHEGVFAYGERDSRAAVVTYSVA 174
                           FIKTL      P  +V QWNPK + + A+G  +S + VVT+   
Sbjct: 121 LNNDSSNSSSGDDSGKFIKTLCRSIQLPQSFVCQWNPKDKNILAWGGPNSTSTVVTFQDV 180

Query: 175 DGLWNISETVV--------LADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGK 226
           DG ++I   V         +ADA++    +VTCLEW+P G S LTGVESGE+RLW+ + K
Sbjct: 181 DGTFSIQHEVTCQHPTAINVADASS--SCDVTCLEWSPKGDSFLTGVESGEIRLWTHDAK 238

Query: 227 LQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGV 286
           LQN   +H++ IV IKWNSD TH LT D DN+ IVWN  +GTA+Q FSF+E GT +SLGV
Sbjct: 239 LQNAFDFHKSSIVTIKWNSDATHFLTYDVDNVAIVWNAQTGTALQQFSFRENGTVDSLGV 298

Query: 287 DATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNT 346
           DA+WI  DKF IPG QGSI +  +G S+P+GKL GHS T+T   +N  N +LLS SDD T
Sbjct: 299 DASWIGPDKFVIPGPQGSIYICGMGESRPLGKLNGHSATITAFDFNSENNMLLSGSDDKT 358

Query: 347 LRVWRGGNLNPSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVDG 406
           LRVWR G+L+ S+ F G++  ITSA W+DDD +I+TS+DGS+R+WS  +N+  A + VDG
Sbjct: 359 LRVWRSGSLSSSNCFMGNTLGITSAFWIDDDKVIATSLDGSVRLWSHLTNTLQAISMVDG 418

Query: 407 VPNFTGALSPDQGKFATGTLDGEVMVYDIQKLLQQLNHNGYHGTARSAEVARIPVVGDHR 466
           VP F G+LSPD+ KFA G +DGEV VY+I+KLL  L      G +  +    IP+ GD++
Sbjct: 419 VPIFCGSLSPDKLKFAIGKMDGEVTVYNIEKLLATLKSIADVGNSPIS----IPIYGDYQ 474

Query: 467 SAREGNYVTQISWSQE 482
           S  EGNYV  I+W  E
Sbjct: 475 SNIEGNYVNNIAWDVE 490

>KLLA0E11297g complement(994770..996308) similar to sp|P38262
           Saccharomyces cerevisiae YBR103w SIF2 SIR4P interacting
           protein, start by similarity
          Length = 512

 Score =  489 bits (1258), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 244/509 (47%), Positives = 337/509 (66%), Gaps = 26/509 (5%)

Query: 1   MSITSEELNYLIWRYLQEAGHEVSALAMQEETRVLEFDEKYKEHIPLGTLVKLVQKGILY 60
           MSI SEELNYLIWRYLQEAGHEVSALA+QEETRVLEF+E++KEHIPLG LV+LVQKGILY
Sbjct: 1   MSIASEELNYLIWRYLQEAGHEVSALALQEETRVLEFEERFKEHIPLGCLVQLVQKGILY 60

Query: 61  TESEFLVQYNAQSEGADAEHYGKDFNLVQALEVDKQRFPELVAQGRFAXXXXXXXXXXXX 120
           TESEFLV  N +    D E Y ++F LVQALEVDKQ+FPE+ A+GRFA            
Sbjct: 61  TESEFLVPPNGEMVPVDQELYKRNFTLVQALEVDKQKFPEIAARGRFALENDVEAEMLEK 120

Query: 121 XXX-------------XXXSDDSFIKTLQCVQTFPPGYVSQWNPKHEGVFAYGERDSRAA 167
                              +   FIKTL    T    + SQWNPK+  +  +G   S+A 
Sbjct: 121 KEQEQAAAMAADSPSGTQSASSRFIKTLSDHLTLSQSFTSQWNPKYGILLVWGGAQSQAR 180

Query: 168 VVTYSVADGL--WNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEG 225
           + +  +      W+I + + L      ++  +  + W+P G+ +LTG  SGELRLW+ +G
Sbjct: 181 IGSIDIVTDKESWSIKDPIDLVYPKRSEEEPIISVSWSPDGELVLTGTTSGELRLWNKQG 240

Query: 226 KLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAG--TEES 283
           KL+NIL  HR+PIV +KWN D TH+LT D  N+ I+W+ L+GT +QHFSFKE     E+S
Sbjct: 241 KLKNILDSHRSPIVAMKWNQDCTHLLTTDVSNVVILWSTLTGTQLQHFSFKEGDIENEDS 300

Query: 284 LGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASD 343
           LG+D  W++ DKF IPG  GS+LV+ IG +KP+G+L GH+ T+TT+ +N+ NK LLSASD
Sbjct: 301 LGIDLEWVETDKFVIPGPGGSLLVYTIGNNKPLGRLLGHTSTITTLEFNKSNKSLLSASD 360

Query: 344 DNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASAT 403
           DNT++VWRGGN + ++ F  H+++I+SAHW++DD IIST+ DG+++VWS++ NS VA A+
Sbjct: 361 DNTIKVWRGGNSSAANDFTDHTKTISSAHWINDDLIISTAYDGTVKVWSISKNSIVAEAS 420

Query: 404 VDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQKLLQQLNHNGYHGTARSAEVARIPV-- 461
           +D  P F  +LSPD+     GTL G  +V+D++  L+  + N       S +   +P+  
Sbjct: 421 LDSEPIFEASLSPDRNWLTVGTLQGSAIVFDVKTFLESYDQN-------SVQQQSVPIST 473

Query: 462 VGDHRSAREGNYVTQISWSQESTQLSVSY 490
            G+++  ++G  VT I+W+ EST  +VSY
Sbjct: 474 YGEYQIDQDGLQVTNIAWNNESTAFAVSY 502

>YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in
           telomere silencing, interacts with Sir4p and targets
           Sir4p from telomeres to other sites, component of Set3p
           complex, has WD (WD-40) repeats [1608 bp, 535 aa]
          Length = 535

 Score =  478 bits (1230), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 247/528 (46%), Positives = 332/528 (62%), Gaps = 37/528 (7%)

Query: 1   MSITSEELNYLIWRYLQEAGHEVSALAMQEETRVLEFDEKYKEHIPLGTLVKLVQKGILY 60
           MSITSEELNYLIWRY QE GHEVSALA+Q+ETRVLEFDEKYKEHIPLGTLV LVQ+GILY
Sbjct: 1   MSITSEELNYLIWRYCQEMGHEVSALALQDETRVLEFDEKYKEHIPLGTLVNLVQRGILY 60

Query: 61  TESEFLVQYNAQSEGADAEHYGKDFNLVQALEVDKQRFPELVAQGRF------------- 107
           TESE +V         +  H  +DFNLVQAL++DK++FPE+ ++GRF             
Sbjct: 61  TESELMVDSKGDISALNEHHLSEDFNLVQALQIDKEKFPEISSEGRFTLETNSESNKAGE 120

Query: 108 -AXXXXXXXXXXXXXXXXXXSDD--SFIKTLQCVQTFPPGYVSQWNPKHEGVFAYGERDS 164
                               SDD   F+K L+ +        S WNP  E + AYGE++S
Sbjct: 121 DGASTVERETQEDDTNSIDSSDDLDGFVKILKEIVKLDNIVSSTWNPLDESILAYGEKNS 180

Query: 165 --RAAVVTYSVADG--LWNIS------ETVVLADANTGQQNEVTCLEWAPAGQSLLTGVE 214
             R A +  +  +G   W ++          L+ ++    N+VTCL W+  G S++TGVE
Sbjct: 181 VARLARIVETDQEGKKYWKLTIIAELRHPFALSASSGKTTNQVTCLAWSHDGNSIVTGVE 240

Query: 215 SGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFS 274
           +GELRLW+  G L N+L++HRAPIV +KWN D TH+++ D +N+TI+WNV+SGT +QHF 
Sbjct: 241 NGELRLWNKTGALLNVLNFHRAPIVSVKWNKDGTHIISMDVENVTILWNVISGTVMQHFE 300

Query: 275 FKEAGT----------EESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSK 324
            KE G           + SLGVD  W+D DKF IPG +G+I V+ I    P GKL GH  
Sbjct: 301 LKETGGSSINAENHSGDGSLGVDVEWVDDDKFVIPGPKGAIFVYQITEKTPTGKLIGHHG 360

Query: 325 TLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDTIISTSM 384
            ++ + +N+ NKLLLSASDD TLR+W GGN N  + FYGHSQSI SA WV DD +IS SM
Sbjct: 361 PISVLEFNDTNKLLLSASDDGTLRIWHGGNGNSQNCFYGHSQSIVSASWVGDDKVISCSM 420

Query: 385 DGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQKLLQQLNH 444
           DGS+R+WSL  N+ +A + VDGVP F G +S D  K+A   +DG+V VYD++KL  + + 
Sbjct: 421 DGSVRLWSLKQNTLLALSIVDGVPIFAGRISQDGQKYAVAFMDGQVNVYDLKKLNSK-SR 479

Query: 445 NGYHGTARSAEVARIPVVGDHRSAREGNYVTQISWSQESTQLSVSYSL 492
           + Y           IP+   ++S+++ +Y+  +SW+    ++SV+YSL
Sbjct: 480 SLYGNRDGILNPLPIPLYASYQSSQDNDYIFDLSWNCAGNKISVAYSL 527

>CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces
           cerevisiae YBR103w SIF2 SIR4P interacting protein, start
           by similarity
          Length = 535

 Score =  454 bits (1167), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 234/534 (43%), Positives = 330/534 (61%), Gaps = 48/534 (8%)

Query: 1   MSITSEELNYLIWRYLQEAGHEVSALAMQEETRVLEFDEKYKEHIPLGTLVKLVQKGILY 60
           MSITSEELNYLIWRYLQE G+E+SALA+QEETRVLEF++ YKE+IP+GTLV LVQ+GILY
Sbjct: 1   MSITSEELNYLIWRYLQETGNELSALALQEETRVLEFEKNYKENIPVGTLVNLVQRGILY 60

Query: 61  TESEFLVQYNAQSEGADAEHYGKDFNLVQALEVDKQRFPELVAQGRF------------- 107
           TESE LV  N + +  D  H+ ++FNLVQAL++DK+++P LV++GRF             
Sbjct: 61  TESELLVHPNGKVKPIDENHFSENFNLVQALQIDKEKYPALVSKGRFELEKLGREDSNEL 120

Query: 108 -----AXXXXXXXXXXXXXXXXXXSDDSFIKTLQCVQTFPPGYVSQWNPKHEGVFAYGER 162
                A                   ++ F KTL  +         QWNP    + A GE 
Sbjct: 121 ESTESAGVSADHTENDVRMDQDHDEEEVFAKTLNEIFKLGKAVCLQWNPVSSNILAIGEH 180

Query: 163 DSRAAVV---TYSVADGLWNISETV------VLADANTGQ-QNEVTCLEWAPAGQSLLTG 212
           DS A ++   T +  D +  I +T+          A TG+  N++TCL WA  G S+ TG
Sbjct: 181 DSTAKLIELETTTTDDQIKLIEKTIHELRHPFATSATTGKITNQLTCLSWAHDGDSIATG 240

Query: 213 VESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQH 272
           VE+GELRLW+ EGKLQN+ ++H++PI+ I WNS  TH ++ DADN+TI+W+V SG  +QH
Sbjct: 241 VENGELRLWNKEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVVLQH 300

Query: 273 FSFK--------EAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSK 324
           F  K           + +  GVD  W+D DKF IPG  G++LV+ +  S+PIGKL GH  
Sbjct: 301 FESKANQINGNNNNNSNQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVGHRG 360

Query: 325 TLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDTIISTSM 384
           T++ + +N   KLL SA+DDNT+RVW GGN N  H FYGH+Q+I S  WV++D +IS SM
Sbjct: 361 TISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLISASM 420

Query: 385 DGSIRVWSLA------SNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQKL 438
           DGS+++W         + + +A   VDGVP F GA+S D+ ++A G +DG+V V+++  L
Sbjct: 421 DGSVKLWDCGKKLQEITGNLIAETIVDGVPIFAGAISDDRERYAAGFMDGQVTVFNLAAL 480

Query: 439 LQQLNHNGYHGTARSAEVARIPVVGDHRSAREGNYVTQISWSQESTQLSVSYSL 492
           L++ +     G      V  IP+ GD +SA   + V  +SW ++  +L+++YS+
Sbjct: 481 LKRYS----KGKKHKNHVMSIPICGDFQSAHSDDSVFDLSWKED--RLAIAYSI 528

>Scas_718.6*
          Length = 546

 Score =  421 bits (1081), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 216/542 (39%), Positives = 330/542 (60%), Gaps = 55/542 (10%)

Query: 1   MSITSEELNYLIWRYLQEAGHEVSALAMQEETRVLEFDEKYKEHIPLGTLVKLVQKGILY 60
           MS++SEELNYLIWRYLQE+GHE++ LA+QEE+RVLEFD +YK H+P+G+LV L+QKGILY
Sbjct: 1   MSLSSEELNYLIWRYLQESGHELTTLALQEESRVLEFDSQYKLHVPVGSLVNLIQKGILY 60

Query: 61  TESEFLVQYNAQSEGADAEHYGKDFNLVQALEVDKQRFPEL------------------- 101
           TESE LV+ N      + E++ ++FNLV AL++D +++PE+                   
Sbjct: 61  TESELLVKSNGDITKEEMENFNENFNLVNALQIDLEKYPEIAKKGRFALANDSESQYEER 120

Query: 102 VAQGRFAX---------------XXXXXXXXXXXXXXXXXSDDS-----FIKTLQCVQTF 141
           +A+G+                                   ++DS     F KTL  VQT 
Sbjct: 121 LAKGKKESEINTPIIPTSGIEEETNTKIKADIEDISIHNDTEDSAESSFFAKTLNEVQTL 180

Query: 142 PPGYV-SQWNPKHEGVFAYGERDSRAAVVTYSVAD----GLWNISETVVLADANTGQQNE 196
               V S WN ++E + AYG+ DS A ++ Y+  D        +     L+     + N+
Sbjct: 181 DNKVVTSSWNLQNERLLAYGQEDSMAKMIEYNKEDKKIISSLELRHPFALSSITGRKTNQ 240

Query: 197 VTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDAD 256
           +T L W+P G+ ++T VE+GELRLW+ +G+LQN+ ++HR+PIV IKWN D  H ++ D D
Sbjct: 241 ITALSWSPDGELIITSVENGELRLWNKDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLD 300

Query: 257 NMTIVWNVLSGTAVQHFSFKEA--GTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISK 314
           N+TI+WN ++G  +QHF  ++      ESLGVD  W+D+DK  +PG+ GSILV++I  +K
Sbjct: 301 NITILWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNK 360

Query: 315 PIGKLRGHSKTLTTIAYNEHNKLLLSASD-DNTLRVWRGGNLNPSHVFYGHSQSITSAHW 373
           PIGKL GH  T++ I +N +++LLL++SD D ++R+W G   N  + FYGHSQSI S  W
Sbjct: 361 PIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSW 420

Query: 374 VDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVY 433
           ++DD +IS SMDGS+R+WS+  N  V  A VDG     G +S D+ KFA G+++G++ VY
Sbjct: 421 INDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNKFAIGSMNGQINVY 480

Query: 434 DIQKLLQQLNHNGYHGTARSAEVA---RIPVVGDHRSAREGNYVTQISWSQESTQLSVSY 490
           DI++ + +L         +  E+     IP+ G +++ +  + +  ISW++ +  ++V+ 
Sbjct: 481 DIKRFVSRL-----LKRDKKQELVVPITIPLYGSYQNEKIDDCIFDISWNKSNDLITVAN 535

Query: 491 SL 492
           S+
Sbjct: 536 SI 537

>AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH]
           (172849..175296) [2448 bp, 815 aa]
          Length = 815

 Score = 68.2 bits (165), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 88/177 (49%), Gaps = 9/177 (5%)

Query: 177 LWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQ-NILSYHR 235
           LW++     L  +  G  + V  ++++P G    TG      RLWS +      I + H 
Sbjct: 568 LWSLDTYTCLV-SYKGHNHPVWDVKFSPLGHYFATGSHDQTARLWSCDHIYPLRIFAGHL 626

Query: 236 APIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAG-TEESLGVDATWIDQD 294
             + C+ ++ + T+VLT  +D    +W++ +G +V+ F    A     ++  D  W+   
Sbjct: 627 NDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTG 686

Query: 295 KFAIPGIQGSILVFNIGISKPIGKLRGHSKT-LTTIAYNEHNKLLLSASDDNTLRVW 350
                   G I+V++IG  K I ++RGH K+ + ++++N+   +L+S   D ++RVW
Sbjct: 687 -----SEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVW 738

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 58/307 (18%), Positives = 124/307 (40%), Gaps = 78/307 (25%)

Query: 162 RDSRAAVVTYSVADGLWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLW 221
           R+SR A+      D L   + +V +   +   + E+TCL ++   + +  G +   ++LW
Sbjct: 460 RESRDAIKM----DNLQTSAPSVCMYTFHNTNR-EMTCLRFSDDSRLVAAGFQDSYIKLW 514

Query: 222 SVEG-KLQNILSY-------------HRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSG 267
           S++G  L++ L               H  P+  + ++ D  ++++   D    +W++ + 
Sbjct: 515 SLDGTPLESQLPSKAKDASNTVTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTY 574

Query: 268 TAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLT 327
           T +  +                                              +GH+  + 
Sbjct: 575 TCLVSY----------------------------------------------KGHNHPVW 588

Query: 328 TIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDT-IISTSMDG 386
            + ++       + S D T R+W   ++ P  +F GH   +    +  + T +++ S D 
Sbjct: 589 DVKFSPLGHYFATGSHDQTARLWSCDHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDK 648

Query: 387 SIRVWSLASNSTVA-----SATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDI--QKLL 439
           + R+W + +  +V      +A+V  V     A+SPD     TG+ DG ++V+DI   K +
Sbjct: 649 TCRMWDIQTGDSVRLFLGHTASVVSV-----AVSPDGRWLTTGSEDGVIIVWDIGTGKRI 703

Query: 440 QQLNHNG 446
           +Q+  +G
Sbjct: 704 KQMRGHG 710

>YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation factor I
           subunit 2 required for mRNA 3'-end processing, bridges
           two mRNA 3'-end processing factors, has WD (WD-40)
           repeats [1398 bp, 465 aa]
          Length = 465

 Score = 67.4 bits (163), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 59/251 (23%), Positives = 108/251 (43%), Gaps = 11/251 (4%)

Query: 197 VTCLEWAPAGQSLLTGVESGELRLWSVEG-KLQNILSYHRAPIVCIKWNSDETHVLTCDA 255
           +  ++W P G+ L+    SGE  LW+      + ++  H + +  +K++ D   +++ DA
Sbjct: 96  IPAIQWTPEGRRLVVATYSGEFSLWNASSFTFETLMQAHDSAVTTMKYSHDSDWMISGDA 155

Query: 256 DNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKP 315
           D M  +W   + + V+     +A   ES+   A   +  KF        + ++N    K 
Sbjct: 156 DGMIKIWQP-NFSMVKEI---DAAHTESIRDMAFSSNDSKFVTCSDDNILKIWNFSNGKQ 211

Query: 316 IGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW--RGGNLNPSHVFYGHSQSITSAHW 373
              L GH   + +  ++    L+ SAS DN +++W  R GN   S + + H+   T    
Sbjct: 212 ERVLSGHHWDVKSCDWHPEMGLIASASKDNLVKLWDPRSGNCISSILKFKHTVLKTRFQP 271

Query: 374 VDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSP-DQGKFATGTLDGEVMV 432
              + +++ S D S RV+ +  +        D     T    P ++  F     DG +  
Sbjct: 272 TKGNLLMAISKDKSCRVFDIRYSMKELMCVRDETDYMTLEWHPINESMFTLACYDGSLKH 331

Query: 433 YDIQKLLQQLN 443
           +D   LLQ LN
Sbjct: 332 FD---LLQNLN 339

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/232 (18%), Positives = 92/232 (39%), Gaps = 47/232 (20%)

Query: 174 ADGLWNI--SETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSV-EGKLQNI 230
           ADG+  I      ++ + +      +  + ++      +T  +   L++W+   GK + +
Sbjct: 155 ADGMIKIWQPNFSMVKEIDAAHTESIRDMAFSSNDSKFVTCSDDNILKIWNFSNGKQERV 214

Query: 231 LSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQ------------------- 271
           LS H   +    W+ +   + +   DN+  +W+  SG  +                    
Sbjct: 215 LSGHHWDVKSCDWHPEMGLIASASKDNLVKLWDPRSGNCISSILKFKHTVLKTRFQPTKG 274

Query: 272 -----------------HFSFKE--AGTEESLGVDATW--IDQDKFAIPGIQGSILVFNI 310
                             +S KE     +E+  +   W  I++  F +    GS+  F++
Sbjct: 275 NLLMAISKDKSCRVFDIRYSMKELMCVRDETDYMTLEWHPINESMFTLACYDGSLKHFDL 334

Query: 311 --GISKPIGKLR-GHSKTLTTIAYNEHNKLLLSASDDNTLRVW-RGGNLNPS 358
              +++PI  +   H K +T+++YN    +  +A+ D T+R W R   ++P+
Sbjct: 335 LQNLNEPILTIPYAHDKCITSLSYNPVGHIFATAAKDRTIRFWTRARPIDPN 386

 Score = 33.1 bits (74), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 31/152 (20%), Positives = 66/152 (43%), Gaps = 7/152 (4%)

Query: 326 LTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWV-DDDTIISTSM 384
           +  I +    + L+ A+      +W   +     +   H  ++T+  +  D D +IS   
Sbjct: 96  IPAIQWTPEGRRLVVATYSGEFSLWNASSFTFETLMQAHDSAVTTMKYSHDSDWMISGDA 155

Query: 385 DGSIRVW--SLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQKLLQQL 442
           DG I++W  + +    + +A  + + +   A S +  KF T + D  + +++     Q+ 
Sbjct: 156 DGMIKIWQPNFSMVKEIDAAHTESIRDM--AFSSNDSKFVTCSDDNILKIWNFSNGKQER 213

Query: 443 NHNGYHGTARSAEVARIPVVGDHRSAREGNYV 474
             +G+H   +S +    P +G   SA + N V
Sbjct: 214 VLSGHHWDVKSCDWH--PEMGLIASASKDNLV 243

>Scas_720.95
          Length = 515

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 66/256 (25%), Positives = 122/256 (47%), Gaps = 30/256 (11%)

Query: 149 WNPKHEGVFAYGERDSRAAVVTYSVADGLWNISETVVLADANTGQQNEVTCLEWAPAGQS 208
           W P H  +   GE   R A  +      +W+I+  V L    +G  N V+C++W+  GQ 
Sbjct: 237 WEPIH--LVKPGE-SPRLASASKDGTIRIWDITRRVCLY-TMSGHTNSVSCIKWS--GQG 290

Query: 209 LL-TGVESGELRLWSV--EGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVL 265
           ++ +G     +R+W +  +GK  NIL  H   +  +  ++D  + L   A + T      
Sbjct: 291 IIYSGSHDKTVRVWDMNADGKCINILKSHAHWVNHLSLSTD--YALRVGAFDHTGAQPAS 348

Query: 266 SG----TAVQHFS--FKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFN-IGISKPIGK 318
           +      A+ ++    K+ G  E L V A+    D F       ++ ++N +  +KPI +
Sbjct: 349 AKDARDKALANYEKVVKKNGKLEELMVTAS----DDF-------TMFLWNPLKSNKPIAR 397

Query: 319 LRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHW-VDDD 377
           + GH K +  +A++   + ++SAS DN++++W G +      F GH  S+    W  D  
Sbjct: 398 MTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSADCR 457

Query: 378 TIISTSMDGSIRVWSL 393
            ++S S D +++VW +
Sbjct: 458 LLVSCSKDTTLKVWDV 473

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 62/140 (44%), Gaps = 12/140 (8%)

Query: 307 VFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNP-SHVFYGHS 365
           +++     P   L GH   +  ++Y  + +++ + S DNT+R+W   +  P      GH 
Sbjct: 170 IWDCDTQTPKATLTGHFNWVLCVSYCPNGEVIATGSMDNTIRLWDSKDGKPLGDALRGHL 229

Query: 366 QSITSAHWV--------DDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALS-P 416
           + ITS  W         +   + S S DG+IR+W +     V   T+ G  N    +   
Sbjct: 230 KWITSLAWEPIHLVKPGESPRLASASKDGTIRIWDITRR--VCLYTMSGHTNSVSCIKWS 287

Query: 417 DQGKFATGTLDGEVMVYDIQ 436
            QG   +G+ D  V V+D+ 
Sbjct: 288 GQGIIYSGSHDKTVRVWDMN 307

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 67/155 (43%), Gaps = 17/155 (10%)

Query: 307 VFNIGISKPIGK----LRGHSKTLTTIAYNEH-NKLLLSASDDNTLRVWRGGNLNPSHVF 361
           VF +   KP+ +    + GH  T+   A+  + +  +++ + DNT R+W      P    
Sbjct: 126 VFKV---KPVTRSSSAIAGHGSTILCSAFAPNTSSRMVTGAGDNTARIWDCDTQTPKATL 182

Query: 362 YGHSQSITSAHWVDDDTIIST-SMDGSIRVWSLASNSTVASATVDGVPNFTG-ALSP--- 416
            GH   +    +  +  +I+T SMD +IR+W       +  A    +   T  A  P   
Sbjct: 183 TGHFNWVLCVSYCPNGEVIATGSMDNTIRLWDSKDGKPLGDALRGHLKWITSLAWEPIHL 242

Query: 417 ----DQGKFATGTLDGEVMVYDIQKLLQQLNHNGY 447
               +  + A+ + DG + ++DI + +     +G+
Sbjct: 243 VKPGESPRLASASKDGTIRIWDITRRVCLYTMSGH 277

 Score = 37.0 bits (84), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 34/175 (19%), Positives = 63/175 (36%), Gaps = 47/175 (26%)

Query: 177 LWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWS-VEGKLQNILSYHR 235
           LWN  ++       TG Q  V  + ++P G+ +++      ++LW   +GK  +    H 
Sbjct: 385 LWNPLKSNKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHV 444

Query: 236 APIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDK 295
           A +  + W++D   +++C  D    VW+V +                 L VD        
Sbjct: 445 ASVYQVAWSADCRLLVSCSKDTTLKVWDVRT---------------RKLSVD-------- 481

Query: 296 FAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW 350
                                  L GH   + T+ ++   K + S   D  +R+W
Sbjct: 482 -----------------------LPGHKDEVYTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 36.6 bits (83), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 83/206 (40%), Gaps = 58/206 (28%)

Query: 191 TGQQNEVTCLEWAPAGQSLLTGVESGELRLW-SVEGK-LQNILSYHRAPIVCIKWNSDET 248
           TG  N V C+ + P G+ + TG     +RLW S +GK L + L  H      +KW     
Sbjct: 183 TGHFNWVLCVSYCPNGEVIATGSMDNTIRLWDSKDGKPLGDALRGH------LKW----- 231

Query: 249 HVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVF 308
                           ++  A +     + G            +  + A     G+I ++
Sbjct: 232 ----------------ITSLAWEPIHLVKPG------------ESPRLASASKDGTIRIW 263

Query: 309 NIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW----RGGNLNPSHVFYGH 364
           +I     +  + GH+ +++ I ++    ++ S S D T+RVW     G  +N   +   H
Sbjct: 264 DITRRVCLYTMSGHTNSVSCIKWSGQG-IIYSGSHDKTVRVWDMNADGKCIN---ILKSH 319

Query: 365 SQSITSAHWVDDDTIISTSMDGSIRV 390
                 AHWV+    +S S D ++RV
Sbjct: 320 ------AHWVNH---LSLSTDYALRV 336

>CAGL0J03476g 331933..333486 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 517

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 61/228 (26%), Positives = 105/228 (46%), Gaps = 23/228 (10%)

Query: 177 LWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVE--GKLQNILSYH 234
           +W+ S  V L     G  N V+C++W   G  L +G     +R W ++  GK  NIL  H
Sbjct: 264 IWDSSRRVCLMTLG-GHTNSVSCVKWGGEGI-LYSGSHDKTVRAWDMKQNGKCINILKSH 321

Query: 235 RAPIVCIKWNSDETHVLTCDADNMTIVWNV----LSGTAVQHFS--FKEAGTEESLGVDA 288
              +  +  ++D  + L   A + T V           A+Q++    ++ G  E L V A
Sbjct: 322 AHWVNHLSLSTD--YALRVGAFDYTGVKPANAKEARDKALQNYEKVARKNGKHEELMVTA 379

Query: 289 TWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLR 348
           +    D F +       L   +  +KPI ++ GH K +  +A++   K ++SAS DN+++
Sbjct: 380 S----DDFTM------FLWNPLKGTKPISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIK 429

Query: 349 VWRGGNLNPSHVFYGHSQSITSAHWVDD-DTIISTSMDGSIRVWSLAS 395
           +W G        F GH  S+    W  D   ++S S D +++VW + +
Sbjct: 430 LWDGKEGTFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKT 477

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 50/220 (22%), Positives = 83/220 (37%), Gaps = 56/220 (25%)

Query: 187 ADANTGQQNEVTCLEWAPAGQS-LLTGVESGELRLWSVEGKLQNI-LSYHRAPIVCIKWN 244
           + A  G    + C  +AP   S ++TG      R+W  + +   + L+ HR  ++C+ W+
Sbjct: 138 SSAIAGHGATILCSAFAPHTSSRVVTGGGDNTARIWDCDTQTPKVTLNGHRNWVLCVSWS 197

Query: 245 SDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGS 304
           +D   + T   DN   +W+  SG                                     
Sbjct: 198 ADGEVIATGSMDNTIRLWDAESG------------------------------------- 220

Query: 305 ILVFNIGISKPIGK-LRGHSKTLTTIAYNE-------HNKLLLSASDDNTLRVWRGGNLN 356
                    KP+G  LRGHSK +T++ +             L SAS D T+R+W      
Sbjct: 221 ---------KPLGDALRGHSKWITSLTWEPIHLVEPGSKPRLASASKDGTIRIWDSSRRV 271

Query: 357 PSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASN 396
                 GH+ S++   W  +  + S S D ++R W +  N
Sbjct: 272 CLMTLGGHTNSVSCVKWGGEGILYSGSHDKTVRAWDMKQN 311

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 68/156 (43%), Gaps = 19/156 (12%)

Query: 307 VFNIGISKPIGK----LRGHSKTLTTIAYNEH-NKLLLSASDDNTLRVWRGGNLNPSHVF 361
           VF +   KPI +    + GH  T+   A+  H +  +++   DNT R+W      P    
Sbjct: 128 VFKV---KPITRSSSAIAGHGATILCSAFAPHTSSRVVTGGGDNTARIWDCDTQTPKVTL 184

Query: 362 YGHSQSITSAHWVDDDTIIST-SMDGSIRVWSLASNSTVASATVDGVPNFTGALS----- 415
            GH   +    W  D  +I+T SMD +IR+W   S   +  A + G   +  +L+     
Sbjct: 185 NGHRNWVLCVSWSADGEVIATGSMDNTIRLWDAESGKPLGDA-LRGHSKWITSLTWEPIH 243

Query: 416 ----PDQGKFATGTLDGEVMVYDIQKLLQQLNHNGY 447
                 + + A+ + DG + ++D  + +  +   G+
Sbjct: 244 LVEPGSKPRLASASKDGTIRIWDSSRRVCLMTLGGH 279

 Score = 37.0 bits (84), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 35/175 (20%), Positives = 61/175 (34%), Gaps = 47/175 (26%)

Query: 177 LWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLW-SVEGKLQNILSYHR 235
           LWN  +        TG Q  V  + ++P G+ +++      ++LW   EG   +    H 
Sbjct: 387 LWNPLKGTKPISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWDGKEGTFLSTFRGHV 446

Query: 236 APIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDK 295
           A +  + W+SD   +++C  D    VW+V +                 L VD        
Sbjct: 447 ASVYQVAWSSDCRLLVSCSKDTTLKVWDVKT---------------RKLSVD-------- 483

Query: 296 FAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW 350
                                  L GH   + T+ ++   K + S   D  +R+W
Sbjct: 484 -----------------------LPGHQDEVYTVDWSVDGKRVCSGGKDKMMRLW 515

>Kwal_23.6324
          Length = 514

 Score = 65.5 bits (158), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 67/254 (26%), Positives = 114/254 (44%), Gaps = 26/254 (10%)

Query: 149 WNPKHEGVFAYGERDSRAAVVTYSVADGLWNISETVVLADANTGQQNEVTCLEWAPAGQS 208
           W P H  +   G++  R A  +      +W+ +  V +    +G  N V+C++W   G  
Sbjct: 236 WEPMH--LVKAGDQ-PRLASASKDGTIKIWDTTRRVCVLTL-SGHTNSVSCVKWGGRGI- 290

Query: 209 LLTGVESGELRLWSVE--GKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMT----IVW 262
           L +G     +R W +   GK  NIL  H   I  +  N+D  + L   A + T       
Sbjct: 291 LYSGSHDKTIRAWDMAAGGKCINILKSHAHWINHLSLNTD--YALRVGAFDHTGEKPSSP 348

Query: 263 NVLSGTAVQHFS--FKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLR 320
                 A++++    K+ G  E L V A+    D F +       L   +  SKPI ++ 
Sbjct: 349 EEARAKALKNYEKIAKKNGQLEELMVTAS----DDFTM------YLWDPLKASKPITRMT 398

Query: 321 GHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDD-DTI 379
           GH K +  +A++   + ++SAS DN++++W G N      F GH  S+    W  D   +
Sbjct: 399 GHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRNGTFIATFRGHVASVYQVAWSSDCRLL 458

Query: 380 ISTSMDGSIRVWSL 393
           +S S D +++VW +
Sbjct: 459 VSCSKDTTLKVWDV 472

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 69/153 (45%), Gaps = 13/153 (8%)

Query: 307 VFNI-GISKPIGKLRGHSKTLTTIAYNEHNK-LLLSASDDNTLRVWRGGNLNPSHVFYGH 364
           VF +  +++    + GH  T+   A+  H    +++ S DNT R+W      P +   GH
Sbjct: 125 VFKVRPVTRSSSAIAGHGSTILCSAFAPHTSGRMVTGSGDNTARIWDCNTNTPMYTLKGH 184

Query: 365 SQSITSAHWVDDDTIIST-SMDGSIRVWSLASNSTVASATVDGVPNFTGALS-------- 415
              +    W  D  +I+T SMD +IR+W      +   A + G   +  +L+        
Sbjct: 185 FNWVLCVAWCPDGELIATGSMDNTIRLWDSNKGESYGEA-LRGHAKWITSLTWEPMHLVK 243

Query: 416 -PDQGKFATGTLDGEVMVYDIQKLLQQLNHNGY 447
             DQ + A+ + DG + ++D  + +  L  +G+
Sbjct: 244 AGDQPRLASASKDGTIKIWDTTRRVCVLTLSGH 276

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 65/140 (46%), Gaps = 14/140 (10%)

Query: 307 VFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSH--VFYGH 364
           +++   + P+  L+GH   +  +A+    +L+ + S DNT+R+W   N   S+     GH
Sbjct: 169 IWDCNTNTPMYTLKGHFNWVLCVAWCPDGELIATGSMDNTIRLW-DSNKGESYGEALRGH 227

Query: 365 SQSITSAHWV--------DDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALS- 415
           ++ ITS  W         D   + S S DG+I++W   +   V   T+ G  N    +  
Sbjct: 228 AKWITSLTWEPMHLVKAGDQPRLASASKDGTIKIWD--TTRRVCVLTLSGHTNSVSCVKW 285

Query: 416 PDQGKFATGTLDGEVMVYDI 435
             +G   +G+ D  +  +D+
Sbjct: 286 GGRGILYSGSHDKTIRAWDM 305

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/252 (18%), Positives = 86/252 (34%), Gaps = 54/252 (21%)

Query: 153 HEGVFAYGERDSRAAVVTYSVADGLWNISETVVLADANTGQQNEVTCLEWAP-AGQSLLT 211
           +  +   G + +   +        ++ +      + A  G  + + C  +AP     ++T
Sbjct: 101 YSSILKPGHKTTEDFITIVYTPRAVFKVRPVTRSSSAIAGHGSTILCSAFAPHTSGRMVT 160

Query: 212 GVESGELRLWSVEGKL-QNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAV 270
           G      R+W          L  H   ++C+ W  D   + T   DN   +W+   G   
Sbjct: 161 GSGDNTARIWDCNTNTPMYTLKGHFNWVLCVAWCPDGELIATGSMDNTIRLWDSNKGE-- 218

Query: 271 QHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIA 330
              S+ EA                                        LRGH+K +T++ 
Sbjct: 219 ---SYGEA----------------------------------------LRGHAKWITSLT 235

Query: 331 YNEHNKL-------LLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDTIISTS 383
           +   + +       L SAS D T+++W            GH+ S++   W     + S S
Sbjct: 236 WEPMHLVKAGDQPRLASASKDGTIKIWDTTRRVCVLTLSGHTNSVSCVKWGGRGILYSGS 295

Query: 384 MDGSIRVWSLAS 395
            D +IR W +A+
Sbjct: 296 HDKTIRAWDMAA 307

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 61/280 (21%), Positives = 114/280 (40%), Gaps = 37/280 (13%)

Query: 177 LWNISETVVLADANTGQQNEVTCLEWAP-----AGQ--SLLTGVESGELRLWSVEGKLQN 229
           LW+ ++     +A  G    +T L W P     AG    L +  + G +++W    ++  
Sbjct: 211 LWDSNKGESYGEALRGHAKWITSLTWEPMHLVKAGDQPRLASASKDGTIKIWDTTRRVCV 270

Query: 230 I-LSYHRAPIVCIKWNSDETHVLTCDADNMTI-VWNVLSGTAVQHFSFKEAGTEESLGVD 287
           + LS H   + C+KW      +L   + + TI  W++ +G    +           L   
Sbjct: 271 LTLSGHTNSVSCVKWGG--RGILYSGSHDKTIRAWDMAAGGKCINI----------LKSH 318

Query: 288 ATWIDQ----DKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTT---IAYN--EHNKLL 338
           A WI+       +A+      +  F+    KP       +K L     IA    +  +L+
Sbjct: 319 AHWINHLSLNTDYAL-----RVGAFDHTGEKPSSPEEARAKALKNYEKIAKKNGQLEELM 373

Query: 339 LSASDDNTLRVWRGGNLN-PSHVFYGHSQSITSAHWVDDDT-IISTSMDGSIRVWSLASN 396
           ++ASDD T+ +W     + P     GH + +    +  D   I+S S D SI++W   + 
Sbjct: 374 VTASDDFTMYLWDPLKASKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRNG 433

Query: 397 STVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQ 436
           + +A+        +  A S D     + + D  + V+D++
Sbjct: 434 TFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVR 473

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 32/161 (19%), Positives = 58/161 (36%), Gaps = 47/161 (29%)

Query: 191 TGQQNEVTCLEWAPAGQSLLTGVESGELRLWS-VEGKLQNILSYHRAPIVCIKWNSDETH 249
           TG Q  V  + ++P G+ +++      ++LW    G        H A +  + W+SD   
Sbjct: 398 TGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRNGTFIATFRGHVASVYQVAWSSDCRL 457

Query: 250 VLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFN 309
           +++C  D    VW+V +               + L VD                      
Sbjct: 458 LVSCSKDTTLKVWDVRT---------------KKLSVD---------------------- 480

Query: 310 IGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW 350
                    L GH+  + T+ ++   K + SA  D  +R+W
Sbjct: 481 ---------LPGHNDEVYTVDWSVDGKRVCSAGKDKMVRIW 512

>YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein of
           unknown function, member of WD (WD-40) repeat family
           [1548 bp, 515 aa]
          Length = 515

 Score = 64.3 bits (155), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 68/290 (23%), Positives = 117/290 (40%), Gaps = 55/290 (18%)

Query: 149 WNPKHEGVFAYGERDSRAAVVTYSVADGLWNISETVVLADANTGQQNEVTCLEWAP---- 204
           W+P  E V A G  D+            LW+      L DA  G    +T L W P    
Sbjct: 194 WSPDGE-VIATGSMDNTIR---------LWDPKSGQCLGDALRGHSKWITSLSWEPIHLV 243

Query: 205 ---AGQSLLTGVESGELRLW-SVEGKLQNILSYHRAPIVCIKWN--------SDETHVLT 252
              +   L +  + G +++W +V    Q  +S H   + C+KW         S +  V  
Sbjct: 244 KPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQGLLYSGSHDRTVRV 303

Query: 253 CDADNMTIVWNVLSGTA--VQHFS-----------FKEAGTEESLGVDATWIDQDKF-AI 298
            D ++     N+L   A  V H S           F   G + S   +A     + +  I
Sbjct: 304 WDINSQGRCINILKSHAHWVNHLSLSTDYALRIGAFDHTGKKPSTPEEAQKKALENYEKI 363

Query: 299 PGIQG-------------SILVFN-IGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDD 344
               G             ++ ++N +  +KPI ++ GH K +  +A++   + ++SAS D
Sbjct: 364 CKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFD 423

Query: 345 NTLRVWRGGNLNPSHVFYGHSQSITSAHWVDD-DTIISTSMDGSIRVWSL 393
           N++++W G +      F GH  S+    W  D   ++S S D +++VW +
Sbjct: 424 NSIKLWDGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDV 473

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 70/156 (44%), Gaps = 19/156 (12%)

Query: 307 VFNIGISKPIGK----LRGHSKTLTTIAYNEH-NKLLLSASDDNTLRVWRGGNLNPSHVF 361
           VF +   KP+ +    + GH  T+   A+  H +  +++ + DNT R+W      P H  
Sbjct: 126 VFKV---KPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPMHTL 182

Query: 362 YGHSQSITSAHWVDDDTIIST-SMDGSIRVWSLASNSTVASATVDGVPNFTGALS----- 415
            GH   +    W  D  +I+T SMD +IR+W   S   +  A + G   +  +LS     
Sbjct: 183 KGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKSGQCLGDA-LRGHSKWITSLSWEPIH 241

Query: 416 ----PDQGKFATGTLDGEVMVYDIQKLLQQLNHNGY 447
                 + + A+ + DG + ++D    + Q   +G+
Sbjct: 242 LVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGH 277

 Score = 51.6 bits (122), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 85/218 (38%), Gaps = 54/218 (24%)

Query: 187 ADANTGQQNEVTCLEWAPAGQS-LLTGVESGELRLWSVEGKL-QNILSYHRAPIVCIKWN 244
           + A  G  + + C  +AP   S ++TG      R+W  + +   + L  H   ++C+ W+
Sbjct: 136 SSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCVSWS 195

Query: 245 SDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGS 304
            D   + T   DN   +W+  SG              + LG DA                
Sbjct: 196 PDGEVIATGSMDNTIRLWDPKSG--------------QCLG-DA---------------- 224

Query: 305 ILVFNIGISKPIGKLRGHSKTLTTIAYNE-------HNKLLLSASDDNTLRVWRGGNLNP 357
                         LRGHSK +T++++             L S+S D T+++W   +   
Sbjct: 225 --------------LRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVC 270

Query: 358 SHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLAS 395
            +   GH+ S++   W     + S S D ++RVW + S
Sbjct: 271 QYTMSGHTNSVSCVKWGGQGLLYSGSHDRTVRVWDINS 308

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 68/148 (45%), Gaps = 14/148 (9%)

Query: 307 VFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW--RGGNLNPSHVFYGH 364
           +++     P+  L+GH   +  ++++   +++ + S DNT+R+W  + G         GH
Sbjct: 170 IWDCDTQTPMHTLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKSGQCL-GDALRGH 228

Query: 365 SQSITSAHWV--------DDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALS- 415
           S+ ITS  W             + S+S DG+I++W   S   V   T+ G  N    +  
Sbjct: 229 SKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSR--VCQYTMSGHTNSVSCVKW 286

Query: 416 PDQGKFATGTLDGEVMVYDIQKLLQQLN 443
             QG   +G+ D  V V+DI    + +N
Sbjct: 287 GGQGLLYSGSHDRTVRVWDINSQGRCIN 314

 Score = 38.1 bits (87), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 35/175 (20%), Positives = 63/175 (36%), Gaps = 47/175 (26%)

Query: 177 LWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWS-VEGKLQNILSYHR 235
           LWN  ++       TG Q  V  + ++P G+ +++      ++LW   +GK  +    H 
Sbjct: 385 LWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHV 444

Query: 236 APIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDK 295
           A +  + W+SD   +++C  D    VW+V +                 L VD        
Sbjct: 445 ASVYQVAWSSDCRLLVSCSKDTTLKVWDVRT---------------RKLSVD-------- 481

Query: 296 FAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW 350
                                  L GH   + T+ ++   K + S   D  +R+W
Sbjct: 482 -----------------------LPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 45/207 (21%), Positives = 78/207 (37%), Gaps = 62/207 (29%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGK--LQNILSYHRAPIVCIKWNSDETH 249
           G  N V C+ W+P G+ + TG     +RLW  +    L + L  H   I  + W  +  H
Sbjct: 184 GHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKSGQCLGDALRGHSKWITSLSW--EPIH 241

Query: 250 VLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFN 309
           ++                         + G++  L   +              G+I +++
Sbjct: 242 LV-------------------------KPGSKPRLASSSK------------DGTIKIWD 264

Query: 310 IGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW------RGGNLNPSHVFYG 363
                    + GH+ +++ + +     LL S S D T+RVW      R  N+  SH    
Sbjct: 265 TVSRVCQYTMSGHTNSVSCVKWGGQG-LLYSGSHDRTVRVWDINSQGRCINILKSH---- 319

Query: 364 HSQSITSAHWVDDDTIISTSMDGSIRV 390
                  AHWV+    +S S D ++R+
Sbjct: 320 -------AHWVNH---LSLSTDYALRI 336

>AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)
           [1542 bp, 513 aa]
          Length = 513

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/266 (23%), Positives = 111/266 (41%), Gaps = 47/266 (17%)

Query: 177 LWNISETVVLADANTGQQNEVTCLEWAP-----AGQS--LLTGVESGELRLWSVEGKLQ- 228
           LW+  +   L DA  G    +T L W P      G+   L +  + G +++W    ++  
Sbjct: 210 LWDSEKGQSLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASASKDGTIKIWDTTRRVCI 269

Query: 229 NILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTA-----------VQHFS--- 274
             LS H + + CIKW      + +   D     W++ +G             V H S   
Sbjct: 270 YTLSGHTSSVSCIKWGGRNV-LYSASHDRTVRCWDMAAGGKCINILKSHAHWVNHLSLST 328

Query: 275 --------FKEAGTEESLGVDA---TWIDQDKFAIP-GIQGSILV-----FNIGI----- 312
                   F   GT+ +   DA      + +K A   G    ++V     F + +     
Sbjct: 329 DYALRMGPFDHTGTKPASPEDAQARALRNYEKVAKKNGTMEELMVTGSDDFTMYLWNPLK 388

Query: 313 -SKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSA 371
            SKPI ++ GH K +  +A++   + ++SAS DN++++W G +      F GH  S+   
Sbjct: 389 GSKPILRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFIATFRGHVASVYQV 448

Query: 372 HWVDD-DTIISTSMDGSIRVWSLASN 396
            W  D   ++S S D +++VW + + 
Sbjct: 449 AWSSDCRLLVSCSKDTTLKVWDVKTR 474

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 66/143 (46%), Gaps = 13/143 (9%)

Query: 307 VFNI-GISKPIGKLRGHSKTLTTIAYNEH-NKLLLSASDDNTLRVWRGGNLNPSHVFYGH 364
           VF +  +++    + GH  T+   A+  H +  +++ + DNT R+W      P     GH
Sbjct: 124 VFKVRPVTRSSSAIAGHGATILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPLCTLKGH 183

Query: 365 SQSITSAHWVDDDTIIST-SMDGSIRVWSLASNSTVASATVDGVPNFTGALS-------- 415
           S  +    W  D  +I+T SMD +IR+W      ++  A + G   +  +LS        
Sbjct: 184 SNWVLCVAWSADGEVIATGSMDATIRLWDSEKGQSLGDA-LRGHTKWITSLSWEPIHLVK 242

Query: 416 -PDQGKFATGTLDGEVMVYDIQK 437
             ++ + A+ + DG + ++D  +
Sbjct: 243 PGEKPRLASASKDGTIKIWDTTR 265

 Score = 48.9 bits (115), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 47/218 (21%), Positives = 83/218 (38%), Gaps = 54/218 (24%)

Query: 187 ADANTGQQNEVTCLEWAPAGQS-LLTGVESGELRLWSVEGKLQ-NILSYHRAPIVCIKWN 244
           + A  G    + C  +AP   S ++TG      R+W  + +     L  H   ++C+ W+
Sbjct: 134 SSAIAGHGATILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPLCTLKGHSNWVLCVAWS 193

Query: 245 SDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGS 304
           +D   + T   D    +W+   G              +SLG DA                
Sbjct: 194 ADGEVIATGSMDATIRLWDSEKG--------------QSLG-DA---------------- 222

Query: 305 ILVFNIGISKPIGKLRGHSKTLTTIAYNE-------HNKLLLSASDDNTLRVWRGGNLNP 357
                         LRGH+K +T++++             L SAS D T+++W       
Sbjct: 223 --------------LRGHTKWITSLSWEPIHLVKPGEKPRLASASKDGTIKIWDTTRRVC 268

Query: 358 SHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLAS 395
            +   GH+ S++   W   + + S S D ++R W +A+
Sbjct: 269 IYTLSGHTSSVSCIKWGGRNVLYSASHDRTVRCWDMAA 306

 Score = 34.3 bits (77), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 35/175 (20%), Positives = 62/175 (35%), Gaps = 47/175 (26%)

Query: 177 LWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLW-SVEGKLQNILSYHR 235
           LWN  +        TG Q  V  + ++P G+ +++      ++LW   +GK       H 
Sbjct: 383 LWNPLKGSKPILRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFIATFRGHV 442

Query: 236 APIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDK 295
           A +  + W+SD   +++C  D    VW+V +                 L VD        
Sbjct: 443 ASVYQVAWSSDCRLLVSCSKDTTLKVWDVKT---------------RKLTVD-------- 479

Query: 296 FAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW 350
                                  L GH+  + T+ ++   K + S   D  +R+W
Sbjct: 480 -----------------------LPGHNDEVYTVDWSVDGKRVCSGGKDKMVRLW 511

>AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH]
           (328838..331645) [2808 bp, 935 aa]
          Length = 935

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 55/232 (23%), Positives = 106/232 (45%), Gaps = 22/232 (9%)

Query: 177 LWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGK--LQNILSYH 234
           +WNI     + + + G      C ++ P G  ++ G  +G+L+L+ +     L+NI   H
Sbjct: 410 VWNIKTKTCIRNLDCGY---ALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAH 466

Query: 235 RAPIVCIKWNSDETHVLTCDADNMTIVWN------VLSGTAVQHFSFKEA---GTEESLG 285
            A I  +   SD   ++T  AD     W+      +++GT +  F  K      T   LG
Sbjct: 467 TAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGT-LDKFVPKMKLIHDTTLDLG 525

Query: 286 VDATWID---QDKF-AIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSA 341
            D   +    +D+F A+  +  ++ VF +   K    L GH   + ++  +  +KL++++
Sbjct: 526 EDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITS 585

Query: 342 SDDNTLRVWRGGNLNPSH-VFYGHSQSITSAHWVDDD-TIISTSMDGSIRVW 391
           S D  +++W G +    H   + H  SI +  ++ +     S S DG+++ W
Sbjct: 586 SADKNIKIW-GLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYW 636

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 48/106 (45%)

Query: 296 FAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNL 355
            A+    G+I ++++     +     HS  +T + +++    L+S S D T+ +W     
Sbjct: 90  LAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAE 149

Query: 356 NPSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVAS 401
                   H  +IT     +DD +IS S DG I++W +  +  V +
Sbjct: 150 TGLCKLRSHKDAITGIWCENDDWLISVSKDGLIKLWDMKVHQCVET 195

 Score = 33.1 bits (74), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 1/72 (1%)

Query: 327 TTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDT-IISTSMD 385
           T + Y+E   +L     D T+++W         VF+ HS +IT   +    T +IS S D
Sbjct: 79  TYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRD 138

Query: 386 GSIRVWSLASNS 397
            +I +W L + +
Sbjct: 139 ATIILWDLVAET 150

 Score = 32.3 bits (72), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 27/144 (18%), Positives = 66/144 (45%), Gaps = 17/144 (11%)

Query: 303 GSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW-----RGGNLNP 357
            ++L+    + + + KL+  S T+ T +  E    L+  + +NT+  +     +   L P
Sbjct: 316 ANLLLHPFQLVRSLFKLKASSWTVCTPSKLE----LVITTANNTIEYYSIPYKKKEPLQP 371

Query: 358 SHVFY------GHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFT 411
           + +        GH   + +A    DD +++T+ +G+++VW++ + + + +  +D      
Sbjct: 372 TAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIKTKTCIRN--LDCGYALC 429

Query: 412 GALSPDQGKFATGTLDGEVMVYDI 435
               P       GT  G++ ++D+
Sbjct: 430 CKFLPGGALVILGTRAGQLQLFDL 453

 Score = 30.0 bits (66), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 30/154 (19%), Positives = 68/154 (44%), Gaps = 7/154 (4%)

Query: 199 CLEWAPAGQSLLTGVESGELRLWSVEGKLQNILSY--HRAPIVCIKWNSDETHVLTCDAD 256
           C++ +P  + L   +    ++++ ++  ++  LS   H+ P++ +  + D   ++T  AD
Sbjct: 530 CVKISPEDRFLAVSLLDNTVKVFFLDS-MKFFLSLYGHKLPVLSMDISHDSKLIITSSAD 588

Query: 257 NMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPI 316
               +W +  G    H S      ++S+       +   F      G++  ++      I
Sbjct: 589 KNIKIWGLDFGDC--HKSL--FAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCI 644

Query: 317 GKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW 350
            KL GH   +  +A +   + ++S S D ++RVW
Sbjct: 645 QKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVW 678

>YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer
           (COPI) complex alpha chain (alpha-COP) of secretory
           pathway vesicles required for retrograde Golgi to
           endoplasmic reticulum transport, member of WD (WD-40)
           repeat family [3606 bp, 1201 aa]
          Length = 1201

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 87/191 (45%), Gaps = 8/191 (4%)

Query: 261 VWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLR 320
           +W+   GT +  F   E G    L    T   Q  F   G   +I V+++  +K +  L 
Sbjct: 37  LWDYRMGTLLHRFEDHE-GPVRGLDFHPT---QPIFVSAGDDYTIKVWSLDTNKCLYTLT 92

Query: 321 GHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHW-VDDDTI 379
           GH   + T+ ++     ++SASDD T+R+W   N        GH+  +  A +   DD I
Sbjct: 93  GHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLI 152

Query: 380 ISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQKLL 439
           +S S+D +IR+W ++      SA   G  +F   +S  Q     G+L   V+ + ++   
Sbjct: 153 VSASLDETIRIWDISGLRKRHSAP--GTSSFEEQMSAQQN-LLDGSLGDCVVKFILEGHT 209

Query: 440 QQLNHNGYHGT 450
           + +N   +H T
Sbjct: 210 RGVNWASFHPT 220

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/233 (19%), Positives = 100/233 (42%), Gaps = 21/233 (9%)

Query: 209 LLTGVESGELRLWSVEGKLQ-NILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSG 267
           +++  +   +R+W+ + + +   L+ H   ++C +++  +  +++   D    +W++ SG
Sbjct: 110 IISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLIVSASLDETIRIWDI-SG 168

Query: 268 TAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLT 327
              +H +   +  EE +      +D       G  G  +V  I        L GH++ + 
Sbjct: 169 LRKRHSAPGTSSFEEQMSAQQNLLD-------GSLGDCVVKFI--------LEGHTRGVN 213

Query: 328 TIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHV--FYGHSQSITSAHW-VDDDTIISTSM 384
             +++    L++S SDD  +++WR        V    GH+ ++ S  +    + IIS   
Sbjct: 214 WASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQNLIISVGE 273

Query: 385 DGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQK 437
           D ++RVW L   + V     +    +  A  P    F     D  +MV+ + +
Sbjct: 274 DKTLRVWDLDKRTPVKQFKRENDRFWLIAAHPHINLFGAAH-DSGIMVFKLDR 325

>Scas_585.8
          Length = 460

 Score = 61.2 bits (147), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 54/252 (21%), Positives = 109/252 (43%), Gaps = 9/252 (3%)

Query: 197 VTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDAD 256
           +  + W P G+ L+    +GE  LW+     ++++  H + + CI+++     + + DAD
Sbjct: 93  IPAITWTPEGRRLVVATYNGEFSLWNGTSFNESLMQAHDSAVSCIQYSHAGDWMCSGDAD 152

Query: 257 NMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQD-KFAIPGIQGSILVFNIGISKP 315
               +W        +   F+ A TE     D ++ + D KF        + ++N    + 
Sbjct: 153 GGIKIWQPNFNMVKE---FENAHTE--CIRDISFSNNDSKFVTCSDDNVLKIWNFSNGQV 207

Query: 316 IGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW--RGGNLNPSHVFYGHSQSITSAHW 373
              L GH   + +  ++    L++SAS DN +++W  R G    + + + H+   T    
Sbjct: 208 ERTLSGHHWDIKSCDWHPEMGLIVSASKDNLVKLWDPRSGQCISTIIKFKHTVLKTRFQP 267

Query: 374 VDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSP-DQGKFATGTLDGEVMV 432
              + + + S D S RV+ +  +        D V   T   +P ++  F  G  DG +  
Sbjct: 268 TRGNLLAAISKDKSCRVFDIRHSMKELMCVRDEVDYMTLTWNPINESMFTVGNYDGAMKY 327

Query: 433 YDIQKLLQQLNH 444
           +D+ + L+  +H
Sbjct: 328 FDLLQDLEGPSH 339

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/197 (21%), Positives = 78/197 (39%), Gaps = 49/197 (24%)

Query: 209 LLTGVESGELRLWSV-EGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSG 267
            +T  +   L++W+   G+++  LS H   I    W+ +   +++   DN+  +W+  SG
Sbjct: 188 FVTCSDDNVLKIWNFSNGQVERTLSGHHWDIKSCDWHPEMGLIVSASKDNLVKLWDPRSG 247

Query: 268 TAV------QH--------------------------FSFKEAGTEESLGVDA------T 289
             +      +H                          F  + +  E     D       T
Sbjct: 248 QCISTIIKFKHTVLKTRFQPTRGNLLAAISKDKSCRVFDIRHSMKELMCVRDEVDYMTLT 307

Query: 290 W--IDQDKFAIPGIQGSILVFNI-----GISKPIGKLRGHSKTLTTIAYNEHNKLLLSAS 342
           W  I++  F +    G++  F++     G S  I     H K +T++AYN    +L SAS
Sbjct: 308 WNPINESMFTVGNYDGAMKYFDLLQDLEGPSHVIP--YAHDKCVTSMAYNPAGNILASAS 365

Query: 343 DDNTLRVW-RGGNLNPS 358
            D T+R W R   ++P+
Sbjct: 366 KDRTIRFWTRAKPVDPN 382

 Score = 32.3 bits (72), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 37/91 (40%), Gaps = 7/91 (7%)

Query: 132 IKTLQCVQTFPPGYVSQWNPKHEGVFAYGERDSRAAVVTYSVADGLWNISETVVLADANT 191
           +K L CV+         WNP +E +F  G  D   A+  + +   L   S  +  A    
Sbjct: 291 MKELMCVRDEVDYMTLTWNPINESMFTVGNYD--GAMKYFDLLQDLEGPSHVIPYA---- 344

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWS 222
                VT + + PAG  L +  +   +R W+
Sbjct: 345 -HDKCVTSMAYNPAGNILASASKDRTIRFWT 374

>KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces
           cerevisiae YBR198c TAF90 TFIID and SAGA subunit, start
           by similarity
          Length = 826

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 81/177 (45%), Gaps = 9/177 (5%)

Query: 177 LWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQ-NILSYHR 235
           LW++     L     G  + V  ++++P G   +T       RLWS +      I S H 
Sbjct: 579 LWSLDTFTCLV-CYKGHNHPVWYVKFSPLGHYFITASHDQTARLWSCDHIYPLRIFSGHL 637

Query: 236 APIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHF-SFKEAGTEESLGVDATWIDQD 294
             + C  ++ +  +V T  +D    +W++ +G +V+ F       T   +  D  W+   
Sbjct: 638 NDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGRWL--- 694

Query: 295 KFAIPGIQGSILVFNIGISKPIGKLRGHSKT-LTTIAYNEHNKLLLSASDDNTLRVW 350
                   G+I+V++IG  K I +++GH K  + +I +N+    L++   D ++RVW
Sbjct: 695 --TTGSEDGTIIVWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVW 749

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/267 (18%), Positives = 105/267 (39%), Gaps = 63/267 (23%)

Query: 197 VTCLEWAPAGQSLLTGVESGELRLWSVEG-KLQNILSY-------------HRAPIVCIK 242
           +TC+E++   +    G +   +++W ++G  LQ+IL               H  P+  + 
Sbjct: 501 MTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSATLVGHSGPVYSVA 560

Query: 243 WNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQ 302
           ++ D  ++L+   D    +W++ + T +  +                             
Sbjct: 561 FSPDNRYLLSASEDKTVRLWSLDTFTCLVCY----------------------------- 591

Query: 303 GSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFY 362
                            +GH+  +  + ++      ++AS D T R+W   ++ P  +F 
Sbjct: 592 -----------------KGHNHPVWYVKFSPLGHYFITASHDQTARLWSCDHIYPLRIFS 634

Query: 363 GHSQSITSAHWVDDDTIIST-SMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKF 421
           GH   +  + +  +   + T S D + R+W + +  +V        P     +SPD    
Sbjct: 635 GHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGRWL 694

Query: 422 ATGTLDGEVMVYDI--QKLLQQLNHNG 446
            TG+ DG ++V+DI   K ++Q+  +G
Sbjct: 695 TTGSEDGTIIVWDIGTGKRIKQMKGHG 721

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 53/116 (45%), Gaps = 8/116 (6%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWSV-EGK-LQNILSYHRAPIVCIKWNSDETH 249
           G  + VT LE +P G+ L TG E G + +W +  GK ++ +  + + PI  I +N +   
Sbjct: 677 GHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGTGKRIKQMKGHGKNPIYSITFNKEGNC 736

Query: 250 VLTCDADNMTIVWNVLSGT------AVQHFSFKEAGTEESLGVDATWIDQDKFAIP 299
           ++T  AD    VW++   T        Q F+      E S+  D     + +  IP
Sbjct: 737 LVTGGADQSVRVWDIKRFTNEPGMEPEQQFNTYSGDMELSVNNDIKEFGRRRAVIP 792

>Scas_707.22
          Length = 730

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 61/252 (24%), Positives = 107/252 (42%), Gaps = 34/252 (13%)

Query: 197 VTCLEWAPAGQSLLTGVESGELRLWSVEGK-LQNILSYHRAPIVCIKWNSDETHVLTCDA 255
           VTCL++      ++TG +  +LR++    K     LS H   +  +K+++D   +++   
Sbjct: 359 VTCLQFE--DDYVITGADDRQLRIYDARSKKFLKELSGHEGGVWALKYDADGI-IVSGST 415

Query: 256 DNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSIL--------- 306
           D    +W++  G     F   +  T     ++       K+ + G + + L         
Sbjct: 416 DRSVRIWDIKRGCCTHVF---KGHTSTVRCLEIVTYKNMKYIVTGSRDNTLHVWKLIKEE 472

Query: 307 --------VFNIGISKP--IGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLN 356
                   V+N     P  +G LRGH  ++ TI+   H  +++S S DN L VW    + 
Sbjct: 473 KFDGELPMVYNTPEENPYFVGVLRGHMASVRTIS--GHGNIVISGSYDNNLMVWDIAQMK 530

Query: 357 PSHVFYGHSQSITSAHWV-DDDTIISTSMDGSIRVWSLAS-----NSTVASATVDGVPNF 410
             +V  GH+  I S  +       IS SMD +I+VW L +     N T+ + +       
Sbjct: 531 CLYVLIGHTDRIYSTIYDHKRQRCISASMDSTIKVWDLDNIWNNGNCTIITNSATPCTKI 590

Query: 411 TGALSPDQGKFA 422
           TG++   QG  A
Sbjct: 591 TGSMLTLQGHTA 602

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 48/113 (42%), Gaps = 4/113 (3%)

Query: 347 LRVWRGGNLNPSHV-FYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVD 405
           L+ W   +  P      GH+ S+ +    +DD +I+ + D  +R++   S   +    + 
Sbjct: 336 LQNWYNPSFKPERTTLTGHATSVVTCLQFEDDYVITGADDRQLRIYDARSKKFLKE--LS 393

Query: 406 GVPNFTGALSPD-QGKFATGTLDGEVMVYDIQKLLQQLNHNGYHGTARSAEVA 457
           G      AL  D  G   +G+ D  V ++DI++        G+  T R  E+ 
Sbjct: 394 GHEGGVWALKYDADGIIVSGSTDRSVRIWDIKRGCCTHVFKGHTSTVRCLEIV 446

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 49/109 (44%), Gaps = 21/109 (19%)

Query: 303 GSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNL------- 355
            +++V++I   K +  L GH+  + +  Y+   +  +SAS D+T++VW   N+       
Sbjct: 519 NNLMVWDIAQMKCLYVLIGHTDRIYSTIYDHKRQRCISASMDSTIKVWDLDNIWNNGNCT 578

Query: 356 ------NPSH-------VFYGHSQSITSAHWVDDDTIISTSMDGSIRVW 391
                  P            GH+ ++     + D  ++S + DGS+R W
Sbjct: 579 IITNSATPCTKITGSMLTLQGHT-ALVGLLRLSDKYLVSAAADGSLRGW 626

>AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH]
           complement(257969..259858) [1890 bp, 629 aa]
          Length = 629

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 62/263 (23%), Positives = 112/263 (42%), Gaps = 36/263 (13%)

Query: 202 WAPAGQSLLTGVESGELRLWSV-EGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTI 260
           ++P G+ L TG E   +R+W +   K+   L  H   I  + +      +++   D    
Sbjct: 360 FSPDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVR 419

Query: 261 VWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKL- 319
           +W++ +G      S ++  T     V  +  D    A   +  ++ V++      + +L 
Sbjct: 420 IWDLRTGQCSLTLSIEDGVTT----VAVSPGDGKYIAAGSLDRTVRVWDSETGFLVERLD 475

Query: 320 ------RGHSKTLTTIAYNEHNKLLLSASDDNTLRVW--RGGNLNPSHV-----FYGHSQ 366
                  GH  ++ ++ +    + ++S S D ++++W  RG N   SH      + GH  
Sbjct: 476 SENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNGQKSHATCEVTYTGHKD 535

Query: 367 SITS-AHWVDDDTIISTSMDGSIRVWSLAS-----------NSTVASATVDGVPNFTGAL 414
            + S A   DD+ I+S S D  +  W  AS           NS ++ A V+G P     L
Sbjct: 536 FVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNSVISVAVVNGFP-----L 590

Query: 415 SPDQGKFATGTLDGEVMVYDIQK 437
            PD G FATG+ D +  ++   K
Sbjct: 591 GPDVGVFATGSGDCKARIWKYTK 613

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 71/151 (47%), Gaps = 14/151 (9%)

Query: 305 ILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW--RGGNLNPSHVFY 362
           I ++++   K +  L+GH + + ++ Y      L+S S D T+R+W  R G  + +    
Sbjct: 376 IRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSLTLSIE 435

Query: 363 GHSQSITSAHWVDDDTIISTSMDGSIRVWS---------LASNSTVASATVDGVPNFTGA 413
               ++  +   D   I + S+D ++RVW          L S + +++   D V  ++  
Sbjct: 436 DGVTTVAVSPG-DGKYIAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSV--YSVV 492

Query: 414 LSPDQGKFATGTLDGEVMVYDIQKLLQQLNH 444
            + D     +G+LD  V ++D++ L  Q +H
Sbjct: 493 FTRDGQGVISGSLDRSVKLWDLRGLNGQKSH 523

>Scas_713.50
          Length = 983

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 105/233 (45%), Gaps = 24/233 (10%)

Query: 177 LWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQ--NILSYH 234
           +WN+   + +     G    +TC ++ P G  ++ G  +GEL+L+ +    Q  NI   H
Sbjct: 454 IWNLKTKLCIRTFECGYA--LTC-KFLPGGMLVIIGTRAGELQLFDLASSTQIANIEEAH 510

Query: 235 RAPIVCIKWNSDETHVLTCDADNMTIVWN------VLSGTAVQ-------HFSFKEAGTE 281
            A I  +   SD   ++T  AD     WN      ++ GT+ +       H       ++
Sbjct: 511 DAAIWSLDLTSDGKRLITGSADKSVKFWNFQLEQELVPGTSDKFVPKLGLHHDTTLELSD 570

Query: 282 ESLGVDATWIDQDKF-AIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLS 340
           + L V  +   +DKF A+  +  ++ VF +   K    L GH   + +I  +  +K++++
Sbjct: 571 DILSVRVS--PEDKFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKMIIT 628

Query: 341 ASDDNTLRVWRGGNLNPSH-VFYGHSQSITSAHWVDDD-TIISTSMDGSIRVW 391
           +S D  +++W G +    H   + H  SI +  +V +     S S DG I+ W
Sbjct: 629 SSADKNIKIW-GLDFGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGIIKYW 680

 Score = 38.1 bits (87), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 49/110 (44%), Gaps = 12/110 (10%)

Query: 303 GSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFY 362
           G + V+++     +  L GHS  +T + ++     L+S S D+ + VW   +    +   
Sbjct: 128 GVVKVWDLYSKTVLCNLNGHSSAITALKFDTSGTRLISGSRDSNIIVWDLVSEVGLYKLR 187

Query: 363 GHSQSITSAHWVDD-----------DTIISTSMDGSIRVWSLASNSTVAS 401
            H  +IT   W ++           D +ISTS DG I++W L     V +
Sbjct: 188 SHKDAITGI-WCNEVTNNNQEENELDWLISTSKDGLIKIWDLKIQQCVET 236

 Score = 33.1 bits (74), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 39/89 (43%), Gaps = 2/89 (2%)

Query: 363 GHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFA 422
           G    I S    DD+ +++T+ +GS+++W+L +   +   T +     T    P      
Sbjct: 427 GQRTDIRSIDISDDNKLLATASNGSLKIWNLKTKLCI--RTFECGYALTCKFLPGGMLVI 484

Query: 423 TGTLDGEVMVYDIQKLLQQLNHNGYHGTA 451
            GT  GE+ ++D+    Q  N    H  A
Sbjct: 485 IGTRAGELQLFDLASSTQIANIEEAHDAA 513

>Sklu_2173.2 YCR072C, Contig c2173 2732-4279
          Length = 515

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 66/275 (24%), Positives = 109/275 (39%), Gaps = 65/275 (23%)

Query: 177 LWNISETVVLADANTGQQNEVTCLEWAP-----AGQS--LLTGVESGELRLWSVEGKLQN 229
           LW  ++   + DA  G    +T L W P      GQ   L +  + G +++W    ++  
Sbjct: 212 LWEGNKGQPVGDALRGHGKWITSLSWEPIHLVKPGQKPRLASASKDGTIKIWDTTRRVCL 271

Query: 230 I-LSYHRAPIVCIKWNS-----DETHVLTCDADNMTI---VWNVLSGTA--VQHFSF--- 275
           I LS H + + CIKW         +H  T  A +M +     N+L   A  V H S    
Sbjct: 272 ITLSGHTSSVSCIKWGGQGVLYSGSHDKTIRAWDMNLGGKCINILKSHAHWVNHLSLSTD 331

Query: 276 ---------------------------------KEAGTEESLGVDATWIDQDKFAIPGIQ 302
                                            K  G  E L V A+    D F +    
Sbjct: 332 YALRIGAFDHTSEKPSTPEEAQKRALKNYEKIAKRNGEVEELMVTAS----DDFTM---- 383

Query: 303 GSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFY 362
              L   +  +KPI ++ GH K +  +A++   + ++SAS DN++++W G +      F 
Sbjct: 384 --YLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWNGRDGKFISTFR 441

Query: 363 GHSQSITSAHWVDD-DTIISTSMDGSIRVWSLASN 396
           GH  S+    W  D   ++S S D +++VW + + 
Sbjct: 442 GHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTK 476

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 70/156 (44%), Gaps = 19/156 (12%)

Query: 307 VFNIGISKPIGK----LRGHSKTLTTIAYNEH-NKLLLSASDDNTLRVWRGGNLNPSHVF 361
           VF +   KP+ +    + GH  T+   A+  H +  +++ + DNT R+W      P    
Sbjct: 126 VFKV---KPVTRSSSAIAGHGSTILCSAFAPHTSSRMITGAGDNTARIWDCNTQTPMSTL 182

Query: 362 YGHSQSITSAHWVDDDTIIST-SMDGSIRVWSLASNSTVASATVDGVPNFTGALS----- 415
            GH   +    W  D  +I+T SMD +IR+W       V  A + G   +  +LS     
Sbjct: 183 KGHFNWVLCVSWSPDGELIATGSMDNTIRLWEGNKGQPVGDA-LRGHGKWITSLSWEPIH 241

Query: 416 ---PDQG-KFATGTLDGEVMVYDIQKLLQQLNHNGY 447
              P Q  + A+ + DG + ++D  + +  +  +G+
Sbjct: 242 LVKPGQKPRLASASKDGTIKIWDTTRRVCLITLSGH 277

 Score = 48.9 bits (115), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 63/287 (21%), Positives = 107/287 (37%), Gaps = 52/287 (18%)

Query: 149 WNPKHEGVFAYGERDSRAAVVTYSVADGLWNISETVVLADANTGQQNEVTCLEWAPAGQS 208
           W P H  +   G++  R A  +      +W+ +  V L    +G  + V+C++W   GQ 
Sbjct: 237 WEPIH--LVKPGQK-PRLASASKDGTIKIWDTTRRVCLITL-SGHTSSVSCIKWG--GQG 290

Query: 209 LL-TGVESGELRLWSVE--GKLQNILSYHRAPIVCIKWNSD------------------- 246
           +L +G     +R W +   GK  NIL  H   +  +  ++D                   
Sbjct: 291 VLYSGSHDKTIRAWDMNLGGKCINILKSHAHWVNHLSLSTDYALRIGAFDHTSEKPSTPE 350

Query: 247 --------------------ETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGV 286
                               E  ++T   D    +WN L  T       +  G ++ +  
Sbjct: 351 EAQKRALKNYEKIAKRNGEVEELMVTASDDFTMYLWNPLKSTKP---ITRMTGHQKLVNH 407

Query: 287 DATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNT 346
            A   D           SI ++N    K I   RGH  ++  +A++   +LL+S S D T
Sbjct: 408 VAFSPDGRHIVSASFDNSIKLWNGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTT 467

Query: 347 LRVWRGGNLNPSHVFYGHSQSITSAHW-VDDDTIISTSMDGSIRVWS 392
           L+VW       +    GH   + +  W VD   + S   D  +R+W+
Sbjct: 468 LKVWDVKTKKLAVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLWT 514

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 62/139 (44%), Gaps = 12/139 (8%)

Query: 307 VFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNP-SHVFYGHS 365
           +++     P+  L+GH   +  ++++   +L+ + S DNT+R+W G    P      GH 
Sbjct: 170 IWDCNTQTPMSTLKGHFNWVLCVSWSPDGELIATGSMDNTIRLWEGNKGQPVGDALRGHG 229

Query: 366 QSITSAHWV--------DDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALS-P 416
           + ITS  W             + S S DG+I++W   +   V   T+ G  +    +   
Sbjct: 230 KWITSLSWEPIHLVKPGQKPRLASASKDGTIKIWD--TTRRVCLITLSGHTSSVSCIKWG 287

Query: 417 DQGKFATGTLDGEVMVYDI 435
            QG   +G+ D  +  +D+
Sbjct: 288 GQGVLYSGSHDKTIRAWDM 306

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 46/217 (21%), Positives = 78/217 (35%), Gaps = 56/217 (25%)

Query: 187 ADANTGQQNEVTCLEWAPAGQS-LLTGVESGELRLWSVEGKL-QNILSYHRAPIVCIKWN 244
           + A  G  + + C  +AP   S ++TG      R+W    +   + L  H   ++C+ W+
Sbjct: 136 SSAIAGHGSTILCSAFAPHTSSRMITGAGDNTARIWDCNTQTPMSTLKGHFNWVLCVSWS 195

Query: 245 SDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGS 304
            D   + T   DN   +W                                     G +G 
Sbjct: 196 PDGELIATGSMDNTIRLWE------------------------------------GNKG- 218

Query: 305 ILVFNIGISKPIGK-LRGHSKTLTTIAYNE-------HNKLLLSASDDNTLRVWRGGNLN 356
                    +P+G  LRGH K +T++++             L SAS D T+++W      
Sbjct: 219 ---------QPVGDALRGHGKWITSLSWEPIHLVKPGQKPRLASASKDGTIKIWDTTRRV 269

Query: 357 PSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSL 393
                 GH+ S++   W     + S S D +IR W +
Sbjct: 270 CLITLSGHTSSVSCIKWGGQGVLYSGSHDKTIRAWDM 306

>Scas_624.11
          Length = 1205

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 101/229 (44%), Gaps = 19/229 (8%)

Query: 261 VWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLR 320
           +W+   GT +  F   E G   S+    T   Q  F   G   +I V+++  +K +  L 
Sbjct: 37  LWDYRMGTLLHRFEDHE-GPVRSVDFHPT---QPIFVSGGDDYTIKVWSLETNKCLYTLN 92

Query: 321 GHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHW-VDDDTI 379
           GH   + T+ +++    ++SASDD T+R+W   N        GH+  +  A +   DD +
Sbjct: 93  GHLDYIRTVFFHKELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLV 152

Query: 380 ISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQKLL 439
           +S S+D +IRVW ++      SA   G   F   ++  Q     G  D  V+ + ++   
Sbjct: 153 VSASLDETIRVWDISGLRKKHSAP--GTSTFDDQMAAQQNLLDGGFGDC-VVKFILEGHT 209

Query: 440 QQLNHNGYHGTARSAEVARIPVV---GDHRSAREGNYVTQISWSQESTQ 485
           + +N   +H T        +P++    D R  +   Y +  +W  ++ +
Sbjct: 210 RGVNWASFHPT--------LPMIVSGSDDRQVKLWKYNSTKAWEVDTCR 250

 Score = 33.9 bits (76), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 30/172 (17%), Positives = 72/172 (41%), Gaps = 31/172 (18%)

Query: 209 LLTGVESGELRLWSVEGKLQ-NILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSG 267
           +++  +   +R+W+ + + +   L+ H   ++C +++  +  V++   D    VW++ SG
Sbjct: 110 IISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLVVSASLDETIRVWDI-SG 168

Query: 268 TAVQHFSFKEAGTEESLGVDATWIDQD------KFAIPG-----------------IQGS 304
              +H +   +  ++ +      +D        KF + G                 + GS
Sbjct: 169 LRKKHSAPGTSTFDDQMAAQQNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLPMIVSGS 228

Query: 305 ------ILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW 350
                 +  +N   +  +   RGH+  +  + ++   K +LS  +D TLR+W
Sbjct: 229 DDRQVKLWKYNSTKAWEVDTCRGHTNNVDCVIFHPTQKFILSVGEDKTLRIW 280

>YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associated
           splicing factor, member of WD (WD-40) repeat family
           [1398 bp, 465 aa]
          Length = 465

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 61/125 (48%), Gaps = 1/125 (0%)

Query: 314 KPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHW 373
           + +G L GH + ++ + Y+   K + SAS D T R+W         +  GH + + S  +
Sbjct: 256 RLLGDLVGHERRISDVKYHPSGKFIGSASHDMTWRLWDASTHQELLLQEGHDKGVFSLSF 315

Query: 374 -VDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMV 432
             D   + S  MD    +W + S S V +      P +T A SP+  + ATG  DG + V
Sbjct: 316 QCDGSLVCSGGMDSLSMLWDIRSGSKVMTLAGHSKPIYTVAWSPNGYQVATGGGDGIINV 375

Query: 433 YDIQK 437
           +DI+K
Sbjct: 376 WDIRK 380

 Score = 33.9 bits (76), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 35/183 (19%), Positives = 74/183 (40%), Gaps = 60/183 (32%)

Query: 177 LWNI---SETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSV----EGKLQN 229
           LW+I   S+ + LA    G    +  + W+P G  + TG   G + +W +    EG+L  
Sbjct: 333 LWDIRSGSKVMTLA----GHSKPIYTVAWSPNGYQVATGGGDGIINVWDIRKRDEGQLNQ 388

Query: 230 ILSYHRAPIVCIKWNSDE--THVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVD 287
           IL+ HR  +  ++++ ++    +++C  DN+  V++                        
Sbjct: 389 ILA-HRNIVTQVRFSKEDGGKKLVSCGYDNLINVYS-----------------------S 424

Query: 288 ATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTL 347
            TW+                        +G L GH+  + ++  + ++  L+S   D ++
Sbjct: 425 DTWL-----------------------KMGSLAGHTDKIISLDISNNSHFLVSGGWDRSI 461

Query: 348 RVW 350
           ++W
Sbjct: 462 KLW 464

 Score = 29.3 bits (64), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 34/207 (16%), Positives = 75/207 (36%), Gaps = 52/207 (25%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNILSY-HRAPIVCIKWNSDETHV 250
           G +  ++ +++ P+G+ + +       RLW      + +L   H   +  + +  D + V
Sbjct: 263 GHERRISDVKYHPSGKFIGSASHDMTWRLWDASTHQELLLQEGHDKGVFSLSFQCDGSLV 322

Query: 251 LTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNI 310
            +   D+++++W++ SG+ V                                        
Sbjct: 323 CSGGMDSLSMLWDIRSGSKVM--------------------------------------- 343

Query: 311 GISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW--RGGNLNPSHVFYGHSQSI 368
                   L GHSK + T+A++ +   + +   D  + VW  R  +    +    H   +
Sbjct: 344 -------TLAGHSKPIYTVAWSPNGYQVATGGGDGIINVWDIRKRDEGQLNQILAHRNIV 396

Query: 369 TSAHWVDDD---TIISTSMDGSIRVWS 392
           T   +  +D    ++S   D  I V+S
Sbjct: 397 TQVRFSKEDGGKKLVSCGYDNLINVYS 423

>YNL006W (LST8) [4579] chr14 (620066..620977) Protein required for
           transport of permeases from the Golgi to the plasma
           membrane [912 bp, 303 aa]
          Length = 303

 Score = 58.5 bits (140), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/216 (21%), Positives = 93/216 (43%), Gaps = 11/216 (5%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVL 251
           G +  VT + +    + ++T  E G +++W V          H AP+  +  + ++  ++
Sbjct: 73  GHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELI 132

Query: 252 TCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIG 311
           +CD D    +W++         + ++  + +SL + +   D    A    +G+  V+ + 
Sbjct: 133 SCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMAS---DGSMLAAANTKGNCYVWEMP 189

Query: 312 IS------KPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWR-GGNLNPSHVFYGH 364
                   KP+ K R HS  +T I  +   K L + S D+T RVW    +        GH
Sbjct: 190 NHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGH 249

Query: 365 SQSI-TSAHWVDDDTIISTSMDGSIRVWSLASNSTV 399
            + +   A   D   +++ S D  +R+W L++   V
Sbjct: 250 QRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIV 285

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 55/104 (52%), Gaps = 4/104 (3%)

Query: 335 NKLLLSASDDNTLRVW--RGGNLNPSHVFYGHSQSITSAHWVDDDT-IISTSMDGSIRVW 391
           +K LL+ +    +R++  R  N NP   F GH  ++TS  +  D+  ++++S DG+I+VW
Sbjct: 43  DKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVW 102

Query: 392 SLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDI 435
            + S S +        P     + P+QG+  +   DG + ++D+
Sbjct: 103 DVRSPS-IPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/151 (21%), Positives = 72/151 (47%), Gaps = 12/151 (7%)

Query: 292 DQDKFAIPGIQGSILVFNIGISKP--IGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRV 349
           D+   A  G Q ++ +++I  + P  +    GH   +T++++ + N+ ++++S+D T++V
Sbjct: 43  DKKLLATAGHQ-NVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKV 101

Query: 350 W--RGGNLNPSHVFYGHSQSITSA--HWVDDDTIISTSMDGSIRVWSLASNSTVASATVD 405
           W  R  ++  +   Y H+  +     H  +   +IS   DG+IR+W L  N      T +
Sbjct: 102 WDVRSPSIPRN---YKHNAPVNEVVIH-PNQGELISCDRDGNIRIWDLGENQCTHQLTPE 157

Query: 406 GVPNFTG-ALSPDQGKFATGTLDGEVMVYDI 435
              +    +++ D    A     G   V+++
Sbjct: 158 DDTSLQSLSMASDGSMLAAANTKGNCYVWEM 188

>YBR198C (TAF5) [381] chr2 complement(616084..618480) Component of
           the TAF(II) complex (TBP-associated protein complex) and
           SAGA complex (Spt-Ada-Gcn5-acetyltransferase), required
           for activated transcription by RNA polymerase II, member
           of WD (WD-40) repeat family [2397 bp, 798 aa]
          Length = 798

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 84/178 (47%), Gaps = 11/178 (6%)

Query: 177 LWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQ-NILSYHR 235
           LW++     L  +  G  + V  + ++P G    T       RLWS +      I + H 
Sbjct: 551 LWSMDTHTALV-SYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHL 609

Query: 236 APIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGV--DATWIDQ 293
             + C+ ++ +  +V T  +D    +W+V +G +V+ F         S+ V  D  W+  
Sbjct: 610 NDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLF-LGHTAPVISIAVCPDGRWL-- 666

Query: 294 DKFAIPGIQGSILVFNIGISKPIGKLRGHSKT-LTTIAYNEHNKLLLSASDDNTLRVW 350
              +     G I V++IG  K + ++RGH K  + +++Y++   +L+S   D+T+RVW
Sbjct: 667 ---STGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVW 721

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 64/130 (49%), Gaps = 3/130 (2%)

Query: 320 RGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDTI 379
           +GH+  +  ++++       +AS D T R+W   ++ P  +F GH   +    +  +   
Sbjct: 564 KGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCY 623

Query: 380 IST-SMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDI--Q 436
           + T S D + R+W +++  +V        P  + A+ PD    +TG+ DG + V+DI   
Sbjct: 624 VFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTG 683

Query: 437 KLLQQLNHNG 446
           K L+Q+  +G
Sbjct: 684 KRLKQMRGHG 693

>KLLA0C08547g 749737..751284 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 515

 Score = 58.9 bits (141), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 64/276 (23%), Positives = 106/276 (38%), Gaps = 69/276 (25%)

Query: 177 LWNISETVVLADANTGQQNEVTCLEWAPA-------GQSLLTGVESGELRLWSVEGKLQN 229
           LW  S+     DA  G    +T L W P           L T  + G +++W    ++  
Sbjct: 212 LWESSKGKPYGDALRGHSKWITSLSWEPIHLVKPGDKPRLATASKDGTIKIWDTTRRVCL 271

Query: 230 I-LSYHRAPIVCIKWNSDETHVLTCDADNMTI-VW---------NVLSGTA--VQHFSF- 275
           + L  H + + C+KW     +VL   + + TI  W         N+L   A  V H S  
Sbjct: 272 LTLCGHTSSVSCVKWGG--KNVLYSGSHDKTIRCWDMNLNGKCINILKSHAHWVNHLSLS 329

Query: 276 -----------------------------------KEAGTEESLGVDATWIDQDKFAIPG 300
                                              K  G  E L V A+    D F +  
Sbjct: 330 TDYALRLGAFDHKGETPASPEEAQQKALKNYEKVAKRKGDFEELMVTAS----DDFTM-- 383

Query: 301 IQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHV 360
                L   +  +KPI ++ GH K +  +A++   + ++SAS DN++++W G +      
Sbjct: 384 ----YLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFLST 439

Query: 361 FYGHSQSITSAHWVDD-DTIISTSMDGSIRVWSLAS 395
           F GH  S+    W  D   ++S S D +++VW + +
Sbjct: 440 FRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKT 475

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/220 (21%), Positives = 79/220 (35%), Gaps = 56/220 (25%)

Query: 187 ADANTGQQNEVTCLEWAPAGQS-LLTGVESGELRLWSVEGKLQNI-LSYHRAPIVCIKWN 244
           + A  G  + + C  +AP   S ++TG       +W  + + +   L  H   ++C  W+
Sbjct: 136 SSAIAGHGSTILCSAFAPNTSSRMVTGAGDNTACIWDCDTQTRMCTLQGHHNWVLCCSWS 195

Query: 245 SDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGS 304
            D   + T   DN   +W                  E S G                   
Sbjct: 196 PDGELIATGSMDNTIRLW------------------ESSKG------------------- 218

Query: 305 ILVFNIGISKPIGK-LRGHSKTLTTIAYNE-------HNKLLLSASDDNTLRVWRGGNLN 356
                    KP G  LRGHSK +T++++             L +AS D T+++W      
Sbjct: 219 ---------KPYGDALRGHSKWITSLSWEPIHLVKPGDKPRLATASKDGTIKIWDTTRRV 269

Query: 357 PSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASN 396
                 GH+ S++   W   + + S S D +IR W +  N
Sbjct: 270 CLLTLCGHTSSVSCVKWGGKNVLYSGSHDKTIRCWDMNLN 309

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 64/149 (42%), Gaps = 16/149 (10%)

Query: 314 KPIGK----LRGHSKTLTTIAYNEH-NKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSI 368
           KP+ +    + GH  T+   A+  + +  +++ + DNT  +W            GH   +
Sbjct: 130 KPVTRSSSAIAGHGSTILCSAFAPNTSSRMVTGAGDNTACIWDCDTQTRMCTLQGHHNWV 189

Query: 369 TSAHWVDDDTIIST-SMDGSIRVWSLASNSTVASATVDGVPNFTGALS---------PDQ 418
               W  D  +I+T SMD +IR+W  +       A + G   +  +LS          D+
Sbjct: 190 LCCSWSPDGELIATGSMDNTIRLWESSKGKPYGDA-LRGHSKWITSLSWEPIHLVKPGDK 248

Query: 419 GKFATGTLDGEVMVYDIQKLLQQLNHNGY 447
            + AT + DG + ++D  + +  L   G+
Sbjct: 249 PRLATASKDGTIKIWDTTRRVCLLTLCGH 277

 Score = 38.5 bits (88), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 35/175 (20%), Positives = 63/175 (36%), Gaps = 47/175 (26%)

Query: 177 LWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWS-VEGKLQNILSYHR 235
           LWN  ++       TG Q  V  + ++P G+ +++      ++LW   +GK  +    H 
Sbjct: 385 LWNPLKSTKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFLSTFRGHV 444

Query: 236 APIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDK 295
           A +  + W+SD   +++C  D    VW+V +                 L VD        
Sbjct: 445 ASVYQVAWSSDCRLLVSCSKDTTLKVWDVKT---------------RKLSVD-------- 481

Query: 296 FAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW 350
                                  L GH   + T+ ++   K + S   D  +R+W
Sbjct: 482 -----------------------LPGHQDEVYTVDWSVDGKRVCSGGKDKMVRIW 513

>Kwal_27.11585
          Length = 823

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 68/136 (50%), Gaps = 5/136 (3%)

Query: 296 FAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNL 355
           FA      +  ++N+   +  G L  H + L  + + +++KLL + S D T++VW   ++
Sbjct: 519 FATASYDKTCKIWNVDSGELEGTLANHKRGLWDVTFCQYDKLLATCSGDKTIKVWSLESM 578

Query: 356 NPSHVFYGHSQSITSAHWVD-DDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGAL 414
           +      GH+ ++    +++ +  I+ST  DG I+VW L++   +   T+D   N   AL
Sbjct: 579 SVVKTLEGHTNAVQRCSFINRNKQIVSTGADGLIKVWDLSTGECI--RTLDAHSNRIWAL 636

Query: 415 S--PDQGKFATGTLDG 428
           S   D  +F T   DG
Sbjct: 637 SVLSDGKEFVTADADG 652

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 30/162 (18%), Positives = 69/162 (42%), Gaps = 7/162 (4%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWSVE-GKLQNILSYHRAPIVCIKWNSDETHV 250
             + ++  L  +P      T       ++W+V+ G+L+  L+ H+  +  + +   +  +
Sbjct: 502 AHEKDINALSISPNDSVFATASYDKTCKIWNVDSGELEGTLANHKRGLWDVTFCQYDKLL 561

Query: 251 LTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIP-GIQGSILVFN 309
            TC  D    VW++ S + V+         +       ++I+++K  +  G  G I V++
Sbjct: 562 ATCSGDKTIKVWSLESMSVVKTLEGHTNAVQR-----CSFINRNKQIVSTGADGLIKVWD 616

Query: 310 IGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWR 351
           +   + I  L  HS  +  ++     K  ++A  D   + W+
Sbjct: 617 LSTGECIRTLDAHSNRIWALSVLSDGKEFVTADADGVFQFWK 658

>AFL009C [3184] [Homologous to ScYGL004C - SH] (420007..421248)
           [1242 bp, 413 aa]
          Length = 413

 Score = 57.8 bits (138), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 55/106 (51%), Gaps = 2/106 (1%)

Query: 295 KFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGN 354
           ++AI   +G + + N   S     L GHS  +T++ Y    K+LLSAS D  L++W   +
Sbjct: 119 QYAIGDTEGRLTLHNAEFSD-CRSLDGHSGHITSLHYFPSGKVLLSASIDMQLKIWSAAD 177

Query: 355 LNPSHVFYGHSQSITSAHWVD-DDTIISTSMDGSIRVWSLASNSTV 399
                  +GH+  IT    ++    ++S+S DGS+R+W   S S +
Sbjct: 178 GTNPRTLFGHTAPITGCGLIERGRNVLSSSKDGSVRLWECGSGSML 223

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 46/101 (45%), Gaps = 4/101 (3%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWS-VEGKLQNILSYHRAPIVCIKWNSDETHV 250
           G    +T L + P+G+ LL+     +L++WS  +G     L  H API          +V
Sbjct: 144 GHSGHITSLHYFPSGKVLLSASIDMQLKIWSAADGTNPRTLFGHTAPITGCGLIERGRNV 203

Query: 251 LTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWI 291
           L+   D    +W   SG+ ++ F  ++     S GV+A  +
Sbjct: 204 LSSSKDGSVRLWECGSGSMLRAFHRRD---RHSDGVNALQV 241

 Score = 32.7 bits (73), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 36/83 (43%), Gaps = 5/83 (6%)

Query: 317 GKLRG----HSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAH 372
           GK+R      S+ LT +A  +H +   +  D            +      GHS  ITS H
Sbjct: 94  GKVRSSLATESRNLTALAVTQHPEAQYAIGDTEGRLTLHNAEFSDCRSLDGHSGHITSLH 153

Query: 373 WVDD-DTIISTSMDGSIRVWSLA 394
           +      ++S S+D  +++WS A
Sbjct: 154 YFPSGKVLLSASIDMQLKIWSAA 176

>ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH]
           complement(375532..376881) [1350 bp, 449 aa]
          Length = 449

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/251 (19%), Positives = 101/251 (40%), Gaps = 53/251 (21%)

Query: 197 VTCLEWAPAGQSLLTGVESGELRLWSVEG-KLQNILSYHRAPIVCIKWNSDETHVLTCDA 255
           +  + W P G+ L+    SGE  LW+      ++I+  H + +  ++++     +++ DA
Sbjct: 82  IPAITWTPEGRRLVVATYSGEFSLWNGSSFNFESIMQAHDSAVTVMQYSHAGDWLISGDA 141

Query: 256 DNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKP 315
           D    +W                              Q  F +      + V +      
Sbjct: 142 DGTIKIW------------------------------QPNFNM------VKVLD------ 159

Query: 316 IGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVD 375
               R H++ +  I+++  ++  ++ SDDN L++W   N     V  GH   + S  W  
Sbjct: 160 ----RAHTECMRDISFSYSDQKFVTCSDDNVLKIWNFSNGQQERVLSGHHWDVKSCDWHP 215

Query: 376 D-DTIISTSMDGSIRVWSLASNSTVASATVDGVPN--FTGALSPDQGK-FATGTLDGEVM 431
               I+S S D  I++W   +   V  +T+ G+ +        P QG   A  + D  + 
Sbjct: 216 KMGLIVSGSKDNLIKLWDPRTGRNV--STILGLKHTVIKTKFQPTQGNLLAVVSKDKSIK 273

Query: 432 VYDIQKLLQQL 442
           +YD+++ +++L
Sbjct: 274 IYDMRQHMREL 284

 Score = 33.5 bits (75), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 47/238 (19%), Positives = 96/238 (40%), Gaps = 56/238 (23%)

Query: 174 ADG---LW--NISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSV-EGKL 227
           ADG   +W  N +   VL  A+T    +++   ++ + Q  +T  +   L++W+   G+ 
Sbjct: 141 ADGTIKIWQPNFNMVKVLDRAHTECMRDIS---FSYSDQKFVTCSDDNVLKIWNFSNGQQ 197

Query: 228 QNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAV----------------- 270
           + +LS H   +    W+     +++   DN+  +W+  +G  V                 
Sbjct: 198 ERVLSGHHWDVKSCDWHPKMGLIVSGSKDNLIKLWDPRTGRNVSTILGLKHTVIKTKFQP 257

Query: 271 ---------------------QHFSFKEAGTEESLGVDATW--IDQDKFAIPGIQGSILV 307
                                QH    +   ++   +  +W  I++  F++    G+I  
Sbjct: 258 TQGNLLAVVSKDKSIKIYDMRQHMRELQTIRDDMDYMSLSWHPINETIFSVGCYNGAIKH 317

Query: 308 FNI----GISKPIGKL--RGHSKTLTTIAYNEHNKLLLSASDDNTLRVW-RGGNLNPS 358
           F++      S P        H K++T++AY+    +L SA+ D T+R W R   ++P+
Sbjct: 318 FDLLHDNSNSTPACHTIPYAHEKSVTSLAYSPVGHILASAAKDRTIRFWARSRPVDPN 375

>AAL009C [178] [Homologous to ScYNL006W (LST8) - SH]
           (325785..326696) [912 bp, 303 aa]
          Length = 303

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/216 (20%), Positives = 91/216 (42%), Gaps = 11/216 (5%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVL 251
           G +  VT + +    + +++  E G +++W V          H AP+  +  + ++  ++
Sbjct: 73  GHRGNVTSIAFQQDNKWMVSSSEDGTIKVWDVRSPSVQRNYKHDAPVNEVVIHPNQGELI 132

Query: 252 TCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNI- 310
           +CD D    +W++         + ++    +SL + +   D         +G+  V+ + 
Sbjct: 133 SCDQDGNIKIWDLGENQCTNQLALEDNTALQSLSIAS---DGSMLVAGNNKGNCYVWKMP 189

Query: 311 -----GISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWR-GGNLNPSHVFYGH 364
                   KP+ K R HSK +T +  +   K L + S D+T RVW    N         H
Sbjct: 190 NHTDTASLKPVTKFRSHSKYITRVLLSVDVKHLATCSADHTARVWSVEDNFQLETTLDAH 249

Query: 365 SQSI-TSAHWVDDDTIISTSMDGSIRVWSLASNSTV 399
           S+ +   A   D   +++   D  +R+W L++   V
Sbjct: 250 SRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIV 285

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 59/126 (46%), Gaps = 9/126 (7%)

Query: 315 PIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW--RGGNLNPSHVFYGHSQSITSA- 371
           P+    GH   +T+IA+ + NK ++S+S+D T++VW  R  ++  +   Y H   +    
Sbjct: 67  PVTSFEGHRGNVTSIAFQQDNKWMVSSSEDGTIKVWDVRSPSVQRN---YKHDAPVNEVV 123

Query: 372 -HWVDDDTIISTSMDGSIRVWSLASN-STVASATVDGVPNFTGALSPDQGKFATGTLDGE 429
            H  +   +IS   DG+I++W L  N  T   A  D     + +++ D      G   G 
Sbjct: 124 IH-PNQGELISCDQDGNIKIWDLGENQCTNQLALEDNTALQSLSIASDGSMLVAGNNKGN 182

Query: 430 VMVYDI 435
             V+ +
Sbjct: 183 CYVWKM 188

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 56/104 (53%), Gaps = 4/104 (3%)

Query: 335 NKLLLSASDDNTLRVW--RGGNLNPSHVFYGHSQSITS-AHWVDDDTIISTSMDGSIRVW 391
           +K  L+A+    +R++  R  N NP   F GH  ++TS A   D+  ++S+S DG+I+VW
Sbjct: 43  DKRYLAAAGHLHVRMYDIRTTNPNPVTSFEGHRGNVTSIAFQQDNKWMVSSSEDGTIKVW 102

Query: 392 SLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDI 435
            + S S   +   D  P     + P+QG+  +   DG + ++D+
Sbjct: 103 DVRSPSVQRNYKHDA-PVNEVVIHPNQGELISCDQDGNIKIWDL 145

>CAGL0A00561g complement(63710..64948) similar to sp|P53196
           Saccharomyces cerevisiae YGL004c, hypothetical start
          Length = 412

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 89/204 (43%), Gaps = 31/204 (15%)

Query: 268 TAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLT 327
           T  +  S +E G  ESL + +     DK  I    G I V++      +  +  H   +T
Sbjct: 86  TPKRLVSTEELGISESLDLISCDASTDKIVIGDSGGDINVYDHEWMSKLSLVGAHVSDVT 145

Query: 328 TIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVD-DDTIISTSMDG 386
           T+     N +LLS S D  L+VW   + +      GHS  IT    ++    ++S+S+DG
Sbjct: 146 TVKIFPSNAVLLSGSTDMQLKVWSLEDGSNPRTLKGHSAGITDTIIIERGRNVLSSSLDG 205

Query: 387 SIRVWSLASNSTVAS-----ATVDGVPNF---------------TGALSPDQGKFAT--- 423
           S+R+W L S  T++       T DGV +                T   + D+ +F T   
Sbjct: 206 SVRLWELGSGKTISKFCRKENTTDGVTSMSLLVGEESTSMSAQVTDRETGDRLEFGTEGK 265

Query: 424 ----GTLDGEVMVYDI---QKLLQ 440
               G L G + V+D+   Q++LQ
Sbjct: 266 QVFAGHLSGTITVHDLFNKQQILQ 289

 Score = 35.4 bits (80), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 41/88 (46%), Gaps = 1/88 (1%)

Query: 195 NEVTCLEWAPAGQSLLTGVESGELRLWSVE-GKLQNILSYHRAPIVCIKWNSDETHVLTC 253
           ++VT ++  P+   LL+G    +L++WS+E G     L  H A I          +VL+ 
Sbjct: 142 SDVTTVKIFPSNAVLLSGSTDMQLKVWSLEDGSNPRTLKGHSAGITDTIIIERGRNVLSS 201

Query: 254 DADNMTIVWNVLSGTAVQHFSFKEAGTE 281
             D    +W + SG  +  F  KE  T+
Sbjct: 202 SLDGSVRLWELGSGKTISKFCRKENTTD 229

>Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement
          Length = 749

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 78/162 (48%), Gaps = 8/162 (4%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQ-NILSYHRAPIVCIKWNSDETHV 250
           G  + V  + ++P G    T       RLWS +      I + H   + C+ ++ + T+V
Sbjct: 516 GHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYV 575

Query: 251 LTCDADNMTIVWNVLSGTAVQHFSFKEAGT-EESLGVDATWIDQDKFAIPGIQGSILVFN 309
            T   D    +W++ +G +V+ F    A     ++  D  W+     +     G I V++
Sbjct: 576 FTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWL-----STGSEDGIINVWD 630

Query: 310 IGISKPIGKLRGHSKT-LTTIAYNEHNKLLLSASDDNTLRVW 350
           IG  K + ++RGH K  + +++Y++   +L+S   D+++RVW
Sbjct: 631 IGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVW 672

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 59/302 (19%), Positives = 121/302 (40%), Gaps = 68/302 (22%)

Query: 162 RDSRAAVVTYSVADGLWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLW 221
           R+SR A+      D L + + +V +   +   + ++TCLE++        G +   ++LW
Sbjct: 394 RESRDAIK----LDNLQSAAPSVCMYTFHNTNR-DMTCLEFSDDATLAAAGFQDSYIKLW 448

Query: 222 SVEG-------------KLQNI-LSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSG 267
           S++G             K+ N  L  H   +    ++ D  ++L+   D    +W++ + 
Sbjct: 449 SLDGTPLDSKLPSKQREKINNTTLIGHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTY 508

Query: 268 TAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLT 327
           +++  +                                              +GH+  + 
Sbjct: 509 SSLVSY----------------------------------------------KGHNHPVW 522

Query: 328 TIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDTIIST-SMDG 386
            ++++       +AS D T R+W   ++ P  +F GH   +    +  + T + T S D 
Sbjct: 523 DVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDK 582

Query: 387 SIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDI--QKLLQQLNH 444
           + R+W + +  +V        P  + A+SPD    +TG+ DG + V+DI   K L+Q+  
Sbjct: 583 TCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRG 642

Query: 445 NG 446
           +G
Sbjct: 643 HG 644

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 48/216 (22%), Positives = 88/216 (40%), Gaps = 29/216 (13%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNILSY--HRAPIVCIKWNSDETH 249
           G    V    ++P  + LL+  E   +RLWS++    +++SY  H  P+  + ++    +
Sbjct: 474 GHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMD-TYSSLVSYKGHNHPVWDVSFSPLGHY 532

Query: 250 VLTCDADNMTIVWN--------VLSG--TAVQHFSFKEAGTEESLGVDATWIDQDKFAIP 299
             T   D    +W+        + +G    V   SF   GT    G        DK    
Sbjct: 533 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTG------STDK---- 582

Query: 300 GIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSH 359
               +  +++IG    +    GH+  + + A +   + L + S+D  + VW  G      
Sbjct: 583 ----TCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLK 638

Query: 360 VFYGHSQ-SITSAHWVDDDTI-ISTSMDGSIRVWSL 393
              GH + ++ S  +  + T+ +S   D S+RVW L
Sbjct: 639 QMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDL 674

 Score = 29.6 bits (65), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 40/80 (50%), Gaps = 2/80 (2%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWSV-EGK-LQNILSYHRAPIVCIKWNSDETH 249
           G    V     +P G+ L TG E G + +W +  GK L+ +  + +  +  + ++ + T 
Sbjct: 600 GHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTV 659

Query: 250 VLTCDADNMTIVWNVLSGTA 269
           +++  AD+   VW++   TA
Sbjct: 660 LVSGGADHSVRVWDLKRSTA 679

>Kwal_23.5035
          Length = 744

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 95/230 (41%), Gaps = 31/230 (13%)

Query: 197 VTCLEWAPAGQSLLTGVESGELRLWSVEG-KLQNILSYHRAPIVCIKWNSDETHVLTCDA 255
           VTCL++      ++TG +   +R++  +  K    LS H   +  +K+  D   +++   
Sbjct: 373 VTCLQFE--DDYVITGADDKMIRVYDAKTEKFITQLSGHDGGVWALKYGHDGI-LVSGST 429

Query: 256 DNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSIL--------- 306
           D    VWN+ SG     F   +  T     +D    +  KF + G +   L         
Sbjct: 430 DRSVRVWNIKSGKCTHVF---KGHTSTVRCLDIVEHNGKKFIVTGSRDHTLHVWKLPNCN 486

Query: 307 ----------VFNIGISKP--IGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGN 354
                     VFN   + P  +G LRGH   + T++   H  +++S S D  L VW    
Sbjct: 487 AEDYNPEVCEVFNTTDANPYFVGVLRGHMAAVRTVS--GHGNIVVSGSYDFNLMVWDIAQ 544

Query: 355 LNPSHVFYGHSQSITSAHW-VDDDTIISTSMDGSIRVWSLASNSTVASAT 403
           +   +V  GH+  I S  +    +  IS  MD +++VW LA  S     T
Sbjct: 545 MKCLYVLTGHTDRIYSTIYDYQRNRCISAGMDSTVKVWDLADVSKNGPCT 594

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 76/168 (45%), Gaps = 23/168 (13%)

Query: 293 QDKFAIPGIQGSIL-VFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWR 351
           +D + I G    ++ V++    K I +L GH   +  + Y  H+ +L+S S D ++RVW 
Sbjct: 379 EDDYVITGADDKMIRVYDAKTEKFITQLSGHDGGVWALKYG-HDGILVSGSTDRSVRVWN 437

Query: 352 GGNLNPSHVFYGHSQSITSAHWVDDDT---IISTSMDGSIRVWSLAS------NSTVASA 402
             +   +HVF GH+ ++     V+ +    I++ S D ++ VW L +      N  V   
Sbjct: 438 IKSGKCTHVFKGHTSTVRCLDIVEHNGKKFIVTGSRDHTLHVWKLPNCNAEDYNPEVCEV 497

Query: 403 --TVDGVPNFTGALSPDQGKFAT----------GTLDGEVMVYDIQKL 438
             T D  P F G L        T          G+ D  +MV+DI ++
Sbjct: 498 FNTTDANPYFVGVLRGHMAAVRTVSGHGNIVVSGSYDFNLMVWDIAQM 545

 Score = 33.1 bits (74), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 42/83 (50%), Gaps = 3/83 (3%)

Query: 319 LRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDT 378
           L+GH+  +  +  ++  K L+SA  D  LR W   N      ++    S  +  +V+D+ 
Sbjct: 613 LQGHTALVGLLGLSD--KFLVSAGADGILRGWDSENYTRQFAYHHKDLSAITTFYVNDNI 670

Query: 379 IISTSMDGSIRVWSLASNSTVAS 401
           ++S S +G+  +++L S   + S
Sbjct: 671 LVSGS-EGNFNIYNLRSGKLIHS 692

>CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30, hypothetical start
          Length = 673

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 83/198 (41%), Gaps = 16/198 (8%)

Query: 209 LLTGVESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGT 268
           +++G     +++W VE +    L  H   + C+K +       +C  D    +W++ + T
Sbjct: 427 IVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNT 486

Query: 269 AVQHFSFKEAGTEESLGVDATWIDQDKFAI----PGIQGSILVFNIGISKPIGKLRGHSK 324
            ++ F       ++ + +  T ID          PG +  I     G   P   + G  +
Sbjct: 487 CLRVFRGHVGQVQKVIPL--TIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRE 544

Query: 325 TLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHW---VDDDTIIS 381
               + Y  H   LLS + DNT+++W   +       +GH + +    W    D+  IIS
Sbjct: 545 LDKKMPYPTH---LLSCALDNTIKLWEVRSGRCIRTQFGHVEGV----WDIAADNFRIIS 597

Query: 382 TSMDGSIRVWSLASNSTV 399
            S DGSI++W L S   +
Sbjct: 598 GSHDGSIKIWDLQSGKCM 615

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 67/145 (46%), Gaps = 10/145 (6%)

Query: 256 DNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKP 315
           D    +W++ +G  ++        T  S GV   + D  K     +  +I V+N    + 
Sbjct: 353 DTTVAIWDLFTGKLIRRL------TGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGEC 406

Query: 316 IGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVD 375
           I   RGH+ ++ ++  + H K+++S S D T++VW   +    +   GH++ +       
Sbjct: 407 ISTYRGHTDSVMSV--DSHKKIIVSGSADKTVKVWHVES-RTCYTLKGHTEWVNCVKLHP 463

Query: 376 DD-TIISTSMDGSIRVWSLASNSTV 399
              +  S S D +IR+W + +N+ +
Sbjct: 464 KSFSCYSCSDDTTIRMWDIRTNTCL 488

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 59/121 (48%), Gaps = 5/121 (4%)

Query: 316 IGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVD 375
           I + +GH   + T+ +N   +LL + S D T+ +W            GHS  + + ++ D
Sbjct: 327 IQEFKGHMDGVLTLQFNY--RLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF-D 383

Query: 376 DDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDI 435
           D  +I+ S+D +IRVW+  +   +  +T  G  +   ++   +    +G+ D  V V+ +
Sbjct: 384 DQKLITGSLDKTIRVWNYITGECI--STYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHV 441

Query: 436 Q 436
           +
Sbjct: 442 E 442

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/278 (19%), Positives = 110/278 (39%), Gaps = 64/278 (23%)

Query: 209 LLTGVESGELRLWSV-EGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSG 267
           L TG     + +W +  GKL   L+ H   +  + +  D+  ++T   D    VWN ++G
Sbjct: 347 LFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF--DDQKLITGSLDKTIRVWNYITG 404

Query: 268 TAVQHFSFKEAGTEESLGVDATWIDQDKFAIPG-IQGSILVFNIGISKPIGKLRGHSKTL 326
             +  +      T+  + VD+      K  + G    ++ V+++  S+    L+GH++ +
Sbjct: 405 ECISTY---RGHTDSVMSVDS----HKKIIVSGSADKTVKVWHVE-SRTCYTLKGHTEWV 456

Query: 327 TTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGH---------------------- 364
             +  +  +    S SDD T+R+W         VF GH                      
Sbjct: 457 NCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHE 516

Query: 365 -----SQSITSAHWVDDDT-------------------IISTSMDGSIRVWSLASNSTVA 400
                   I S    +DD                    ++S ++D +I++W + S   + 
Sbjct: 517 RKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIR 576

Query: 401 S--ATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQ 436
           +    V+GV +    ++ D  +  +G+ DG + ++D+Q
Sbjct: 577 TQFGHVEGVWD----IAADNFRIISGSHDGSIKIWDLQ 610

>Sklu_2442.2 YNL006W, Contig c2442 3831-4742
          Length = 303

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/216 (20%), Positives = 91/216 (42%), Gaps = 11/216 (5%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVL 251
           G +  VT + +    + +++  E G +++W V          H AP+  +  + ++  ++
Sbjct: 73  GHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVQRNYKHHAPVNEVVIHPNQGELI 132

Query: 252 TCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNI- 310
           +CD D    +W++         + ++    +SL + +   D         +G+  V+ + 
Sbjct: 133 SCDQDGNIRIWDLGENQCTHQLTPEDDTPLQSLSIAS---DGSMLVAGNNKGNCYVWQMP 189

Query: 311 -----GISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWR-GGNLNPSHVFYGH 364
                   KP+ K R H+K +T +  +   K L + S D+T RVW    N        GH
Sbjct: 190 NHTDAANLKPVTKFRSHTKYITRVLLSSDVKHLATCSADHTARVWSIEDNFKLETTLDGH 249

Query: 365 SQSI-TSAHWVDDDTIISTSMDGSIRVWSLASNSTV 399
            + +   A   D   +++   D  +R+W L++   V
Sbjct: 250 QRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIV 285

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 55/122 (45%), Gaps = 1/122 (0%)

Query: 315 PIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWV 374
           P+    GH   +T+I++ + NK ++S+S+D T++VW     +    +  H+         
Sbjct: 67  PVTSFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVQRNYKHHAPVNEVVIHP 126

Query: 375 DDDTIISTSMDGSIRVWSLASNSTVASATV-DGVPNFTGALSPDQGKFATGTLDGEVMVY 433
           +   +IS   DG+IR+W L  N      T  D  P  + +++ D      G   G   V+
Sbjct: 127 NQGELISCDQDGNIRIWDLGENQCTHQLTPEDDTPLQSLSIASDGSMLVAGNNKGNCYVW 186

Query: 434 DI 435
            +
Sbjct: 187 QM 188

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 55/104 (52%), Gaps = 4/104 (3%)

Query: 335 NKLLLSASDDNTLRVW--RGGNLNPSHVFYGHSQSITSAHWVDDDT-IISTSMDGSIRVW 391
           +K  L+A+    +R++  R  N NP   F GH  ++TS  +  D+  ++S+S DG+I+VW
Sbjct: 43  DKRFLAAAGHLHVRLYDIRTTNPNPVTSFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVW 102

Query: 392 SLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDI 435
            + + S V        P     + P+QG+  +   DG + ++D+
Sbjct: 103 DVRAPS-VQRNYKHHAPVNEVVIHPNQGELISCDQDGNIRIWDL 145

>CAGL0M05335g complement(569132..571552) similar to sp|P38129
           Saccharomyces cerevisiae YBR198c Transcription
           initiation factor TFIID 90, hypothetical start
          Length = 806

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 92/204 (45%), Gaps = 15/204 (7%)

Query: 177 LWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQ-NILSYHR 235
           LW++     L +   G  + V  ++++P G    +       RLW+ +      I + H 
Sbjct: 559 LWSMDTHTALVNYK-GHNHPVWDVKFSPLGHYFASASHDQTARLWACDHIYPLRIFAGHT 617

Query: 236 APIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGT-EESLGVDATWIDQD 294
             +  + ++ +  +V T  +D    +W+V +G +V+ F    A      +  D  W+   
Sbjct: 618 NDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRWL--- 674

Query: 295 KFAIPGIQGSILVFNIGISKPIGKLRGHSKT-LTTIAYNEHNKLLLSASDDNTLRVW--R 351
             A     G I +++IG  K I ++RGH K  + ++++N+   +L+S   D+++RVW  +
Sbjct: 675 --ATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDVK 732

Query: 352 GGNL----NPSHVFYGHSQSITSA 371
            G       P   F  H   IT++
Sbjct: 733 HGTTEQGPEPEQPFNAHVGDITAS 756

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 65/130 (50%), Gaps = 3/130 (2%)

Query: 320 RGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDTI 379
           +GH+  +  + ++       SAS D T R+W   ++ P  +F GH+  + +  +  +   
Sbjct: 572 KGHNHPVWDVKFSPLGHYFASASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCY 631

Query: 380 IST-SMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDI--Q 436
           + T S D + R+W +++  +V        P  +  +SPD    ATG+ DG + ++DI   
Sbjct: 632 VFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLWDIGTG 691

Query: 437 KLLQQLNHNG 446
           K ++Q+  +G
Sbjct: 692 KRIKQMRGHG 701

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 57/125 (45%), Gaps = 4/125 (3%)

Query: 315 PIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWV 374
           P+    GH+  + T++++ +   + + S D T R+W     +   +F GH+  + S    
Sbjct: 609 PLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVS 668

Query: 375 DDDTIIST-SMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQ--GKFATGTLDGEVM 431
            D   ++T S DG I +W + +   +      G  N   +LS ++      +G  D  V 
Sbjct: 669 PDGRWLATGSEDGVICLWDIGTGKRIKQMRGHG-KNAVHSLSFNKEGNVLISGGADHSVR 727

Query: 432 VYDIQ 436
           V+D++
Sbjct: 728 VWDVK 732

>YCR084C (TUP1) [608] chr3 complement(260307..262448) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by regulated,
           sequence-specific DNA-binding proteins, exists in a
           complex with Ssn6p that is converted to a
           transcriptional activator in a Hog1p-dependent manner
           [2142 bp, 713 aa]
          Length = 713

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 74/151 (49%), Gaps = 7/151 (4%)

Query: 326 LTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDD-DTIISTSM 384
           + ++ ++   K L + ++D  +R+W   N     +  GH Q I S  +    D ++S S 
Sbjct: 446 IRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSG 505

Query: 385 DGSIRVWSLASNSTVASATV-DGVPNFTGALSPDQGKF-ATGTLDGEVMVYDIQK--LLQ 440
           D ++R+W L +     + ++ DGV   T A+SP  GK+ A G+LD  V V+D +   L++
Sbjct: 506 DRTVRIWDLRTGQCSLTLSIEDGV--TTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVE 563

Query: 441 QLNHNGYHGTARSAEVARIPVVGDHRSAREG 471
           +L+     GT     V  +    D +S   G
Sbjct: 564 RLDSENESGTGHKDSVYSVVFTRDGQSVVSG 594

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 57/270 (21%), Positives = 114/270 (42%), Gaps = 43/270 (15%)

Query: 202 WAPAGQSLLTGVESGELRLWSVEG-KLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTI 260
           ++P G+ L TG E   +R+W +E  K+  IL  H   I  + +      +++   D    
Sbjct: 451 FSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVR 510

Query: 261 VWNVLSGTAVQHFSFKEAGTEESLGV-DATWIDQDKFAIPGIQGSILVFNIGISKPIGKL 319
           +W++ +G      S ++  T  ++   D  +I     A   +  ++ V++      + +L
Sbjct: 511 IWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYI-----AAGSLDRAVRVWDSETGFLVERL 565

Query: 320 -------RGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLN-------PSH-----V 360
                   GH  ++ ++ +    + ++S S D ++++W   N N       P+       
Sbjct: 566 DSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVT 625

Query: 361 FYGHSQSITS-AHWVDDDTIISTSMDGSIRVWSLAS-----------NSTVASATVDGVP 408
           + GH   + S A   +D+ I+S S D  +  W   S           NS ++ A  +G P
Sbjct: 626 YIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSP 685

Query: 409 NFTGALSPDQGKFATGTLDGEVMVYDIQKL 438
                L P+   FATG+ D +  ++  +K+
Sbjct: 686 -----LGPEYNVFATGSGDCKARIWKYKKI 710

>CAGL0M04081g complement(450572..451939) highly similar to sp|P42841
           Saccharomyces cerevisiae YNL317w PFS2 polyadenylation
           factor I, hypothetical start
          Length = 455

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/249 (18%), Positives = 94/249 (37%), Gaps = 49/249 (19%)

Query: 197 VTCLEWAPAGQSLLTGVESGELRLWSVEG-KLQNILSYHRAPIVCIKWNSDETHVLTCDA 255
           +  ++W+P G+ L+    SGE  LW+      + I+  H   +  +K++     +++ DA
Sbjct: 85  IPAIQWSPEGRRLIVATFSGEFSLWNGSSFTFETIMQAHDTSVTTMKYSHAGDWMISGDA 144

Query: 256 DNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKP 315
           D    +W                                              N  + K 
Sbjct: 145 DGTIKIWQP--------------------------------------------NFNMVKE 160

Query: 316 IGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVD 375
           + ++  H++ +  +A++ ++   ++ SDDN L++W   N     V  GH   + S  W  
Sbjct: 161 LDRI--HTEGIRDVAFSNNDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWDVRSCDWHP 218

Query: 376 D-DTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGK-FATGTLDGEVMVY 433
           +   I+S S D  +++W   S   V++              P +G   A  + D    V+
Sbjct: 219 ELGLIVSGSKDNLVKLWDPRSGQCVSTLLKFKHTVLKTRFQPTKGNLLAAISKDKSCRVF 278

Query: 434 DIQKLLQQL 442
           D++  + +L
Sbjct: 279 DLRASMNEL 287

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/216 (20%), Positives = 97/216 (44%), Gaps = 18/216 (8%)

Query: 154 EGV--FAYGERDSRAAVVTYSVADGLWNIS----ETVVLADANTGQQNEVTCLEWAPAGQ 207
           EG+   A+   DS+    +      +WN S    E V+     +G   +V   +W P   
Sbjct: 167 EGIRDVAFSNNDSKFVTCSDDNILKIWNFSNGQQERVL-----SGHHWDVRSCDWHPELG 221

Query: 208 SLLTGVESGELRLWSVE-GKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLS 266
            +++G +   ++LW    G+  + L   +  ++  ++   + ++L   + + +     L 
Sbjct: 222 LIVSGSKDNLVKLWDPRSGQCVSTLLKFKHTVLKTRFQPTKGNLLAAISKDKSCRVFDLR 281

Query: 267 GTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIG--ISKPIGKLR-GHS 323
            +  +    ++    + + ++ + I++  F +    GS+  F++G    KPI  +   H 
Sbjct: 282 ASMNELMCVRDE--VDFMELEWSTINESMFTVGCYDGSLKHFDLGQDTEKPIHIIPFAHE 339

Query: 324 KTLTTIAYNEHNKLLLSASDDNTLRVW-RGGNLNPS 358
           K ++ IAYN    +L +A+ D T+R W R   ++P+
Sbjct: 340 KCISAIAYNPVGHILATAAKDRTIRFWTRARPVDPN 375

 Score = 35.8 bits (81), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 28/133 (21%), Positives = 58/133 (43%), Gaps = 5/133 (3%)

Query: 326 LTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVD-DDTIISTSM 384
           +  I ++   + L+ A+      +W G +     +   H  S+T+  +    D +IS   
Sbjct: 85  IPAIQWSPEGRRLIVATFSGEFSLWNGSSFTFETIMQAHDTSVTTMKYSHAGDWMISGDA 144

Query: 385 DGSIRVWSLASN--STVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQKLLQQL 442
           DG+I++W    N    +     +G+ +   A S +  KF T + D  + +++     Q+ 
Sbjct: 145 DGTIKIWQPNFNMVKELDRIHTEGIRDV--AFSNNDSKFVTCSDDNILKIWNFSNGQQER 202

Query: 443 NHNGYHGTARSAE 455
             +G+H   RS +
Sbjct: 203 VLSGHHWDVRSCD 215

>CAGL0I03718g complement(317565..321170) highly similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 Coatomer alpha
           subunit, start by similarity
          Length = 1201

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 76/160 (47%), Gaps = 7/160 (4%)

Query: 261 VWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLR 320
           +W+   GT +  F   E G   ++    T   Q  F   G   SI V+++  ++ +  L 
Sbjct: 37  LWDYRMGTLLHRFEGHE-GPVRAVDFHPT---QPIFVSAGDDASIKVWSLETNRCLYTLT 92

Query: 321 GHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHW-VDDDTI 379
           GH   + T+ ++     ++SASDD T+R+W   N        GH+  +  A +   +D +
Sbjct: 93  GHLDYVRTVFFHSELPWVISASDDQTVRIWNWQNRKELACLTGHNHFVMCAQFHQTEDLV 152

Query: 380 ISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQG 419
           +S S+D ++RVW ++      SA   GV ++  +L+  Q 
Sbjct: 153 VSASLDETVRVWDISGLRKKHSAP--GVTSYEDSLASQQN 190

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/195 (20%), Positives = 88/195 (45%), Gaps = 20/195 (10%)

Query: 209 LLTGVESGELRLWSVEGKLQ-NILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSG 267
           +++  +   +R+W+ + + +   L+ H   ++C +++  E  V++   D    VW++ SG
Sbjct: 110 VISASDDQTVRIWNWQNRKELACLTGHNHFVMCAQFHQTEDLVVSASLDETVRVWDI-SG 168

Query: 268 TAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLT 327
              +H +      E+SL      +D       G  G   V  I        L GH++ + 
Sbjct: 169 LRKKHSAPGVTSYEDSLASQQNLLD-------GAFGDCKVKFI--------LEGHTRGVN 213

Query: 328 TIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHV--FYGHSQSITSAHW-VDDDTIISTSM 384
             +++    L+++  DD  +++WR  +     V    GH+ ++    +  D + I+S + 
Sbjct: 214 WASFHPTLPLIVTGGDDRQVKLWRMSSNKAWEVDTCRGHTNNVDCVVFHPDQNLILSVAE 273

Query: 385 DGSIRVWSLASNSTV 399
           D ++R+W L   + V
Sbjct: 274 DKTLRIWDLDKRTPV 288

>KLLA0E24508g complement(2175775..2176758) similar to sp|P38123
           Saccharomyces cerevisiae YBR175w, start by similarity
          Length = 327

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 60/274 (21%), Positives = 115/274 (41%), Gaps = 40/274 (14%)

Query: 191 TGQQNEVTCLEWAPAGQSLLTGVESGELRLWSV-EGKLQNILSYHRAPIVCIKWNSDETH 249
           T  +  + CL W+P  + + +G E   + +  +  G+++ ++  H AP++ I +N+    
Sbjct: 66  TTHKECINCLCWSPDSKCIASGSEDFTVEITHIIYGRIRRLMG-HTAPVISICYNNKGNI 124

Query: 250 VLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFN 309
           + +   D     W+VLSGTA++  S   A ++  + +D    D    +     G I +F+
Sbjct: 125 LCSSSMDESIKEWHVLSGTALKTMS---AHSDAVVSIDIPKFDSSILSSGSYDGLIRIFD 181

Query: 310 IGISKPIGKLRGHS-KTLT---------------TIAYNEHNKLLLSASDDNTLRVWRGG 353
                      GH  KTLT               T+ ++ + K LL  S DN +++W   
Sbjct: 182 TE--------SGHCLKTLTYDKDWIAEDGVVPISTVKFSRNGKFLLVKSLDNVVKLWEYT 233

Query: 354 NLNPSHVF-YGHSQSITSAHWV----------DDDTIISTSMDGSIRVWSLASNSTVASA 402
                  F + H ++     +            D  +IS +  GS+ VW++ S + V   
Sbjct: 234 RGTVVRTFLWPHQETKAKLKYNCGLELIYPQGKDPLVISGNDSGSMCVWNVYSKNLVQKI 293

Query: 403 TVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQ 436
                 +   ++S    K AT +L+GE  ++ + 
Sbjct: 294 DEKHRNSPLISISASYDKVATLSLNGECNLFRVH 327

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 68/147 (46%), Gaps = 29/147 (19%)

Query: 305 ILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFY-- 362
           +LV+ I  SK +     H + +  + ++  +K + S S+D T+ +        +H+ Y  
Sbjct: 51  MLVYEISSSKMMKLTTTHKECINCLCWSPDSKCIASGSEDFTVEI--------THIIYGR 102

Query: 363 -----GHSQSITSAHWVDDDTII-STSMDGSIRVWSLASNSTV--ASATVDGV-----PN 409
                GH+  + S  + +   I+ S+SMD SI+ W + S + +   SA  D V     P 
Sbjct: 103 IRRLMGHTAPVISICYNNKGNILCSSSMDESIKEWHVLSGTALKTMSAHSDAVVSIDIPK 162

Query: 410 FTGALSPDQGKFATGTLDGEVMVYDIQ 436
           F      D    ++G+ DG + ++D +
Sbjct: 163 F------DSSILSSGSYDGLIRIFDTE 183

>Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement
          Length = 555

 Score = 55.8 bits (133), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 82/175 (46%), Gaps = 15/175 (8%)

Query: 181 SETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWS-VEGKLQNILSYHRAPIV 239
           +E V L D     +NE T + W  AG  L  G  +G + ++  V+ K    LS H   + 
Sbjct: 282 NEVVQLCDT----ENEYTSINWVGAGSHLAVGQGNGLVEIYDIVKRKCIRTLSGHMDRVA 337

Query: 240 CIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATW-IDQDKFAI 298
           C+ WN+   H+LT  + +  I+   +      +F   E  T+E  G+   W  D+++ A 
Sbjct: 338 CLSWNN---HILTSGSRDRKILHRDVR-MPEPYFEQVETHTQEVCGL--KWNTDENRLAS 391

Query: 299 PGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLS---ASDDNTLRVW 350
            G    + V++    KP  KL  H+  +  IA++ H + +L+    + D  +++W
Sbjct: 392 GGNDNVVYVYDGTSRKPTLKLAEHTAAVKAIAWSPHKRGILATGGGTADKKMKIW 446

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 47/212 (22%), Positives = 85/212 (40%), Gaps = 17/212 (8%)

Query: 191 TGQQNEVTCLEWAPAGQSLLTGVESGEL--RLWSVEGKLQNILSYHRAPIVCIKWNSDET 248
           +G  + V CL W      L +G    ++  R   +       +  H   +  +KWN+DE 
Sbjct: 330 SGHMDRVACLSWN--NHILTSGSRDRKILHRDVRMPEPYFEQVETHTQEVCGLKWNTDEN 387

Query: 249 HVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQG----- 303
            + +   DN+  V++   GT+ +  + K A  E +  V A      K  I    G     
Sbjct: 388 RLASGGNDNVVYVYD---GTS-RKPTLKLA--EHTAAVKAIAWSPHKRGILATGGGTADK 441

Query: 304 SILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLS-ASDDNTLRVWRGGNLNPSHVFY 362
            + ++N+  S  +  +   S+    I     N+L+ S       L +W   ++ P  +  
Sbjct: 442 KMKIWNVNTSTKLRDIDTGSQVCNMIWSKNTNELVTSHGYSRYNLTLWDYPSMEPVAILK 501

Query: 363 GHSQSITSAHW-VDDDTIISTSMDGSIRVWSL 393
           GHS  +       D  T++S + D ++R W L
Sbjct: 502 GHSFRVLHLTLSADGTTVVSGAGDETLRYWKL 533

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 45/115 (39%), Gaps = 20/115 (17%)

Query: 149 WNPKHEGVFAYGERDSRAAVVTYSVADGLWNISETVVLADANTGQQNEVTCLEWAPAGQS 208
           W+P   G+ A G   +   +        +WN++ +  L D +TG Q  V  + W+     
Sbjct: 424 WSPHKRGILATGGGTADKKM-------KIWNVNTSTKLRDIDTGSQ--VCNMIWSKNTNE 474

Query: 209 LLT--GVESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIV 261
           L+T  G     L LW               P+  +K +S     LT  AD  T+V
Sbjct: 475 LVTSHGYSRYNLTLWDYPSM---------EPVAILKGHSFRVLHLTLSADGTTVV 520

>Kwal_0.212
          Length = 303

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 44/216 (20%), Positives = 91/216 (42%), Gaps = 11/216 (5%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVL 251
           G +  VT + +    + +++  E G +++W V          H+A +  +  + ++  ++
Sbjct: 73  GHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVVIHPNQGELI 132

Query: 252 TCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNI- 310
           +CD D    +W++     V   + ++    +SL V +   D         +G+  V+ + 
Sbjct: 133 SCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVAS---DGSMLVAGNNKGNCYVWQMP 189

Query: 311 -----GISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWR-GGNLNPSHVFYGH 364
                   KP+ K R H+K +T +  +   K L + S D+T RVW    N         H
Sbjct: 190 HQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNH 249

Query: 365 SQSI-TSAHWVDDDTIISTSMDGSIRVWSLASNSTV 399
            + +   A   D   +++   D  +R+W L++   V
Sbjct: 250 QRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIV 285

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 61/126 (48%), Gaps = 9/126 (7%)

Query: 315 PIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW--RGGNLNPSHVFYGHSQSITSA- 371
           P+    GH   +T+IA+ + NK ++S+S+D T++VW  R  ++  +   Y H  ++    
Sbjct: 67  PVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRN---YKHQAAVNEVV 123

Query: 372 -HWVDDDTIISTSMDGSIRVWSLASNSTVAS-ATVDGVPNFTGALSPDQGKFATGTLDGE 429
            H  +   +IS   DG++R+W L  N  V   A  D  P  + +++ D      G   G 
Sbjct: 124 IH-PNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGN 182

Query: 430 VMVYDI 435
             V+ +
Sbjct: 183 CYVWQM 188

>KLLA0D04840g 413362..414273 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8 required for
           transport of permeases from the golgi to the plasma
           membrane, start by similarity
          Length = 303

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 43/216 (19%), Positives = 92/216 (42%), Gaps = 11/216 (5%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVL 251
           G +  VT + +    + +++  E G +++W V          H AP+  +  + ++  ++
Sbjct: 73  GHKGNVTSIAFQQENRWMVSSSEDGTIKVWDVRSPSVQRNYKHNAPVNEVAIHPNQGELI 132

Query: 252 TCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNI- 310
           +CD D    +W++         + ++    +SL V +   D         +G+  V+ + 
Sbjct: 133 SCDQDGNIRIWDLGENQCTNQLTPEDNTPLQSLSVAS---DGSMLVAGNNKGNCYVWKMP 189

Query: 311 -----GISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWR-GGNLNPSHVFYGH 364
                   +P+ K + H+K +T +  +   K L + S D+T RVW    N        GH
Sbjct: 190 HHTDASTLEPVTKFKSHTKYITRVLLSADVKHLATCSADHTARVWNIEDNFELETTLDGH 249

Query: 365 SQSI-TSAHWVDDDTIISTSMDGSIRVWSLASNSTV 399
            + +   A   D   +++   D  +R+W L+++  V
Sbjct: 250 QRWVWDCAFSADSAYLVTACSDHYVRLWDLSTSEIV 285

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 60/125 (48%), Gaps = 7/125 (5%)

Query: 315 PIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW--RGGNLNPSHVFYGHSQSITS-A 371
           P+    GH   +T+IA+ + N+ ++S+S+D T++VW  R  ++  +   Y H+  +   A
Sbjct: 67  PVSSFEGHKGNVTSIAFQQENRWMVSSSEDGTIKVWDVRSPSVQRN---YKHNAPVNEVA 123

Query: 372 HWVDDDTIISTSMDGSIRVWSLASNSTVASATV-DGVPNFTGALSPDQGKFATGTLDGEV 430
              +   +IS   DG+IR+W L  N      T  D  P  + +++ D      G   G  
Sbjct: 124 IHPNQGELISCDQDGNIRIWDLGENQCTNQLTPEDNTPLQSLSVASDGSMLVAGNNKGNC 183

Query: 431 MVYDI 435
            V+ +
Sbjct: 184 YVWKM 188

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 56/104 (53%), Gaps = 4/104 (3%)

Query: 335 NKLLLSASDDNTLRVW--RGGNLNPSHVFYGHSQSITSAHWVDDDT-IISTSMDGSIRVW 391
           +K  L+A+    +R++  R  N NP   F GH  ++TS  +  ++  ++S+S DG+I+VW
Sbjct: 43  DKKYLAAAGHLHVRLYDIRSNNPNPVSSFEGHKGNVTSIAFQQENRWMVSSSEDGTIKVW 102

Query: 392 SLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDI 435
            + S S V        P    A+ P+QG+  +   DG + ++D+
Sbjct: 103 DVRSPS-VQRNYKHNAPVNEVAIHPNQGELISCDQDGNIRIWDL 145

>Scas_721.32
          Length = 822

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 79/162 (48%), Gaps = 8/162 (4%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQ-NILSYHRAPIVCIKWNSDETHV 250
           G  + V  ++++P G    T       RLWS +      I + H + + C+ ++ +  +V
Sbjct: 589 GHNHPVWDVQFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYV 648

Query: 251 LTCDADNMTIVWNVLSGTAVQHFSFKEAGTE-ESLGVDATWIDQDKFAIPGIQGSILVFN 309
            T  +D    +W++ +G +V+ F    A     ++  D  W+     A     G I +++
Sbjct: 649 FTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWL-----ATGSEDGIINLWD 703

Query: 310 IGISKPIGKLRGHSKT-LTTIAYNEHNKLLLSASDDNTLRVW 350
           IG +K +  +RGH K  + +++Y +   +L+S   D+++RVW
Sbjct: 704 IGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVW 745

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 63/140 (45%), Gaps = 14/140 (10%)

Query: 320 RGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDTI 379
           +GH+  +  + ++       +AS D T R+W   ++ P  +F GH   +    +  +   
Sbjct: 588 KGHNHPVWDVQFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCY 647

Query: 380 IST-SMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQKL 438
           + T S D + R+W +++  +V        P    A+SPD    ATG+ DG + ++DI   
Sbjct: 648 VFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWLATGSEDGIINLWDI--- 704

Query: 439 LQQLNHNGYHGTARSAEVAR 458
                     GTA+  +V R
Sbjct: 705 ----------GTAKRLKVMR 714

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 47/97 (48%), Gaps = 7/97 (7%)

Query: 177 LWNIS--ETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSV--EGKLQNILS 232
           +W+IS  ++V L     G    V C   +P G+ L TG E G + LW +    +L+ +  
Sbjct: 659 MWDISTGDSVRLF---LGHTAPVLCTAVSPDGRWLATGSEDGIINLWDIGTAKRLKVMRG 715

Query: 233 YHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTA 269
           + +  I  + +  +   +++  AD+   VW++   TA
Sbjct: 716 HGKNAIHSLSYCKEGNVLVSGGADHSVRVWDLKKSTA 752

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 54/126 (42%), Gaps = 4/126 (3%)

Query: 315 PIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWV 374
           P+    GH   +  ++++ +   + + S D T R+W     +   +F GH+  +      
Sbjct: 625 PLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVS 684

Query: 375 DDDTIIST-SMDGSIRVWSLASNSTVASATVDGVPNFTGALS--PDQGKFATGTLDGEVM 431
            D   ++T S DG I +W + +   +      G  N   +LS   +     +G  D  V 
Sbjct: 685 PDGRWLATGSEDGIINLWDIGTAKRLKVMRGHGK-NAIHSLSYCKEGNVLVSGGADHSVR 743

Query: 432 VYDIQK 437
           V+D++K
Sbjct: 744 VWDLKK 749

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 57/123 (46%), Gaps = 21/123 (17%)

Query: 326 LTTIAYNEHNKLLLSASDDNTLRVWR--GGNL------------------NPSHVFYGHS 365
           +T++ ++E ++L+ +   D+ +++W   G +L                  N S    GHS
Sbjct: 490 MTSLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADSINTGDMNDNTSTTLIGHS 549

Query: 366 QSITSAHWVDDDT-IISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATG 424
            ++ S  +  D+  ++S S D ++R+WS  + +++ S      P +    SP    FAT 
Sbjct: 550 GAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPLGHYFATA 609

Query: 425 TLD 427
           + D
Sbjct: 610 SHD 612

>KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA
           Kluyveromyces lactis Transcriptional repressor TUP1,
           start by similarity
          Length = 682

 Score = 55.5 bits (132), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 68/298 (22%), Positives = 122/298 (40%), Gaps = 54/298 (18%)

Query: 187 ADANTGQQNE----------VTCLEWAPAGQSLLTGVESGELRLWSVE-GKLQNILSYHR 235
           A+  TG QN           +  + ++P G+ L TG E   +R+W +E  K+   L  H 
Sbjct: 389 AEDGTGNQNSAASTASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHE 448

Query: 236 APIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDK 295
             I  + +      +++   D    +W++ +GT     S      E+ +   A    + K
Sbjct: 449 QDIYSLDYFPSGNKLVSGSGDRTVRIWDLTTGTCSLTLSI-----EDGVTTVAVSPGEGK 503

Query: 296 FAIPG-IQGSILVFNIGISKPIGKL-------RGHSKTLTTIAYNEHNKLLLSASDDNTL 347
           F   G +  ++ V++      + +L        GH  ++ ++ +    K ++S S D ++
Sbjct: 504 FIAAGSLDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSV 563

Query: 348 RVWRGGNLN-----PSH-----VFYGHSQSITS-AHWVDDDTIISTSMDGSIRVWSLAS- 395
           ++W   NLN      SH      + GH   + S A   +D+ I+S S D  +  W   S 
Sbjct: 564 KLW---NLNGLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSG 620

Query: 396 ----------NSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQKLLQQLN 443
                     NS ++    +G P     L P+ G FATG+ D +  ++   K   Q N
Sbjct: 621 NPLLMLQGHRNSVISVTVANGHP-----LGPEYGVFATGSGDCKARIWKYSKKNSQQN 673

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 70/161 (43%), Gaps = 13/161 (8%)

Query: 295 KFAIPGIQGSIL-VFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGG 353
           KF   G +  ++ ++++   K +  L+GH + + ++ Y      L+S S D T+R+W   
Sbjct: 419 KFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDLT 478

Query: 354 NLNPSHVFYGHSQSITSAHWVDDDTIIST-SMDGSIRVWS---------LASNSTVASAT 403
               S          T A    +   I+  S+D ++RVW          L S + + +  
Sbjct: 479 TGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGTGH 538

Query: 404 VDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQKLLQQLNH 444
            D V  ++   + D     +G+LD  V ++++  L  Q +H
Sbjct: 539 RDSV--YSVVFTRDGKGVVSGSLDRSVKLWNLNGLSGQKSH 577

>Kwal_47.17567
          Length = 590

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 80/183 (43%), Gaps = 18/183 (9%)

Query: 180 ISETVVLADANTGQ-------QNEVTCLEWAPAGQSLLTGVESGELRLWSVE-GKLQNIL 231
           + +++ L D NT +        NE T L W  AG  L  G  +G + ++ VE  K    +
Sbjct: 305 LGKSIFLTDNNTNEVTQLSTTDNEYTSLSWVGAGSHLAVGQTNGLVNIFDVEKKKCIRTI 364

Query: 232 SYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATW- 290
             H   + C+ WN+   H+LT  + +  I+            SF+E  T         W 
Sbjct: 365 PGHIDRVACLSWNN---HILTSGSRDRRILHR---DVRTPQSSFEEIRTHNQEVCGLKWN 418

Query: 291 IDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLS---ASDDNTL 347
           ++ +K A  G   ++ V++     P  KL  H+  +  +A++ H + +L+    + D  L
Sbjct: 419 VEDNKLASGGNDNAVFVYDGTSRLPFLKLEEHTAAVKAMAWSPHRRGILATGGGTADKRL 478

Query: 348 RVW 350
           ++W
Sbjct: 479 KIW 481

>YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and
           component of the SCF-Cdc4p complex
           (Skp1p-Cdc53p-Cdc34p-Cdc4p) which targets Sic1p, Far1p,
           Cdc6p, Ctf13p and Gcn4p for ubiquitin-dependent
           degradation, has WD (WD-40) repeats [2340 bp, 779 aa]
          Length = 779

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 69/288 (23%), Positives = 115/288 (39%), Gaps = 55/288 (19%)

Query: 191 TGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVE-GKLQNILSYHRAPIVC--IKWNSDE 247
           +G    V  L++A  G  L++G     +R+W ++ G   ++   H + + C  I    + 
Sbjct: 419 SGHDGGVWALKYAHGGI-LVSGSTDRTVRVWDIKKGCCTHVFKGHNSTVRCLDIVEYKNI 477

Query: 248 THVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILV 307
            +++T   DN   VW +   ++V      + G E                        LV
Sbjct: 478 KYIVTGSRDNTLHVWKLPKESSVP-----DHGEEHDYP--------------------LV 512

Query: 308 FNIGISKP--IGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHS 365
           F+     P  +G LRGH  ++ T++   H  +++S S DNTL VW    +   ++  GH+
Sbjct: 513 FHTPEENPYFVGVLRGHMASVRTVS--GHGNIVVSGSYDNTLIVWDVAQMKCLYILSGHT 570

Query: 366 QSITSAHWVDD-DTIISTSMDGSIRVWSL-----------ASNSTVASA-------TVDG 406
             I S  +  +    IS SMD +IR+W L           A+NS    A       T+ G
Sbjct: 571 DRIYSTIYDHERKRCISASMDTTIRIWDLENIWNNGECSYATNSASPCAKILGAMYTLQG 630

Query: 407 VPNFTGALSPDQGKFATGTLDGEVMVYDIQKLLQQLNHNGYHGTARSA 454
                G L        +   DG +  +D     ++ +   YH T  SA
Sbjct: 631 HTALVGLLRLSDKFLVSAAADGSIRGWDANDYSRKFS---YHHTNLSA 675

 Score = 33.1 bits (74), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 319 LRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDT 378
           LRGH  ++ T    E N  +++ +DD  +RV+   N        GH   + +  +     
Sbjct: 377 LRGHMTSVITCLQFEDN-YVITGADDKMIRVYDSINKKFLLQLSGHDGGVWALKYAHGGI 435

Query: 379 IISTSMDGSIRVWSL 393
           ++S S D ++RVW +
Sbjct: 436 LVSGSTDRTVRVWDI 450

>KLLA0C08976g 784536..787271 highly similar to sgd|S0000653
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/233 (21%), Positives = 102/233 (43%), Gaps = 18/233 (7%)

Query: 181 SETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSV-EGKLQNILSYHRAPIV 239
           SE+ +L     G  + +  L ++P G  ++T    G++++W V  G        H   + 
Sbjct: 330 SESYILK--QQGHFDTLNGLCYSPDGSKIVTASHEGKIKIWDVASGFCLATFDEHAGGVS 387

Query: 240 CIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIP 299
            +++      + +   D     W+++     + F+  E     SL VD +     +    
Sbjct: 388 AVEFAKKGQVLFSASLDGTVKAWDLIRYRNFRTFTATERIQFNSLAVDPS----GEVVCA 443

Query: 300 GIQGS--ILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW----RGG 353
           G + S  I V+++   + +  L GH   ++ ++++  N +L SAS D T+RVW    R  
Sbjct: 444 GSEDSFDIFVWSVQTGQLVDTLSGHEGPISCLSFSNENGVLASASWDKTIRVWSLFGRSQ 503

Query: 354 NLNPSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVDG 406
            + P  VF   S  ++ +   D   I ++++ G I  + +A    V +  +DG
Sbjct: 504 QVEPFEVF---SDVLSISMKPDGQQIAASTLAGQILFFDVAEGKQVGN--IDG 551

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 71/166 (42%), Gaps = 9/166 (5%)

Query: 234 HRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQ 293
           HR  +  +  N   T +L+ D D   I+ N  +   + HF+FKE   +     D      
Sbjct: 54  HRKNVAVVDINKQGTLLLSIDVDGRGILANFKTRNVLHHFNFKEKVYDLKFSPDGKLFAL 113

Query: 294 DKFAIPGIQGSILVFNIGISKPIGKLR---GHSKTLTTIAYNEHNKLLLSASDDNTLRVW 350
                  I  +          P  + R   GH   +T++ +++ ++ ++S S D T R+W
Sbjct: 114 ACGRFLQIWRTPETTEDRQFAPFVRYRIHAGHFSDITSLTWSKDSRFIISTSKDLTARIW 173

Query: 351 ----RGGNLNPSHVFYGHSQSITSAHWVDD-DTIISTSMDGSIRVW 391
                  NL  S  F GH  ++  A++ DD + I + S DG++  W
Sbjct: 174 SVNSEEKNL-ASTTFAGHRDNVIGAYFSDDQEKIYTVSKDGALFQW 218

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 64/302 (21%), Positives = 114/302 (37%), Gaps = 59/302 (19%)

Query: 196 EVTCLEWAPAGQSLLTGVESGELRLWSV-EGKLQNILSYHRAPIVCIKWNSD-ETHVLTC 253
           +V C  +  A   L  G  +GE RL+ + E  +   LS  +  +  +  NS  E      
Sbjct: 258 KVKCSAFHAASNILTVGFSNGEFRLYELPEFIMIQQLSMGQNAVNTVAINSSGEWLAFGS 317

Query: 254 DADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGIS 313
                 IV+   S    + +  K+ G  ++L       D  K      +G I ++++   
Sbjct: 318 SKLGQLIVYEWQS----ESYILKQQGHFDTLNGLCYSPDGSKIVTASHEGKIKIWDVASG 373

Query: 314 KPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW---RGGNL--------------- 355
             +     H+  ++ + + +  ++L SAS D T++ W   R  N                
Sbjct: 374 FCLATFDEHAGGVSAVEFAKKGQVLFSASLDGTVKAWDLIRYRNFRTFTATERIQFNSLA 433

Query: 356 -NPS-------------------------HVFYGHSQSITSAHWVDDDTII-STSMDGSI 388
            +PS                             GH   I+   + +++ ++ S S D +I
Sbjct: 434 VDPSGEVVCAGSEDSFDIFVWSVQTGQLVDTLSGHEGPISCLSFSNENGVLASASWDKTI 493

Query: 389 RVWSLASNSTVASATVDGVPNFTGALS----PDQGKFATGTLDGEVMVYDIQKLLQQLNH 444
           RVWSL       S  V+    F+  LS    PD  + A  TL G+++ +D+ +  Q  N 
Sbjct: 494 RVWSLFGR----SQQVEPFEVFSDVLSISMKPDGQQIAASTLAGQILFFDVAEGKQVGNI 549

Query: 445 NG 446
           +G
Sbjct: 550 DG 551

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/75 (21%), Positives = 35/75 (46%), Gaps = 4/75 (5%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNILSY----HRAPIVCIKWNSDE 247
           G  +++T L W+   + +++  +    R+WSV  + +N+ S     HR  ++   ++ D+
Sbjct: 144 GHFSDITSLTWSKDSRFIISTSKDLTARIWSVNSEEKNLASTTFAGHRDNVIGAYFSDDQ 203

Query: 248 THVLTCDADNMTIVW 262
             + T   D     W
Sbjct: 204 EKIYTVSKDGALFQW 218

>Kwal_56.24526
          Length = 1210

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 64/135 (47%), Gaps = 5/135 (3%)

Query: 261 VWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLR 320
           +W+   GT +  F   E       G+D     Q  F   G   +I V+++   K +  L 
Sbjct: 37  LWDYRMGTLLHKFEDHEGPVR---GIDFHPT-QPLFVSAGDDYTIKVWSLDTKKCLFTLN 92

Query: 321 GHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHW-VDDDTI 379
           GH   + T+ ++     ++SASDD T+R+W   N        GH+  +  A +   +D +
Sbjct: 93  GHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCADFHPTEDLV 152

Query: 380 ISTSMDGSIRVWSLA 394
           +S S+D ++RVW ++
Sbjct: 153 VSASLDETVRVWDIS 167

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/195 (21%), Positives = 86/195 (44%), Gaps = 20/195 (10%)

Query: 209 LLTGVESGELRLWSVEGKLQ-NILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSG 267
           +++  +   +R+W+ + + +   L+ H   ++C  ++  E  V++   D    VW++ SG
Sbjct: 110 IISASDDQTIRIWNWQNRKEIACLTGHNHFVMCADFHPTEDLVVSASLDETVRVWDI-SG 168

Query: 268 TAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLT 327
              +H +      E+ +      +D       G  G  +V  I        L GHS+ + 
Sbjct: 169 LRKRHSAPSTYTLEDQIAAQQNLLD-------GGFGDCVVKFI--------LEGHSRGVN 213

Query: 328 TIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHV--FYGHSQSITSAHW-VDDDTIISTSM 384
             +++    L++S  DD  +++WR  +     V    GH+ ++ S  +    + IIS   
Sbjct: 214 WASFHPTLPLIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPHQNLIISVGE 273

Query: 385 DGSIRVWSLASNSTV 399
           D ++RVW L   + V
Sbjct: 274 DKTVRVWDLDKRTPV 288

 Score = 42.4 bits (98), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 59/139 (42%), Gaps = 1/139 (0%)

Query: 304 SILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYG 363
           SI +++  +   + K   H   +  I ++    L +SA DD T++VW            G
Sbjct: 34  SIQLWDYRMGTLLHKFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVWSLDTKKCLFTLNG 93

Query: 364 HSQSITSAHWVDDDT-IISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFA 422
           H   + +  +  +   IIS S D +IR+W+  +   +A  T            P +    
Sbjct: 94  HLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCADFHPTEDLVV 153

Query: 423 TGTLDGEVMVYDIQKLLQQ 441
           + +LD  V V+DI  L ++
Sbjct: 154 SASLDETVRVWDISGLRKR 172

>AFL007C [3186] [Homologous to ScYGL003C (CDH1) - SH]
           (424004..425659) [1656 bp, 551 aa]
          Length = 551

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 83/183 (45%), Gaps = 18/183 (9%)

Query: 180 ISETVVLADANTGQ-------QNEVTCLEWAPAGQSLLTGVESGELRLWSV-EGKLQNIL 231
           + +TV L D N+ +        +E T L W  +G  L  G+ +G + L  V + K    L
Sbjct: 266 LGKTVFLTDDNSNEVVQLCETDDEYTSLSWVNSGSHLAVGLGNGLVELHDVVKQKCIRTL 325

Query: 232 SYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATW- 290
           S H   + C+ WN    H+L+  + +  I+   +     +H+ F+ A T         W 
Sbjct: 326 SGHLDRVACLSWNQ---HILSSGSKDHKILHRDVR--MPEHY-FETANTHSQEVCGLKWN 379

Query: 291 IDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLS---ASDDNTL 347
           +D+++ A  G    + V++    KP+ K   H+  +  +A++ H +  L+    + D  L
Sbjct: 380 VDENRLASGGNDNVVYVYDGPSKKPVLKFTEHNAAVKAMAWSPHRRATLATGGGTADRRL 439

Query: 348 RVW 350
           ++W
Sbjct: 440 KIW 442

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 72/168 (42%), Gaps = 10/168 (5%)

Query: 189 ANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNILSY--HRAPIVCIKWNSD 246
           ANT  Q EV  L+W      L +G     + ++    K + +L +  H A +  + W+  
Sbjct: 366 ANTHSQ-EVCGLKWNVDENRLASGGNDNVVYVYDGPSK-KPVLKFTEHNAAVKAMAWSPH 423

Query: 247 ETHVLTC---DADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQG 303
               L      AD    +WNV SG  +      + G++    V +   D+   +    + 
Sbjct: 424 RRATLATGGGTADRRLKIWNVNSGVRLNDV---DTGSQVCNMVWSKNTDEIVTSHGYSKF 480

Query: 304 SILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWR 351
           ++ +++    +P+  L+GHS  +  +  +     ++S + D TLR W+
Sbjct: 481 NLTLWDCPTLEPLAVLKGHSFRVLHLTLSTDGTTIVSGAGDETLRYWK 528

>CAGL0H03729g 342948..343859 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8, start by
           similarity
          Length = 303

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/216 (19%), Positives = 90/216 (41%), Gaps = 11/216 (5%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVL 251
           G +  VT + +    + ++T  E G +++W +          H AP+  +  + ++  ++
Sbjct: 73  GHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDIRSPSVPRNYKHNAPVNEVVIHPNQGELI 132

Query: 252 TCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIG 311
           +CD D    +W++         + ++    +SL V +   D         +G+  V+ + 
Sbjct: 133 SCDRDGNIRIWDLGENQCTHQLTPEDDVPLQSLSVAS---DGSMLVAANNKGNCYVWEMP 189

Query: 312 IS------KPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWR-GGNLNPSHVFYGH 364
                   KP  K + H   +T +  +   K + + S D+T R+W    N N      GH
Sbjct: 190 NHTDASNLKPATKFKAHPSYITRVLLSSDVKHMATCSADHTARIWSVEDNFNLESTLDGH 249

Query: 365 SQSI-TSAHWVDDDTIISTSMDGSIRVWSLASNSTV 399
            + +   A   D   +++ S D  +R+W L++   +
Sbjct: 250 QRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRDII 285

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 74/151 (49%), Gaps = 12/151 (7%)

Query: 292 DQDKFAIPGIQGSILVFNIGISK--PIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRV 349
           D+   A  G Q +I +++I  S   P+    GH   +T++++ + NK ++++S+D T++V
Sbjct: 43  DKKLLAAAGHQ-NIRLYDIKTSNSNPVASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKV 101

Query: 350 W--RGGNLNPSHVFYGHSQSITSA--HWVDDDTIISTSMDGSIRVWSLASNSTVASATV- 404
           W  R  ++ P +  Y H+  +     H  +   +IS   DG+IR+W L  N      T  
Sbjct: 102 WDIRSPSV-PRN--YKHNAPVNEVVIH-PNQGELISCDRDGNIRIWDLGENQCTHQLTPE 157

Query: 405 DGVPNFTGALSPDQGKFATGTLDGEVMVYDI 435
           D VP  + +++ D          G   V+++
Sbjct: 158 DDVPLQSLSVASDGSMLVAANNKGNCYVWEM 188

>ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH]
           (843171..846785) [3615 bp, 1204 aa]
          Length = 1204

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 63/135 (46%), Gaps = 5/135 (3%)

Query: 261 VWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLR 320
           +W+   G  +  F   E       GVD     Q  F   G   SI V+++   K +  L 
Sbjct: 37  LWDYRMGVLLHRFEEHEGPVR---GVDFHPT-QPLFVSAGDDYSIKVWSLSTHKCLFTLN 92

Query: 321 GHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHW-VDDDTI 379
           GH   + T+ ++     ++SASDD T+R+W   N        GH+  +  A +   +D +
Sbjct: 93  GHLDYVRTVFFHTELPWIISASDDQTIRIWNWQNRREIACLTGHNHFVMCAQFHPTEDLV 152

Query: 380 ISTSMDGSIRVWSLA 394
           +S S+D ++R+W ++
Sbjct: 153 VSASLDETVRIWDIS 167

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/195 (21%), Positives = 87/195 (44%), Gaps = 20/195 (10%)

Query: 209 LLTGVESGELRLWSVEGKLQ-NILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSG 267
           +++  +   +R+W+ + + +   L+ H   ++C +++  E  V++   D    +W++ SG
Sbjct: 110 IISASDDQTIRIWNWQNRREIACLTGHNHFVMCAQFHPTEDLVVSASLDETVRIWDI-SG 168

Query: 268 TAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLT 327
              +H +      EE +      I Q      G    ++ F          L GH++ + 
Sbjct: 169 LRKRHSAPGSQSFEEQM------ITQQNLFDGGFGDCVVKF---------ILEGHTRGVN 213

Query: 328 TIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHV--FYGHSQSITSAHWVD-DDTIISTSM 384
             +++    L++S SDD  +++WR  +     V    GH+ ++ S  +    + IIS   
Sbjct: 214 WASFHPTLPLIVSGSDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPFQNLIISVGE 273

Query: 385 DGSIRVWSLASNSTV 399
           D +IRVW L   + V
Sbjct: 274 DSTIRVWDLDKRTPV 288

>KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces
           cerevisiae YNL317w PFS2 polyadenylation factor I subunit
           2 required for mRNA 3 -end processing, bridges two mRNA
           3 -end processing factors singleton, start by similarity
          Length = 452

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/249 (20%), Positives = 91/249 (36%), Gaps = 49/249 (19%)

Query: 197 VTCLEWAPAGQSLLTGVESGELRLWSVEG-KLQNILSYHRAPIVCIKWNSDETHVLTCDA 255
           +  L W P G+ L+    +GE  LWS      ++I+  H + +  + ++     +++  A
Sbjct: 84  IPALTWTPEGRRLVVATYNGEFSLWSGSSFNFESIMQAHDSAVTVMTYSHTGDWMVSGSA 143

Query: 256 DNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKP 315
           D    +W                              Q  F +  +              
Sbjct: 144 DGELKIW------------------------------QPNFNMVKVMD------------ 161

Query: 316 IGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVD 375
               + H + +  I+++  ++  +S SDDN L++W   N     V  GH   + S  W  
Sbjct: 162 ----QAHMECVREISFSPTDQKFVSCSDDNVLKIWNFSNGQQERVLSGHHWDVKSCDWHP 217

Query: 376 D-DTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGK-FATGTLDGEVMVY 433
               I+S S D  I+ W   S S V++         +    P QG   +  + D    VY
Sbjct: 218 KMGLIVSGSKDNLIKFWDPRSGSCVSTMLGFKHTIISTKFQPKQGNLLSVISKDKTCKVY 277

Query: 434 DIQKLLQQL 442
           DI++  ++L
Sbjct: 278 DIRQQAKEL 286

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 57/257 (22%), Positives = 101/257 (39%), Gaps = 64/257 (24%)

Query: 163 DSRAAVVTYS---------VADG---LW--NISETVVLADANTGQQNEVTCLEWAPAGQS 208
           DS   V+TYS          ADG   +W  N +   V+  A+     E++   ++P  Q 
Sbjct: 123 DSAVTVMTYSHTGDWMVSGSADGELKIWQPNFNMVKVMDQAHMECVREIS---FSPTDQK 179

Query: 209 LLTGVESGELRLWSV-EGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSG 267
            ++  +   L++W+   G+ + +LS H   +    W+     +++   DN+   W+  SG
Sbjct: 180 FVSCSDDNVLKIWNFSNGQQERVLSGHHWDVKSCDWHPKMGLIVSGSKDNLIKFWDPRSG 239

Query: 268 TAVQ------------HFSFKEAGTEESLGVDAT-------------------------- 289
           + V              F  K+      +  D T                          
Sbjct: 240 SCVSTMLGFKHTIISTKFQPKQGNLLSVISKDKTCKVYDIRQQAKELFSVRDDVDYMTLQ 299

Query: 290 W--IDQDKFAIPGIQGSILVFNIG----ISKPIGKLR-GHSKTLTTIAYNEHNKLLLSAS 342
           W  ID+  F +    GSI  F++      +KP   +   H K +T++AY+    ++ SAS
Sbjct: 300 WHPIDETVFTVGCYDGSIKHFDLSQENQPNKPTHNIPYAHEKCVTSLAYSPIGHIMASAS 359

Query: 343 DDNTLRVW-RGGNLNPS 358
            D T+R W R   ++P+
Sbjct: 360 KDRTIRFWTRSRAVDPN 376

>AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH]
           (134760..136127) [1368 bp, 455 aa]
          Length = 455

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/241 (23%), Positives = 94/241 (39%), Gaps = 60/241 (24%)

Query: 206 GQSLLTGVESGELRLWSVE--GKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWN 263
           GQ L TG   G +++ S E  G  ++I + H   I  + W+ D  H+L+   DN+  +W+
Sbjct: 184 GQQLATGCWGGSIKVVSCETLGIAKSIDAAHEGKIGGLDWHPDGNHLLSGGGDNLVKLWD 243

Query: 264 VLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHS 323
           + S       SF+E                                         LRGH+
Sbjct: 244 MTSN------SFEE-----------------------------------------LRGHA 256

Query: 324 KTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSI-TSAHWVDDDTIIST 382
             ++ +  +   +L  SAS D T  +W         +  GHS+++ T A   D   + S 
Sbjct: 257 GRVSRVKVHPSGRLAASASFDLTWILWDLERKVELQLQEGHSKAVYTIAFQSDGALLASA 316

Query: 383 SMDGSIRVWSLASNSTVASATVDGVPNFTGALS-----PDQGKFATGTLDGEVMVYDIQK 437
            +D    +W L S   +       +    GA+S     P+  + AT   DG V V+DI+ 
Sbjct: 317 GLDAVCAIWDLRSGEPIMK-----LEGHAGAISGVDWSPNGYQLATAGADGTVRVWDIRN 371

Query: 438 L 438
           +
Sbjct: 372 V 372

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 39/194 (20%), Positives = 72/194 (37%), Gaps = 21/194 (10%)

Query: 166 AAVVTYSVADGLWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVE- 224
           AA  ++ +   LW++   V L     G    V  + +   G  L +        +W +  
Sbjct: 271 AASASFDLTWILWDLERKVEL-QLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRS 329

Query: 225 GKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESL 284
           G+    L  H   I  + W+ +   + T  AD    VW++           +  GTE +L
Sbjct: 330 GEPIMKLEGHAGAISGVDWSPNGYQLATAGADGTVRVWDI-----------RNVGTESAL 378

Query: 285 ------GVDATWIDQD-KFAIP-GIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNK 336
                  +D  +   +  F +  G    + +FN    + +  L GH+  + T+   E   
Sbjct: 379 LAHQVAALDVKFKKNNGTFLVSCGHDRLVNIFNADNWQKLASLEGHTDRVFTVDITEDGS 438

Query: 337 LLLSASDDNTLRVW 350
            + S   D +L+ W
Sbjct: 439 TIYSGGKDRSLKQW 452

>KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1 40S
           small subunit ribosomal protein, start by similarity
          Length = 326

 Score = 52.4 bits (124), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 71/146 (48%), Gaps = 14/146 (9%)

Query: 304 SILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYG 363
           ++ ++N+       +  GH+  + ++A + ++  ++SAS D T+RVW     + ++V  G
Sbjct: 89  TLRLWNLATGNSEARFVGHTGDVLSVAIDANSSKIISASRDKTIRVWNTVG-DCAYVLLG 147

Query: 364 HSQSITSAHW---------VDDD--TIISTSMDGSIRVWSLASNSTVASATVDGVPNFTG 412
           H+  +T             VDD   T +S  MD  +R WSL  +S    A   G  N+  
Sbjct: 148 HTDWVTKVRVAPKNLEDGEVDDGRITFVSAGMDKIVRSWSLNEDSYRIEADFIGHNNYIN 207

Query: 413 AL--SPDQGKFATGTLDGEVMVYDIQ 436
            +  SPD    A+   DG++ V++++
Sbjct: 208 VVQPSPDGSLAASAGKDGQIYVWNLK 233

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 41/80 (51%), Gaps = 3/80 (3%)

Query: 315 PIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWV 374
           P+   +GHS  +  +  +      +SAS D TLR+W     N    F GH+  + S   +
Sbjct: 58  PVRSYKGHSHIVQDVVVSADGNYAVSASWDKTLRLWNLATGNSEARFVGHTGDVLSVA-I 116

Query: 375 DDDT--IISTSMDGSIRVWS 392
           D ++  IIS S D +IRVW+
Sbjct: 117 DANSSKIISASRDKTIRVWN 136

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 59/128 (46%), Gaps = 13/128 (10%)

Query: 317 GKLRGHSKTLTTIAYNE-HNKLLLSASDDNTLRVWRGGNLN-----PSHVFYGHSQ---- 366
           G L GH+  +T+++ +     LL+S S D TL  WR          P   + GHS     
Sbjct: 12  GTLEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIVQD 71

Query: 367 SITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTL 426
            + SA   D +  +S S D ++R+W+LA+ ++ A          + A+  +  K  + + 
Sbjct: 72  VVVSA---DGNYAVSASWDKTLRLWNLATGNSEARFVGHTGDVLSVAIDANSSKIISASR 128

Query: 427 DGEVMVYD 434
           D  + V++
Sbjct: 129 DKTIRVWN 136

 Score = 30.8 bits (68), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 84/209 (40%), Gaps = 26/209 (12%)

Query: 244 NSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQG 303
           ++D  + ++   D    +WN+ +G +   F     G   S+ +DA   +  K        
Sbjct: 75  SADGNYAVSASWDKTLRLWNLATGNSEARF-VGHTGDVLSVAIDA---NSSKIISASRDK 130

Query: 304 SILVFN---------IGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGN 354
           +I V+N         +G +  + K+R   K L     ++     +SA  D  +R W   +
Sbjct: 131 TIRVWNTVGDCAYVLLGHTDWVTKVRVAPKNLEDGEVDDGRITFVSAGMDKIVRSW---S 187

Query: 355 LNPSHV-----FYGHSQSITSAHWVDDDTIISTS-MDGSIRVWSLASNSTVASATV-DGV 407
           LN         F GH+  I       D ++ +++  DG I VW+L   S   +    D V
Sbjct: 188 LNEDSYRIEADFIGHNNYINVVQPSPDGSLAASAGKDGQIYVWNLKHKSAFMNFDAKDEV 247

Query: 408 PNFTGALSPDQGKFATGTLDGEVMVYDIQ 436
             F  A SP +      T  G + +YD++
Sbjct: 248 --FALAFSPSRFWLTAATASG-IKIYDLE 273

>KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30 involved in regulation of
           sulfur assimilation genes and cell cycle progression,
           start by similarity
          Length = 623

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 83/187 (44%), Gaps = 20/187 (10%)

Query: 214 ESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHF 273
            +G  R+   +G +  +LS        +K+N     + T   D+   +W+  SG  ++  
Sbjct: 299 RNGRCRIQLFKGHMDGVLS--------LKFN--HRLLFTGSYDSTVAIWDTKSGNLIRRL 348

Query: 274 SFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNE 333
                 T  + GV   + D  K     +  +I V+N      I   RGH  ++ ++  + 
Sbjct: 349 ------TGHTDGVKGIYFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSV--DS 400

Query: 334 HNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDD-TIISTSMDGSIRVWS 392
           + K+++SAS D T++VW   +    +   GH++ +          T  S+S D ++R+W 
Sbjct: 401 YKKIIVSASADKTVKVWHVES-RTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWD 459

Query: 393 LASNSTV 399
           + +NS +
Sbjct: 460 IRTNSCI 466

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 57/271 (21%), Positives = 112/271 (41%), Gaps = 57/271 (21%)

Query: 209 LLTGVESGELRLWSVE-GKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSG 267
           L TG     + +W  + G L   L+ H   +  I +  D+  ++T   D    VWN ++G
Sbjct: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DDQKMITASLDKTIRVWNYITG 382

Query: 268 TAVQHFSFKEAGTEES-LGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTL 326
           + +  +     G ++S L VD+    +          ++ V+++  S+    LRGH++ +
Sbjct: 383 SCISTYR----GHQDSVLSVDSY---KKIIVSASADKTVKVWHVE-SRTCYTLRGHTEWV 434

Query: 327 TTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSA--------------- 371
             +  +  +    S+SDD TLR+W     +   VF GH   +                  
Sbjct: 435 NCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDE 494

Query: 372 ------------HWVDDDT------------IISTSMDGSIRVWSLASNSTVAS--ATVD 405
                        + DD T            ++S S+D +I++W ++S   + +    V+
Sbjct: 495 KIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVE 554

Query: 406 GVPNFTGALSPDQGKFATGTLDGEVMVYDIQ 436
           GV +    ++ D  +  +G+ D  + V+D+Q
Sbjct: 555 GVWD----IAADNFRIVSGSHDKSIKVWDLQ 581

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 48/86 (55%), Gaps = 3/86 (3%)

Query: 316 IGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVD 375
           I   +GH   + ++ +N  ++LL + S D+T+ +W   + N      GH+  +   ++ D
Sbjct: 305 IQLFKGHMDGVLSLKFN--HRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF-D 361

Query: 376 DDTIISTSMDGSIRVWSLASNSTVAS 401
           D  +I+ S+D +IRVW+  + S +++
Sbjct: 362 DQKMITASLDKTIRVWNYITGSCIST 387

 Score = 42.0 bits (97), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 48/226 (21%), Positives = 86/226 (38%), Gaps = 31/226 (13%)

Query: 218 LRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKE 277
           +++W VE +    L  H   + C+K +       +   D    +W++ + + ++ F    
Sbjct: 414 VKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHV 473

Query: 278 AGTE----------ESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLT 327
              +          E+L VD      +K   P ++        GI  P            
Sbjct: 474 GQVQKVIPLTIKDTENLVVDEK---IEKVPNPELEEDFADDCTGIFDP------------ 518

Query: 328 TIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDTIISTSMDGS 387
            + Y  H   LLS S DNT+++W   +       +GH + +      D+  I+S S D S
Sbjct: 519 NLKYPTH---LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIA-ADNFRIVSGSHDKS 574

Query: 388 IRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVY 433
           I+VW L +   + + T    P     +      F +G   GEV ++
Sbjct: 575 IKVWDLQNGKCIQTFTGHKAPIVCVGIG--DSSFVSGDELGEVKMW 618

>Kwal_23.5351
          Length = 474

 Score = 52.4 bits (124), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 54/244 (22%), Positives = 100/244 (40%), Gaps = 45/244 (18%)

Query: 197 VTCLEWAPAGQSLLTGVESGELRLWSVEGK--LQNILSYHRAPIVCIKWNSDETHVLTCD 254
           V+ +  +P G SL  G  +G++++   +    ++++   H   I  + W+SD   + T  
Sbjct: 185 VSQVARSPDGASLAAGSWNGDVKILHPQSLEVVRSLDGAHDDKIGGVAWSSDSQLLATGG 244

Query: 255 ADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISK 314
           ADN+  +WN       Q  S  EA                                  S+
Sbjct: 245 ADNLVKIWNP------QAQSHSEA----------------------------------SR 264

Query: 315 PIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHW- 373
            +  LRGH   ++ + ++  ++ + SAS D T R+W         +  GH++ +    + 
Sbjct: 265 VV--LRGHEARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQLQEGHAKEVYCLDFQ 322

Query: 374 VDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVY 433
            D   + S  +D    VW + +  ++        P +  + SP+    ATG+ DG V V+
Sbjct: 323 CDGSLLCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGSGDGTVQVW 382

Query: 434 DIQK 437
           DI+K
Sbjct: 383 DIRK 386

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/244 (19%), Positives = 107/244 (43%), Gaps = 18/244 (7%)

Query: 172 SVADGLWNISETV-------VLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVE 224
           S+A G WN    +       V+   +    +++  + W+   Q L TG     +++W+ +
Sbjct: 196 SLAAGSWNGDVKILHPQSLEVVRSLDGAHDDKIGGVAWSSDSQLLATGGADNLVKIWNPQ 255

Query: 225 GKLQN-----ILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAG 279
            +  +     +L  H A +  +K++  +  V +   D    +W+V   T +Q    +E  
Sbjct: 256 AQSHSEASRVVLRGHEARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQ---LQEGH 312

Query: 280 TEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLL 339
            +E   +D    D       G+     V+++   + +  L GH+K +  ++++ +   + 
Sbjct: 313 AKEVYCLDFQ-CDGSLLCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVA 371

Query: 340 SASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDT--IISTSMDGSIRVWSLASNS 397
           + S D T++VW     N       H+  ++  ++  ++   ++S+S D +I V++  S  
Sbjct: 372 TGSGDGTVQVWDIRKANKPSSILAHNSIVSEVNFEKENGNFLVSSSYDRTIGVFATGSWI 431

Query: 398 TVAS 401
            +AS
Sbjct: 432 KLAS 435

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/213 (20%), Positives = 95/213 (44%), Gaps = 15/213 (7%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQ-NILSYHRAPIVCIKWNSDETHV 250
           G +  V+ +++ P+ + + +       RLW VE + +  +   H   + C+ +  D + +
Sbjct: 269 GHEARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQLQEGHAKEVYCLDFQCDGSLL 328

Query: 251 LTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGI-QGSILVFN 309
            +   D++  VW++ +G ++      E   +   GV  +W         G   G++ V++
Sbjct: 329 CSAGLDSVGHVWDMRTGRSLMVL---EGHAKPIYGV--SWSPNGHHVATGSGDGTVQVWD 383

Query: 310 IGISKPIGKLRGHSKTLTTIAYNEHN-KLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSI 368
           I  +     +  H+  ++ + + + N   L+S+S D T+ V+  G+        GH+  I
Sbjct: 384 IRKANKPSSILAHNSIVSEVNFEKENGNFLVSSSYDRTIGVFATGSWIKLASLQGHTDKI 443

Query: 369 TSAHWVD----DDTIISTSMDGSIRVWSLASNS 397
            S   VD       + S+  D S+++W+L   S
Sbjct: 444 LS---VDISRGGANLWSSGWDRSVKIWALGVRS 473

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 41/194 (21%), Positives = 75/194 (38%), Gaps = 15/194 (7%)

Query: 163 DSRAAVVTYSVADGLWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWS 222
           D   A  ++ +   LW++     L     G   EV CL++   G  L +        +W 
Sbjct: 283 DRFVASASFDMTWRLWDVERETEL-QLQEGHAKEVYCLDFQCDGSLLCSAGLDSVGHVWD 341

Query: 223 VE-GKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSG----TAVQHFSF-K 276
           +  G+   +L  H  PI  + W+ +  HV T   D    VW++       + + H S   
Sbjct: 342 MRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGSGDGTVQVWDIRKANKPSSILAHNSIVS 401

Query: 277 EAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNK 336
           E   E+  G        +         +I VF  G    +  L+GH+  + ++  +    
Sbjct: 402 EVNFEKENG--------NFLVSSSYDRTIGVFATGSWIKLASLQGHTDKILSVDISRGGA 453

Query: 337 LLLSASDDNTLRVW 350
            L S+  D ++++W
Sbjct: 454 NLWSSGWDRSVKIW 467

>CAGL0L03201g complement(366795..368534) some similarities with
           sp|P47025 Saccharomyces cerevisiae YJL112w MDV1 or
           sp|P36130 Saccharomyces cerevisiae YKR036c CAF4 CCR4,
           hypothetical start
          Length = 579

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 73/164 (44%), Gaps = 29/164 (17%)

Query: 301 IQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW-------RGG 353
           +   I +++I  ++ +G L GH  T+ T  + +  +LL SA  D +++VW       + G
Sbjct: 301 LDNEIKLWDISTTQCLGVLSGHRATVNTTRFIDDTRLLASAGKDASVKVWDVDNIVDKDG 360

Query: 354 NLNPS---HVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVAS--------- 401
           N N +     F GH  S+T A     + I+S S D ++R W L S   + S         
Sbjct: 361 NANDNLCLATFDGHKDSVT-ALATTGNAIVSGSNDKTLRHWDLGSGKCIQSIDLTIALKM 419

Query: 402 -----ATVDGVPNFT----GALSPDQGKFATGTLDGEVMVYDIQ 436
                + +D  P+F     G          TGT DG V ++D++
Sbjct: 420 VPQSVSKLDITPSFNTPLIGGADCIDNALVTGTKDGIVYLWDLR 463

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 65/137 (47%), Gaps = 11/137 (8%)

Query: 310 IGISKPIGK-LRGHSKTLTTIAYNEHNKLLLSASD-DNTLRVWRGGNLNPSHVFYGHSQS 367
           IG    +GK L+ H   + ++A N    +L S ++ DN +++W         V  GH  +
Sbjct: 266 IGTKGQLGKTLKCHDDYINSLAINAQLGVLSSTANLDNEIKLWDISTTQCLGVLSGHRAT 325

Query: 368 ITSAHWVDDDTIISTS-MDGSIRVWSL--------ASNSTVASATVDGVPNFTGALSPDQ 418
           + +  ++DD  +++++  D S++VW +         +N  +  AT DG  +   AL+   
Sbjct: 326 VNTTRFIDDTRLLASAGKDASVKVWDVDNIVDKDGNANDNLCLATFDGHKDSVTALATTG 385

Query: 419 GKFATGTLDGEVMVYDI 435
               +G+ D  +  +D+
Sbjct: 386 NAIVSGSNDKTLRHWDL 402

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 42/80 (52%), Gaps = 5/80 (6%)

Query: 207 QSLLTGVESGELRLWSVE-GKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVL 265
            +L+TG + G + LW +  G++   L  HR PI  +K+   E  ++T   D  T +W++ 
Sbjct: 446 NALVTGTKDGIVYLWDLRIGRVVGSLEGHRGPITSLKYMGSE--LITGSMDKSTRIWDLR 503

Query: 266 SGTAVQHFSFKE--AGTEES 283
            G+  +  SF++     EES
Sbjct: 504 MGSVAELLSFEKEVVSVEES 523

>AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH]
           complement(442821..445589) [2769 bp, 922 aa]
          Length = 922

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/209 (21%), Positives = 87/209 (41%), Gaps = 18/209 (8%)

Query: 181 SETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWS-VEGKLQNILSYHRAPIV 239
           SE+ +L     G  + +  L ++P G  ++T  E G++++W  V G        H + + 
Sbjct: 345 SESYILK--QQGHFDALNALAYSPDGARIVTAAEDGKIKIWDIVSGFCLATFEEHTSSVT 402

Query: 240 CIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIP 299
            +++  +   + +   D     W+++     + F+  E      L  D T     +    
Sbjct: 403 SVQFAKNGQIMFSSSLDGTVKAWDLMRFRNFRTFTATERIQFSCLAADPT----GEVVCA 458

Query: 300 GIQGS--ILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNP 357
           G   +  I V+++   + +  L GH   ++ ++++  N +L SAS D T+RVW       
Sbjct: 459 GSLDNYDIQVWSVQTGQLLDTLSGHEGPVSCLSFSRENSILASASWDKTIRVWS------ 512

Query: 358 SHVFYGHSQSITSAHWVDDDTIISTSMDG 386
               +G SQ +       D   IS   DG
Sbjct: 513 ---IFGRSQQVEPIEAYSDVLDISMRPDG 538

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 77/178 (43%), Gaps = 23/178 (12%)

Query: 234 HRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQ 293
           HR  I  I  N+  T +L+ D D   I+ N+ +   + HF+FK+   +     D      
Sbjct: 70  HRRNIARIDVNAQGTLLLSVDVDGRAILVNIKTRNVIHHFNFKDKVNDVKFSTDGKL--- 126

Query: 294 DKFAIPGIQGSILVFNIGIS-----KPIGKLR---GHSKTLTTIAYNEHNKLLLSASDDN 345
             FA+   +   +    G+S      P  + R   GH   +T++ ++  ++ ++S + D 
Sbjct: 127 --FALACGRFLQIWRTPGVSAERQFAPFVRYRVHAGHFADITSLTWSRDSRFIISTAKDM 184

Query: 346 TLRVWRGGNLN------PSHVFYGHSQSITSAHW-VDDDTIISTSMDGSIRVWSLASN 396
           T R++   ++N       S  F GH   +  A +  D + I + S DG++  W    N
Sbjct: 185 TARIY---SVNAEEKDLASMTFAGHRDYVMGAFFSADQEKIYTVSKDGALFQWEYTKN 239

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 63/136 (46%), Gaps = 6/136 (4%)

Query: 303 GSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFY 362
           G +LV+       I K +GH   L  +AY+     +++A++D  +++W   +      F 
Sbjct: 336 GQLLVYEWQSESYILKQQGHFDALNALAYSPDGARIVTAAEDGKIKIWDIVSGFCLATFE 395

Query: 363 GHSQSITSAHWVDDDTII-STSMDGSIRVWSLASNSTVASATVDGVPNFTG-ALSPDQGK 420
            H+ S+TS  +  +  I+ S+S+DG+++ W L       + T      F+  A  P    
Sbjct: 396 EHTSSVTSVQFAKNGQIMFSSSLDGTVKAWDLMRFRNFRTFTATERIQFSCLAADPTGEV 455

Query: 421 FATGTLDGEVMVYDIQ 436
              G+LD     YDIQ
Sbjct: 456 VCAGSLDN----YDIQ 467

>Kwal_55.22067
          Length = 451

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 53/257 (20%), Positives = 104/257 (40%), Gaps = 10/257 (3%)

Query: 197 VTCLEWAPAGQSLLTGVESGELRLWSVEG-KLQNILSYHRAPIVCIKWNSDETHVLTCDA 255
           +  LEW P G+ L+    SGE  LW+      ++I+  H + +  +K++     +++ D+
Sbjct: 86  IPALEWTPEGRRLVVATYSGEFSLWNGSTFNFESIMQAHDSAVAVMKYSHAGDWLISGDS 145

Query: 256 DNMTIVWNV-LSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISK 314
           D    +W    +   V      EA T+   G+  +  D  KF        + ++N    +
Sbjct: 146 DGTIKIWQPNFNMVKV----LDEAHTQCIRGISFSGTDS-KFVTCSDDNILKIWNFSNGQ 200

Query: 315 PIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW--RGGNLNPSHVFYGHSQSITSAH 372
               L GH   + +  ++    L+ S S DN +++W  R G    + +   H+   T   
Sbjct: 201 QESTLSGHHWDVRSCDWHPTMGLIASGSKDNLVKLWDPRAGQCISTILGCKHTIISTKFQ 260

Query: 373 WVDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSP-DQGKFATGTLDGEVM 431
               + +   S D S R++ +  N    +   D     +    P ++  F  G  DG + 
Sbjct: 261 PTKGNMLAVISKDKSCRIFDIRQNMKELAVYRDESDYMSLTWHPINESMFTVGCYDGSMK 320

Query: 432 VYDIQKLLQQLNHNGYH 448
            +D+ +  Q  +   +H
Sbjct: 321 HFDLLQEPQDSSSGCFH 337

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 75/172 (43%), Gaps = 18/172 (10%)

Query: 191 TGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVE-GKLQNILSYHRAPIVCIKWNSDETH 249
           +G   +V   +W P    + +G +   ++LW    G+  + +   +  I+  K+   + +
Sbjct: 206 SGHHWDVRSCDWHPTMGLIASGSKDNLVKLWDPRAGQCISTILGCKHTIISTKFQPTKGN 265

Query: 250 VLTC-DADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATW--IDQDKFAIPGIQGSIL 306
           +L     D    ++++      Q+        +ES  +  TW  I++  F +    GS+ 
Sbjct: 266 MLAVISKDKSCRIFDIR-----QNMKELAVYRDESDYMSLTWHPINESMFTVGCYDGSMK 320

Query: 307 VFNIGISKPIGKLRG--------HSKTLTTIAYNEHNKLLLSASDDNTLRVW 350
            F++ + +P     G        H K +T++AYN    +L SAS D T+R W
Sbjct: 321 HFDL-LQEPQDSSSGCFHNIPYAHDKCITSLAYNPVGHILASASKDRTIRFW 371

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/136 (19%), Positives = 56/136 (41%), Gaps = 11/136 (8%)

Query: 326 LTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVD-DDTIISTSM 384
           +  + +    + L+ A+      +W G   N   +   H  ++    +    D +IS   
Sbjct: 86  IPALEWTPEGRRLVVATYSGEFSLWNGSTFNFESIMQAHDSAVAVMKYSHAGDWLISGDS 145

Query: 385 DGSIRVWSLASN-----STVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQKLL 439
           DG+I++W    N         +  + G+ +F+G  S    KF T + D  + +++     
Sbjct: 146 DGTIKIWQPNFNMVKVLDEAHTQCIRGI-SFSGTDS----KFVTCSDDNILKIWNFSNGQ 200

Query: 440 QQLNHNGYHGTARSAE 455
           Q+   +G+H   RS +
Sbjct: 201 QESTLSGHHWDVRSCD 216

>Sklu_2382.2 YDL195W, Contig c2382 2146-5931 reverse complement
          Length = 1261

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 61/274 (22%), Positives = 122/274 (44%), Gaps = 39/274 (14%)

Query: 200 LEWAPAGQSLLTGVESGELRLWSVEGKLQNI--LSYHRAPIVCIKWNSDETHVLTCDADN 257
           L+W+P    L   +++G +  +S + +L+++  +S H  P+  +K+N+ + +VL C  D+
Sbjct: 68  LDWSPDNSILAGALDNGIVEFFSPK-ELKSVAKISKHTTPVNTLKFNAKQDNVL-CSGDS 125

Query: 258 M--TIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQ-----------DKFAIPGIQGS 304
                +W++   T+  +  F       S GV  T ID+             FA  G  G 
Sbjct: 126 RGEIFIWDINKITSSGYVPF-------SPGVAMTPIDEVYSLAWNQSLAHVFASAGSSGY 178

Query: 305 ILVFNIGISKPIGKLR------GHSKTLTTIAYNEHN--KLLLSASDDN--TLRVW--RG 352
             ++++   K +  L       G    L+ + ++  N  K+  +  +DN   + VW  R 
Sbjct: 179 TSIWDLKAKKEVLHLSYTSPSTGAKNHLSVVEWHPSNSTKIATATGNDNDPVILVWDLRN 238

Query: 353 GNLNPSHVFYGHSQSITSAHWV--DDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNF 410
                  +  GHS+ I S  W   D++ ++S+  D +  +W+  +   ++     G   F
Sbjct: 239 AKAPLQAMSQGHSKGILSLDWCKQDENLLLSSGRDNTCALWNPQTAQKLSQFPTRGNWCF 298

Query: 411 TGALSPDQGK-FATGTLDGEVMVYDIQKLLQQLN 443
               +P+    FA+ +LD ++ V  +Q L  +L+
Sbjct: 299 KTKFAPEAPDLFASASLDNKIQVQTLQNLTNKLD 332

 Score = 33.5 bits (75), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 43/91 (47%), Gaps = 8/91 (8%)

Query: 191 TGQQNEVTCLEWAPAGQSLL---TGVESGELRL-WSV---EGKLQNILSYHRAPIVCIKW 243
           TG +N ++ +EW P+  + +   TG ++  + L W +   +  LQ +   H   I+ + W
Sbjct: 200 TGAKNHLSVVEWHPSNSTKIATATGNDNDPVILVWDLRNAKAPLQAMSQGHSKGILSLDW 259

Query: 244 -NSDETHVLTCDADNMTIVWNVLSGTAVQHF 273
              DE  +L+   DN   +WN  +   +  F
Sbjct: 260 CKQDENLLLSSGRDNTCALWNPQTAQKLSQF 290

>Scas_720.83d
          Length = 915

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 70/172 (40%), Gaps = 7/172 (4%)

Query: 234 HRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQ 293
           HR  I  I  N   T +++ D D   I+ N  + T + HF+FKE   +     D      
Sbjct: 54  HRKNIATIDLNKQGTLLISVDEDGRAILTNFKAKTVLHHFNFKEKCYQVKFSPDGKLFAL 113

Query: 294 DKFAIPGIQGSILVFNIGISKPIGKLR---GHSKTLTTIAYNEHNKLLLSASDDNTLRVW 350
                  I  +          P  + R   GH + + ++ ++  ++ ++S S D T R+W
Sbjct: 114 ATGRFLQIWKTPDATEDRQFAPFVRYRVHAGHFQDILSLTWSLDSRFIISTSKDLTARIW 173

Query: 351 RGGNLNP---SHVFYGHSQSITSAHW-VDDDTIISTSMDGSIRVWSLASNST 398
              +      S  F GH   +  A +  D + I + S DG++ VW     ST
Sbjct: 174 SIDSEEKDLASMTFAGHRDYVMGAFFSADQEKIYTVSKDGALFVWEFTKKST 225

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/191 (20%), Positives = 84/191 (43%), Gaps = 19/191 (9%)

Query: 181 SETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSV-EGKLQNILSYHRAPIV 239
           SE+ +L     G  +    L ++P G  ++T  E G++++W V  G        H + + 
Sbjct: 332 SESYILK--QQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVVSGFCLATFQEHTSSVT 389

Query: 240 CIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIP 299
            +++      + +   D     W++     +++ +F+     E +  +   +D     + 
Sbjct: 390 QVQFAKRGQVLFSSSLDGTVRAWDL-----IRYRNFRTFTAAERIQFNCLAVDPSGEVVC 444

Query: 300 GIQGSILVFNIGI-----SKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW---- 350
              GS+  F+I +      + +  L GH   ++ +A+++ N +L SAS D T+RVW    
Sbjct: 445 A--GSLDNFDIHVWSVQTGQLLDTLSGHEGPVSCLAFSQENSVLASASWDKTVRVWSIFG 502

Query: 351 RGGNLNPSHVF 361
           R   + P  V+
Sbjct: 503 RSQQVEPFDVY 513

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 69/150 (46%), Gaps = 6/150 (4%)

Query: 303 GSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFY 362
           G +LV+       I K +GH     ++ Y+     +++A++D  ++VW   +      F 
Sbjct: 323 GQLLVYEWQSESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVVSGFCLATFQ 382

Query: 363 GHSQSITSAHWVDDDTII-STSMDGSIRVWSLASNSTVASATVDGVPNFTG-ALSPDQGK 420
            H+ S+T   +     ++ S+S+DG++R W L       + T      F   A+ P    
Sbjct: 383 EHTSSVTQVQFAKRGQVLFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFNCLAVDPSGEV 442

Query: 421 FATGTLDG-EVMVYDIQ--KLLQQLN-HNG 446
              G+LD  ++ V+ +Q  +LL  L+ H G
Sbjct: 443 VCAGSLDNFDIHVWSVQTGQLLDTLSGHEG 472

>KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces
           cerevisiae YDR364c CDC40 cell division control protein
           singleton, start by similarity
          Length = 429

 Score = 51.6 bits (122), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 55/258 (21%), Positives = 103/258 (39%), Gaps = 21/258 (8%)

Query: 192 GQQNEVTCLEWAP-AGQSLLTGVESGELRLWSVEGKLQNILSY--HRAPIVCIKWNSDET 248
           G +N  T L + P  G  LL+G     ++LW    + + + +Y  H   I  + +  +  
Sbjct: 133 GHKNGTTSLRFIPKTGHLLLSGGNDNIIKLWDFYHERELLRTYEGHSMTIKDLNFTDNGH 192

Query: 249 HVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVF 308
              +   D    +WN   G   +   F       +        D+++  +      I  +
Sbjct: 193 SFASASFDKWVKIWNTEKGIIDKRLRFNSVPNCITFHPK----DKNQLVVGLSNSEIRHY 248

Query: 309 NIGISKPIGKLRG---HSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHS 365
           ++ +S+  G+++    H  ++  + Y    K L+S+S+D T+R+W      P     G +
Sbjct: 249 DLRLSENHGEVQKYDHHQGSILALKYFPDGKKLISSSEDKTVRIWENRINIPIKQISGTA 308

Query: 366 QSITSAHWVDDD----TIISTSMDGSIRVWSLASNSTVASATVDGVPNFTG-----ALSP 416
           Q   S  W+D +    +  + SMD +I  +S+               N TG     A SP
Sbjct: 309 QH--SMPWIDINPQGQSFCTQSMDNTIYTYSMLPKYKRHPNKTFKGHNTTGYGIHFAFSP 366

Query: 417 DQGKFATGTLDGEVMVYD 434
           D    A+G   G+  ++D
Sbjct: 367 DGQYIASGDSKGQTFIWD 384

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 55/124 (44%), Gaps = 3/124 (2%)

Query: 316 IGKLRGHSKTLTTIAY-NEHNKLLLSASDDNTLRVWRGGNLNPS-HVFYGHSQSITSAHW 373
           I +  GH    T++ +  +   LLLS  +DN +++W   +       + GHS +I   ++
Sbjct: 128 IAEYYGHKNGTTSLRFIPKTGHLLLSGGNDNIIKLWDFYHERELLRTYEGHSMTIKDLNF 187

Query: 374 VDD-DTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMV 432
            D+  +  S S D  +++W+            + VPN       D+ +   G  + E+  
Sbjct: 188 TDNGHSFASASFDKWVKIWNTEKGIIDKRLRFNSVPNCITFHPKDKNQLVVGLSNSEIRH 247

Query: 433 YDIQ 436
           YD++
Sbjct: 248 YDLR 251

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 27/65 (41%), Gaps = 3/65 (4%)

Query: 200 LEWAPAGQSLLTGVESGELRLWSVEGKLQNILSY---HRAPIVCIKWNSDETHVLTCDAD 256
             ++P GQ + +G   G+  +W  +            +  P+ CI+WN  ET  L C  +
Sbjct: 362 FAFSPDGQYIASGDSKGQTFIWDWKTTKLLKKFKPFSNNLPVTCIEWNPQETSKLCCAGN 421

Query: 257 NMTIV 261
              I 
Sbjct: 422 TGKIA 426

>Scas_695.15
          Length = 327

 Score = 51.2 bits (121), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 45/220 (20%), Positives = 88/220 (40%), Gaps = 15/220 (6%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVL 251
           G +  VT + +    + ++T  E G +++W V          H AP+  +  + ++  ++
Sbjct: 93  GHKGNVTSVSFQQDNKWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVIHPNQGELI 152

Query: 252 TCDADNMTIVWNVLSGTAVQHFSFKEAGTE-ESLGVDATWIDQDKFAIPGIQGSILVFNI 310
           +CD D    +W++            +  T  +SL V +   D         +G   V+ +
Sbjct: 153 SCDRDGTIKIWDLGENQCTHQLIPDDDNTSLQSLSVAS---DGSMLVAANNKGDCYVWEM 209

Query: 311 GIS------KPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGG----NLNPSHV 360
                    KPI K   H   +T +  +   K + + S D T ++W  G    + N    
Sbjct: 210 PNHTDASNLKPINKFSAHKDYITRVVLSSDVKHMATCSADRTAKIWSVGETEDDFNLETT 269

Query: 361 FYGHSQSI-TSAHWVDDDTIISTSMDGSIRVWSLASNSTV 399
             GH + +   A   D   +++ S D  +R+W L++   V
Sbjct: 270 LDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIV 309

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 57/105 (54%), Gaps = 4/105 (3%)

Query: 334 HNKLLLSASDDNTLRVWRGGNLNPSHV--FYGHSQSITSAHWVDDDT-IISTSMDGSIRV 390
           ++K LL+A+    +R++     NP+ V  F GH  ++TS  +  D+  ++++S DG+I+V
Sbjct: 62  NDKKLLAAAGYQNVRLYDIRTTNPNAVATFEGHKGNVTSVSFQQDNKWMVTSSEDGTIKV 121

Query: 391 WSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDI 435
           W + S S V        P     + P+QG+  +   DG + ++D+
Sbjct: 122 WDVRSPS-VPRNYKHNAPVNEVVIHPNQGELISCDRDGTIKIWDL 165

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 60/111 (54%), Gaps = 11/111 (9%)

Query: 292 DQDKFAIPGIQGSILVFNIGISKP--IGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRV 349
           D+   A  G Q ++ +++I  + P  +    GH   +T++++ + NK ++++S+D T++V
Sbjct: 63  DKKLLAAAGYQ-NVRLYDIRTTNPNAVATFEGHKGNVTSVSFQQDNKWMVTSSEDGTIKV 121

Query: 350 W--RGGNLNPSHVFYGHSQSITSA--HWVDDDTIISTSMDGSIRVWSLASN 396
           W  R  ++ P +  Y H+  +     H  +   +IS   DG+I++W L  N
Sbjct: 122 WDVRSPSV-PRN--YKHNAPVNEVVIH-PNQGELISCDRDGTIKIWDLGEN 168

 Score = 32.7 bits (73), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 39/186 (20%), Positives = 68/186 (36%), Gaps = 58/186 (31%)

Query: 177 LWNISET-----VVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEG------ 225
           +W++ E      ++  D NT  Q+    L  A  G  L+     G+  +W +        
Sbjct: 162 IWDLGENQCTHQLIPDDDNTSLQS----LSVASDGSMLVAANNKGDCYVWEMPNHTDASN 217

Query: 226 -KLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESL 284
            K  N  S H+  I  +  +SD  H+ TC AD    +W+V               TE+  
Sbjct: 218 LKPINKFSAHKDYITRVVLSSDVKHMATCSADRTAKIWSV-------------GETEDDF 264

Query: 285 GVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDD 344
            ++ T                             L GH + +   A++  +  L++AS D
Sbjct: 265 NLETT-----------------------------LDGHQRWVWDCAFSADSAYLVTASSD 295

Query: 345 NTLRVW 350
           + +R+W
Sbjct: 296 HYVRLW 301

>CAGL0C01441g complement(156930..159947) similar to tr|Q08924
           Saccharomyces cerevisiae YPL183c, start by similarity
          Length = 1005

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 70/145 (48%), Gaps = 9/145 (6%)

Query: 301 IQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHV 360
           + G  +V+++   + I  L GH  ++  I  +EHNKL+ S SDD ++R+W         +
Sbjct: 157 VMGGAIVWDLYKEELIHNLTGHEGSIFYIQSSEHNKLIASCSDDRSIRLWDRETGKELSI 216

Query: 361 FYGHSQSITSAHWV-DDDTIISTSMDGSIRVWSLASNSTVA-----SATVDG--VPNFTG 412
            + H+  I +  +  +D+ ++S S D + RVW++  N         S   +G  + N  G
Sbjct: 217 GWSHTARIWNLKFFNNDENLVSVSEDCTCRVWNIIPNDISGYELQISNIFEGHLLKNVWG 276

Query: 413 ALSPDQGK-FATGTLDGEVMVYDIQ 436
               D+ +  AT   DG + V D+ 
Sbjct: 277 VDVNDEKRIIATSGNDGRINVIDLN 301

>CAGL0E00561g 49750..52260 some similarities with sp|P16649
           Saccharomyces cerevisiae YCR084c TUP1, hypothetical
           start
          Length = 836

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 60/278 (21%), Positives = 114/278 (41%), Gaps = 43/278 (15%)

Query: 202 WAPAGQSLLTGVESGELRLWSVE-GKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTI 260
           ++P G+ L TG E   +R+W +E  K+  +L  H   I  + +      +++   D    
Sbjct: 563 FSPDGKFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVR 622

Query: 261 VWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPG-IQGSILVFNIGISKPIGKL 319
           +W++ +G      S      E+ +   A      KF   G +  ++ V++      + +L
Sbjct: 623 IWDLKTGQCTLTLSI-----EDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSDTGFLVERL 677

Query: 320 -------RGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSH------------V 360
                   GH  ++ ++ +      ++S S D ++++W   N+N ++             
Sbjct: 678 DSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCEVT 737

Query: 361 FYGHSQSITS-AHWVDDDTIISTSMDGSIRVWSLAS-----------NSTVASATVDGVP 408
           + GH   + S A   DD+ I+S S D  +  W   S           NS ++ A   G P
Sbjct: 738 YTGHKDFVLSVATTEDDEYILSGSKDRGVLFWDKVSGNPLLMLQGHRNSVISVAVNHGHP 797

Query: 409 NFTGALSPDQGKFATGTLDGEVMVYDIQKLLQQLNHNG 446
                L P+   FATG+ D +  ++   K   ++N NG
Sbjct: 798 -----LGPNYHIFATGSGDCKARIWKYIKTTTEVNSNG 830

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 55/249 (22%), Positives = 102/249 (40%), Gaps = 36/249 (14%)

Query: 234 HRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVD------ 287
           H + + C+K+++D    L    +  T ++ V  G  V  FS + A T+++ G D      
Sbjct: 490 HTSVVCCVKFSND-GEFLATGCNKTTQIYRVSDGELVARFSDENAHTDKADGNDNAEAET 548

Query: 288 ------------ATWIDQDKFAIPGIQGSIL-VFNIGISKPIGKLRGHSKTLTTIAYNEH 334
                         +    KF   G +  ++ +++I   K +  L+GH + + ++ Y   
Sbjct: 549 SAGATTDLYIRSVCFSPDGKFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPS 608

Query: 335 NKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDTIIST-SMDGSIRVWS- 392
              L+S S D T+R+W       +          T A    D   I+  S+D ++RVW  
Sbjct: 609 GDKLVSGSGDRTVRIWDLKTGQCTLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDS 668

Query: 393 --------LASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQKLLQQLNH 444
                   L S + + +   D V  ++   + D     +G+LD  V +++    L+ +NH
Sbjct: 669 DTGFLVERLDSENELGTGHKDSV--YSVVFTRDGNGVVSGSLDRSVKLWN----LRNVNH 722

Query: 445 NGYHGTARS 453
           N   G   S
Sbjct: 723 NNADGKPTS 731

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 45/212 (21%), Positives = 83/212 (39%), Gaps = 21/212 (9%)

Query: 177 LWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVE-GKLQNILSYHR 235
           +W+I +  ++     G + ++  L++ P+G  L++G     +R+W ++ G+    LS   
Sbjct: 581 IWDIEQKKIVM-VLKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCTLTLSIED 639

Query: 236 APIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHF-SFKEAGTEESLGVDATWIDQD 294
                     D   +     D    VW+  +G  V+   S  E GT     V +    +D
Sbjct: 640 GVTTVAVSPGDGKFIAAGSLDRAVRVWDSDTGFLVERLDSENELGTGHKDSVYSVVFTRD 699

Query: 295 KFAIPGIQGSI-----------LVFNIGISKPIG-----KLRGHSKTLTTIAYNEHNKLL 338
              +  + GS+           +  N    KP          GH   + ++A  E ++ +
Sbjct: 700 GNGV--VSGSLDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYI 757

Query: 339 LSASDDNTLRVWRGGNLNPSHVFYGHSQSITS 370
           LS S D  +  W   + NP  +  GH  S+ S
Sbjct: 758 LSGSKDRGVLFWDKVSGNPLLMLQGHRNSVIS 789

>YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of
           the WD (WD-40) repeat family that binds to substrates
           (CLB2, CLB3, CDC5, HSL1) of the anaphase promoting
           complex (APC) and targets them for degradation [1701 bp,
           566 aa]
          Length = 566

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 81/183 (44%), Gaps = 18/183 (9%)

Query: 180 ISETVVLADANTGQ-------QNEVTCLEWAPAGQSLLTGVESGELRLWSV-EGKLQNIL 231
           + +++ L D NTG        +NE T L W  AG  L  G  +G + ++ V + K    L
Sbjct: 281 LGKSIFLTDNNTGDVVHLCDTENEYTSLSWIGAGSHLAVGQANGLVEIYDVMKRKCIRTL 340

Query: 232 SYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATW- 290
           S H   + C+ WN+   HVLT  + +  I+   +       F   E+ T+E  G+   W 
Sbjct: 341 SGHIDRVACLSWNN---HVLTSGSRDHRILHRDVR-MPDPFFETIESHTQEVCGLK--WN 394

Query: 291 IDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLS---ASDDNTL 347
           +  +K A  G    + V+      PI     H   +  +A++ H + +L+    + D  L
Sbjct: 395 VADNKLASGGNDNVVHVYEGTSKSPILTFDEHKAAVKAMAWSPHKRGVLATGGGTADRRL 454

Query: 348 RVW 350
           ++W
Sbjct: 455 KIW 457

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 48/229 (20%), Positives = 93/229 (40%), Gaps = 33/229 (14%)

Query: 136 QCVQTFPPGYVSQ-----WNPKHEGVFAYGERDSRAAVVTYSVADGLWNISETVVLADAN 190
           +C++T   G++ +     WN     V   G RD R       + D  +   E+       
Sbjct: 335 KCIRTLS-GHIDRVACLSWN---NHVLTSGSRDHRILHRDVRMPDPFFETIES------- 383

Query: 191 TGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNILSY--HRAPIVCIKWNSDET 248
                EV  L+W  A   L +G     + ++    K   IL++  H+A +  + W+  + 
Sbjct: 384 --HTQEVCGLKWNVADNKLASGGNDNVVHVYEGTSK-SPILTFDEHKAAVKAMAWSPHKR 440

Query: 249 HVLTC---DADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPG---IQ 302
            VL      AD    +WNV   T+++  S  ++G++     +  W       +      +
Sbjct: 441 GVLATGGGTADRRLKIWNV--NTSIK-MSDIDSGSQI---CNMVWSKNTNELVTSHGYSK 494

Query: 303 GSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWR 351
            ++ +++     PI  L+GHS  +  +  +     ++S + D TLR W+
Sbjct: 495 YNLTLWDCNSMDPIAILKGHSFRVLHLTLSNDGTTVVSGAGDETLRYWK 543

>Kwal_27.12239
          Length = 316

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 71/144 (49%), Gaps = 7/144 (4%)

Query: 295 KFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWR--G 352
           K+    +   I+VFN+           HS+ L+ + ++  ++ + +ASDD T+ +     
Sbjct: 30  KYVAICVDVDIVVFNLEDQSSTTFSTLHSRPLSDLCWSPDSQCIATASDDFTIIITHIVF 89

Query: 353 GNLNPSHVFYGHSQSITSAHW-VDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFT 411
           G L   H   GH+  +TS  + +  + + S SMD SI++W + S + + + +    P  +
Sbjct: 90  GEL---HRLVGHTAPVTSVKYTMKGNLLCSCSMDESIKIWDILSGTLLRTLSAHSEPVVS 146

Query: 412 GALSP-DQGKFATGTLDGEVMVYD 434
             L P D    ++G+ DG + ++D
Sbjct: 147 IDLPPFDPSILSSGSYDGLIRIFD 170

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 68/160 (42%), Gaps = 13/160 (8%)

Query: 200 LEWAPAGQSLLTGVESGELRLWS-VEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNM 258
           L W+P  Q + T  +   + +   V G+L  ++  H AP+  +K+      + +C  D  
Sbjct: 64  LCWSPDSQCIATASDDFTIIITHIVFGELHRLVG-HTAPVTSVKYTMKGNLLCSCSMDES 122

Query: 259 TIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGK 318
             +W++LSGT ++  S   A +E  + +D    D    +     G I +F+      +  
Sbjct: 123 IKIWDILSGTLLRTLS---AHSEPVVSIDLPPFDPSILSSGSYDGLIRIFDTATGHCLKT 179

Query: 319 LRGHSK--------TLTTIAYNEHNKLLLSASDDNTLRVW 350
           L              ++ + ++ + K LL  S D  L++W
Sbjct: 180 LTYDKDWQSENGVVPISQVKFSRNGKYLLVKSLDGILKIW 219

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 57/130 (43%), Gaps = 10/130 (7%)

Query: 318 KLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHW--VD 375
           +L GH+  +T++ Y     LL S S D ++++W   +         HS+ + S      D
Sbjct: 94  RLVGHTAPVTSVKYTMKGNLLCSCSMDESIKIWDILSGTLLRTLSAHSEPVVSIDLPPFD 153

Query: 376 DDTIISTSMDGSIRVWSLASNSTVASATVD-------GVPNFTGALSPDQGKF-ATGTLD 427
              + S S DG IR++  A+   + + T D       GV   +       GK+    +LD
Sbjct: 154 PSILSSGSYDGLIRIFDTATGHCLKTLTYDKDWQSENGVVPISQVKFSRNGKYLLVKSLD 213

Query: 428 GEVMVYDIQK 437
           G + ++D  +
Sbjct: 214 GILKIWDFVR 223

>CAGL0L02629g complement(307323..309710) similar to sp|P07834
           Saccharomyces cerevisiae YFL009w CDC4 cell division
           control, hypothetical start
          Length = 795

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 58/245 (23%), Positives = 104/245 (42%), Gaps = 38/245 (15%)

Query: 191 TGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVE-GKLQNILSYHRAPIVCIKWNSDE-- 247
           +G    V  L++A  G  L++G     +R+W++  GK  ++   H + + C+     E  
Sbjct: 406 SGHDGGVWALKYAGNGI-LVSGSTDRSVRIWNIHLGKCTHVFKGHTSTVRCLDIVEHEGV 464

Query: 248 THVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGI--QGSI 305
            +++T   DN   +W +            ++  +E               +P +      
Sbjct: 465 KYIVTGSRDNTLHIWKLPQ--------MSDSNIDE--------------GMPNVYSNNGP 502

Query: 306 LVFNIGISKP--IGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYG 363
           L F+     P  +G LRGH  ++ T++   H ++++S S DN L VW    +   ++  G
Sbjct: 503 LFFHSPEENPYFVGVLRGHIASVRTVS--GHGRIVISGSYDNNLIVWDIIQMKCLYILMG 560

Query: 364 HSQSITSAHW-VDDDTIISTSMDGSIRVWSLA---SNSTVASATVDGVP--NFTGALSPD 417
           H+  I S  +    +  IS SMD +I++W L    +N    + T   VP    TG +   
Sbjct: 561 HTDRIYSTIYDYKRNRCISASMDSTIKIWDLQNIWNNGECVNVTNATVPCTKITGPMMTL 620

Query: 418 QGKFA 422
           QG  A
Sbjct: 621 QGHTA 625

 Score = 30.4 bits (67), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 319 LRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDT 378
           L+GH  ++ T    E N  +++ +DD  +R++            GH   + +  +  +  
Sbjct: 364 LKGHMTSVVTCLQFEDN-YVITGADDKMIRIYDSITKKFLIELSGHDGGVWALKYAGNGI 422

Query: 379 IISTSMDGSIRVWSL 393
           ++S S D S+R+W++
Sbjct: 423 LVSGSTDRSVRIWNI 437

>Kwal_23.6240
          Length = 913

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 74/170 (43%), Gaps = 17/170 (10%)

Query: 234 HRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQ 293
           HR  + C+  N   T +L+ D D   I+ N  + T + HF+FKE  ++     D      
Sbjct: 54  HRKNVQCVALNPQGTLLLSVDEDGRAILVNFRAKTVLHHFNFKEPVSDLKFSPDGK---- 109

Query: 294 DKFAIPGIQGSILVFNIGISK-----PIGKLR---GHSKTLTTIAYNEHNKLLLSASDDN 345
             FAI   +   +     +++     P  + R   GH   + ++ ++  ++ L+S S D 
Sbjct: 110 -VFAIACGRFVQVWKTPDVAEDRQFAPFVRHRVHAGHFSNIISLTWSRDSRFLISTSKDL 168

Query: 346 TLRVWRGGNLNP---SHVFYGHSQSITSAHW-VDDDTIISTSMDGSIRVW 391
           T R+W   +      S  F GH   +  A +  D + I + S DG++  W
Sbjct: 169 TARIWSLDSQEKGLASVTFAGHRDYVMGAFFSADQERIYTVSKDGAVFQW 218

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 49/232 (21%), Positives = 94/232 (40%), Gaps = 34/232 (14%)

Query: 181 SETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSV-EGKLQNILSYHRAPIV 239
           SE+ +L     G  +    + ++P G  ++T  E G++++W V  G        H A + 
Sbjct: 330 SESYILK--QQGHFDATNAVTYSPDGSRVVTASEDGKIKIWDVVSGFCLVTFQEHTAAVS 387

Query: 240 CIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWI-----DQD 294
            + +      + +   D     W+++     + F+  E      L  D +         D
Sbjct: 388 ALAFAKRGQVLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAADPSGEVVCAGSVD 447

Query: 295 KFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGN 354
            FA+        V+++   + +  L GH   ++ +++++ N +L SAS D T+R+W    
Sbjct: 448 SFAVH-------VWSVQTGQLVETLDGHEGPVSCLSFSQENSVLASASWDKTIRIWS--- 497

Query: 355 LNPSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVDG 406
                  +G SQ +       D   +S   DG          + VA+AT+DG
Sbjct: 498 ------IFGRSQQVEPLEVYADVLSLSVRPDG----------NEVAAATLDG 533

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 58/292 (19%), Positives = 115/292 (39%), Gaps = 53/292 (18%)

Query: 194 QNEVTCLEWAPAGQSLLTGVESGELRLWSV-EGKLQNILSYHRAPI--VCIKWNSDETHV 250
           Q  V C+ +     +L+ G  +GE RL+ + E  L   LS  +  +  VC+  +S E   
Sbjct: 256 QARVKCVTFHANSNTLVVGFNNGEFRLYELPEFTLIQQLSMGQNAVNTVCVN-DSGEWLA 314

Query: 251 LTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNI 310
                    +V+   S    + +  K+ G  ++        D  +       G I ++++
Sbjct: 315 FGSSKLGQLLVYEWQS----ESYILKQQGHFDATNAVTYSPDGSRVVTASEDGKIKIWDV 370

Query: 311 GISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW---RGGNL------------ 355
                +   + H+  ++ +A+ +  ++L SAS D T+R W   R  N             
Sbjct: 371 VSGFCLVTFQEHTAAVSALAFAKRGQVLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFN 430

Query: 356 ----NPS--------------HVFY-----------GHSQSITSAHWVDDDTII-STSMD 385
               +PS              HV+            GH   ++   +  +++++ S S D
Sbjct: 431 CLAADPSGEVVCAGSVDSFAVHVWSVQTGQLVETLDGHEGPVSCLSFSQENSVLASASWD 490

Query: 386 GSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQK 437
            +IR+WS+   S             + ++ PD  + A  TLDG+++ +D+ +
Sbjct: 491 KTIRIWSIFGRSQQVEPLEVYADVLSLSVRPDGNEVAAATLDGQILFFDVHE 542

>Scas_397.2
          Length = 410

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 57/109 (52%), Gaps = 1/109 (0%)

Query: 302 QGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVF 361
           +GSI +++   S    +   H   +TT+ +    +++LS S D  L++W   + +   +F
Sbjct: 118 EGSISLYDSQFSHEWTQEDAHCSEITTLKFFPSGEVVLSGSSDMQLKLWSIKDASCPRIF 177

Query: 362 YGHSQSITSAHWVDD-DTIISTSMDGSIRVWSLASNSTVASATVDGVPN 409
            GH+  IT +  ++     +S+S+DG++++W   S STV +      PN
Sbjct: 178 RGHTSKITDSVLIERGRDFVSSSLDGTMKLWECGSGSTVRTFMRRENPN 226

 Score = 37.4 bits (85), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 44/87 (50%), Gaps = 7/87 (8%)

Query: 195 NEVTCLEWAPAGQSLLTGVESGELRLWSV-EGKLQNILSYHRAPI---VCIKWNSDETHV 250
           +E+T L++ P+G+ +L+G    +L+LWS+ +     I   H + I   V I+   D    
Sbjct: 140 SEITTLKFFPSGEVVLSGSSDMQLKLWSIKDASCPRIFRGHTSKITDSVLIERGRD---F 196

Query: 251 LTCDADNMTIVWNVLSGTAVQHFSFKE 277
           ++   D    +W   SG+ V+ F  +E
Sbjct: 197 VSSSLDGTMKLWECGSGSTVRTFMRRE 223

>YMR116C (ASC1) [4073] chr13
           complement(499455..499877,500151..500687) Ribosomal
           protein of the 40S ribosomal subunit that influences
           translational efficiency and cell size, contains two WD
           (WD-40) repeats [960 bp, 319 aa]
          Length = 319

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 77/299 (25%), Positives = 127/299 (42%), Gaps = 40/299 (13%)

Query: 181 SETVVLADANTGQQNEVTCLEWAPAGQS--LLTGVESGELRLWSVEGKLQNI------LS 232
           +E +VL     G    VT L    AGQ   LL+      L  W + G  Q          
Sbjct: 4   NEVLVLRGTLEGHNGWVTSLA-TSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFK 62

Query: 233 YHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWID 292
            H   +      +D  + L+   D    +W+V +G   Q F   ++        D   +D
Sbjct: 63  GHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKS--------DVMSVD 114

Query: 293 QDKFAIPGIQGS----ILVFNIGISKPIGKLRGHSKTLTTIAYNEHNK------LLLSAS 342
            DK A   I GS    I V+ I   + +  L GH+  ++ +    + K       ++SA 
Sbjct: 115 IDKKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAG 173

Query: 343 DDNTLRVWRGGNLNPSHV---FYGHSQSITSAHWVDDDTIISTS-MDGSIRVWSLASNST 398
           +D  ++ W   NLN   +   F GH+ +I +     D T+I+++  DG I +W+LA+   
Sbjct: 174 NDKMVKAW---NLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKA 230

Query: 399 VASATV-DGVPNFTGALSPDQGKFATGTLDG-EVMVYDIQKLLQQLNHNGYHGTARSAE 455
           + + +  D V  F+ A SP++   A  T  G +V   D Q L+  L    + G +++AE
Sbjct: 231 MYTLSAQDEV--FSLAFSPNRYWLAAATATGIKVFSLDPQYLVDDLRPE-FAGYSKAAE 286

>CAGL0M04279g 469040..471862 highly similar to sp|Q12220
           Saccharomyces cerevisiae YLR129w DIP2 DOM34P-interacting
           protein, start by similarity
          Length = 940

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/231 (22%), Positives = 98/231 (42%), Gaps = 20/231 (8%)

Query: 177 LWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGK--LQNILSYH 234
           +WNI     +     G    +TC ++ P G  ++ G  +GEL+L+ +     L N    H
Sbjct: 413 IWNIKTKRCIRSFECGYA--LTC-KFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAH 469

Query: 235 RAPIVCIKWNSDETHVLTCDADNMTIVWNV------LSGTAVQHFSFKEAGTEESLGVDA 288
            A I  +   SD   ++T  AD     W        +S  + +     +   + +L +D 
Sbjct: 470 DAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDD 529

Query: 289 TWID-----QDKF-AIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSAS 342
             +       DKF A+  +  ++ VF +   K    L GH   + ++  +  +KL+++ S
Sbjct: 530 DILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCS 589

Query: 343 DDNTLRVWRGGNLNPSH-VFYGHSQSITSAHWVDDD-TIISTSMDGSIRVW 391
            D  +++W G +    H   + H  SI +  ++ +     S S D +++ W
Sbjct: 590 ADKNIKIW-GLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYW 639

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 49/99 (49%)

Query: 303 GSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFY 362
           G I ++++     +    GH   +T +A++     L+SAS D+ + VW     +  +   
Sbjct: 101 GVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLR 160

Query: 363 GHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVAS 401
            H  +IT     D++ +ISTS DG +++W L S   V +
Sbjct: 161 SHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVET 199

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 56/130 (43%), Gaps = 7/130 (5%)

Query: 361 FYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGK 420
            +G    I S    DD+ +++T+ +GS+++W++ +   + S         T    P    
Sbjct: 384 LHGQRTDIRSTSISDDNKLLATASNGSLKIWNIKTKRCIRSFECGYA--LTCKFLPGGAL 441

Query: 421 FATGTLDGEVMVYDIQKLLQQLNHNGYHGTARSAEVARIPVVGDHRSAREGNYVTQIS-W 479
              GT +GE+ ++DI       N  G H  A    +  + +  D R    G+    +  W
Sbjct: 442 VVVGTRNGELQLFDIASSTMLDNKEGAHDAA----IWSLDLTSDGRKLVTGSADKTVRFW 497

Query: 480 SQESTQLSVS 489
           + E +++ VS
Sbjct: 498 TFEVSEVPVS 507

 Score = 37.7 bits (86), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 39/208 (18%), Positives = 79/208 (37%), Gaps = 49/208 (23%)

Query: 187 ADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNI-LSYHRAPIVCIKWNS 245
           +DA   +  E T L++ P    L  G   G +++W +  K   I  + H++ I  + +++
Sbjct: 72  SDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDT 131

Query: 246 DETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSI 305
             T +++   D+  IVW+++           E+G                          
Sbjct: 132 TGTRLISASKDSDIIVWDLVG----------ESG-------------------------- 155

Query: 306 LVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHS 365
                     + KLR H   +T + + E    L+S S D  +++W   +         H+
Sbjct: 156 ----------LYKLRSHKDAITGL-WCEDENWLISTSKDGLVKIWDLKSQQCVETHLAHT 204

Query: 366 QSITSAHWVDDDTIISTSMDGSIRVWSL 393
               S   + +D  ++ S D  +++W L
Sbjct: 205 GECWSLGII-EDMAVTCSADSQVKLWKL 231

>AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -
           NSH] complement(667539..669809) [2271 bp, 756 aa]
          Length = 756

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 91/218 (41%), Gaps = 25/218 (11%)

Query: 197 VTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNI-LSYHRAPIVCIKWNSDETHVLTCDA 255
           VTC ++   G  ++TG +   + ++  + +   + L  H   +  +K+  DE  +++   
Sbjct: 370 VTCFQFE--GNYIITGADDKRINVYDADREQFKLELVGHEGGVWALKYAGDEI-LVSGST 426

Query: 256 DNMTIVWNVLSGTA----------------VQHFSFKEAGTEESLGVDATWIDQDKFAIP 299
           D    +WNV +G                  V+H   K   T         W   D  +  
Sbjct: 427 DRTVRIWNVKAGKCTHVFRGHTSTVRCLDVVEHGGIKYVVTGSRDNTLHVWKLPDPNSPD 486

Query: 300 GIQGSILVFNIGISKP--IGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNP 357
               ++  FN     P  +G LRGH  ++ T++   H  +++S S D+ L VW    +  
Sbjct: 487 YNPNAMRQFNSIEDNPFFVGVLRGHMASVRTVS--GHGNIVVSGSYDHNLMVWDIAKMKL 544

Query: 358 SHVFYGHSQSITSAHWVDD-DTIISTSMDGSIRVWSLA 394
            +V  GH+  I S  +       IS SMD +++VW L+
Sbjct: 545 LYVLTGHTDRIYSTLYDHKRKRCISASMDTTVKVWDLS 582

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 62/142 (43%), Gaps = 22/142 (15%)

Query: 318 KLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDD 377
           +L GH   +  + Y   +++L+S S D T+R+W       +HVF GH+ ++     V+  
Sbjct: 402 ELVGHEGGVWALKY-AGDEILVSGSTDRTVRIWNVKAGKCTHVFRGHTSTVRCLDVVEHG 460

Query: 378 TI---ISTSMDGSIRVWSLAS--------NSTVASATVDGVPNFTGALSPDQGKFAT--- 423
            I   ++ S D ++ VW L          N+     +++  P F G L        T   
Sbjct: 461 GIKYVVTGSRDNTLHVWKLPDPNSPDYNPNAMRQFNSIEDNPFFVGVLRGHMASVRTVSG 520

Query: 424 -------GTLDGEVMVYDIQKL 438
                  G+ D  +MV+DI K+
Sbjct: 521 HGNIVVSGSYDHNLMVWDIAKM 542

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/235 (20%), Positives = 98/235 (41%), Gaps = 37/235 (15%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWSVE-GKLQNILSYHRAPIVCIKW--NSDET 248
           G +  V  L++A   + L++G     +R+W+V+ GK  ++   H + + C+    +    
Sbjct: 405 GHEGGVWALKYA-GDEILVSGSTDRTVRIWNVKAGKCTHVFRGHTSTVRCLDVVEHGGIK 463

Query: 249 HVLTCDADNMTIVWNV-------LSGTAVQHFS------FKEAGTEESLGVDATWIDQDK 295
           +V+T   DN   VW +        +  A++ F+      F        +    T      
Sbjct: 464 YVVTGSRDNTLHVWKLPDPNSPDYNPNAMRQFNSIEDNPFFVGVLRGHMASVRTVSGHGN 523

Query: 296 FAIPG-IQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGN 354
             + G    +++V++I   K +  L GH+  + +  Y+   K  +SAS D T++VW   +
Sbjct: 524 IVVSGSYDHNLMVWDIAKMKLLYVLTGHTDRIYSTLYDHKRKRCISASMDTTVKVWDLSD 583

Query: 355 LNPS------------------HVFYGHSQSITSAHWVDDDTIISTSMDGSIRVW 391
           +N +                      GH+ ++     + D  ++S + DGS+R W
Sbjct: 584 INNNGPVSQINSTSALKVSGSVRTLCGHT-ALVGLLGLSDKYLVSAAADGSLRGW 637

>Kwal_47.17555
          Length = 417

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 56/117 (47%), Gaps = 1/117 (0%)

Query: 286 VDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDN 345
           +D    D D     G QG I+      ++    L GH   +T + +    ++LLS S D 
Sbjct: 111 IDQYESDGDYLYATGDQGGIISIYDSQAEVTRTLEGHYAEITDVKFFPSGEVLLSGSADM 170

Query: 346 TLRVWRGGNLNPSHVFYGHSQSITSAHWVD-DDTIISTSMDGSIRVWSLASNSTVAS 401
            L+VW   + +      GH+ ++T+   +D    ++S+S DGS+++W   S  T+ S
Sbjct: 171 QLKVWSTLDGSNPRTLKGHTSTVTALGIIDRGRNVMSSSKDGSLKLWECGSGETIHS 227

 Score = 37.7 bits (86), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 42/86 (48%), Gaps = 1/86 (1%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWS-VEGKLQNILSYHRAPIVCIKWNSDETHV 250
           G   E+T +++ P+G+ LL+G    +L++WS ++G     L  H + +  +       +V
Sbjct: 146 GHYAEITDVKFFPSGEVLLSGSADMQLKVWSTLDGSNPRTLKGHTSTVTALGIIDRGRNV 205

Query: 251 LTCDADNMTIVWNVLSGTAVQHFSFK 276
           ++   D    +W   SG  +  F+ K
Sbjct: 206 MSSSKDGSLKLWECGSGETIHSFARK 231

 Score = 33.1 bits (74), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 26/43 (60%)

Query: 319 LRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVF 361
           L+GH+ T+T +   +  + ++S+S D +L++W  G+    H F
Sbjct: 186 LKGHTSTVTALGIIDRGRNVMSSSKDGSLKLWECGSGETIHSF 228

>Scas_631.17
          Length = 474

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 64/130 (49%), Gaps = 1/130 (0%)

Query: 309 NIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSI 368
           ++ I K +  L+GH+  +  + ++   + + SAS D T R+W   +        GH + +
Sbjct: 261 DVKIIKELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQEGHGKEV 320

Query: 369 TSAHWVDDDTII-STSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLD 427
            S  + +D  ++ S  +D +  VW + +  ++ +      P ++   SPD    ATG  D
Sbjct: 321 YSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGGGD 380

Query: 428 GEVMVYDIQK 437
           G + ++DI+K
Sbjct: 381 GVINIWDIRK 390

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 67/176 (38%), Gaps = 5/176 (2%)

Query: 177 LWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVE-GKLQNILSYHR 235
           LW+I     L     G   EV  L +   G  L +G       +W V  GK    L  H 
Sbjct: 301 LWDIESETELQ-FQEGHGKEVYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHA 359

Query: 236 APIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDK 295
            PI  + W+ D  H+ T   D +  +W++   T         A      GV         
Sbjct: 360 KPIYSVDWSPDGYHIATGGGDGVINIWDIRKTTETTRLL---AHNNIVTGVRFQKSTGHC 416

Query: 296 FAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWR 351
               G    I +++      +  L GH+  +  +  +E  +L++S+  D +L++W+
Sbjct: 417 LVSCGYDKQIRIYSSDNWIQVKTLEGHTDKILDVDISEDAQLIVSSGWDRSLKLWK 472

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 41/229 (17%), Positives = 97/229 (42%), Gaps = 13/229 (5%)

Query: 185 VLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNI-----LSYHRAPIV 239
           V++    G   ++  L W      L++G +   +++ S +  ++ I     L  H   +V
Sbjct: 220 VISGIENGHDGKIGGLAWNSTNTHLVSGADDCLVKIHSFDPDVKIIKELTALQGHTGRVV 279

Query: 240 CIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIP 299
            + ++     V +   D    +W++ S T +Q   F+E   +E   + +   D       
Sbjct: 280 NVDFHPSGRFVASASFDMTWRLWDIESETELQ---FQEGHGKEVYSL-SFQNDGALLCSG 335

Query: 300 GIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSH 359
           G+  + +V+++   K I  L+GH+K + ++ ++     + +   D  + +W       + 
Sbjct: 336 GLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGGGDGVINIWDIRKTTETT 395

Query: 360 VFYGHSQSITSAHWVDD--DTIISTSMDGSIRVWSLASNSTVASATVDG 406
               H+  +T   +       ++S   D  IR++S  S++ +   T++G
Sbjct: 396 RLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYS--SDNWIQVKTLEG 442

>Kwal_23.5769
          Length = 627

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 62/272 (22%), Positives = 115/272 (42%), Gaps = 58/272 (21%)

Query: 209 LLTGVESGELRLWSVE-GKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSG 267
           L TG     + +W +  GKL   L+ HR  +  I +  D   ++T   D M  VWN ++G
Sbjct: 330 LFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF--DGQKLITGSLDRMIRVWNYVTG 387

Query: 268 TAVQHFSFKEAGTEESLGVDATWIDQDKFAIPG-IQGSILVFNIGISKPIGKLRGHSKTL 326
             V  +      ++  L VD+      K  + G    ++ V+++  S+    LRGH++ +
Sbjct: 388 ACVAAYP---GHSDSVLSVDSY----KKIIVSGSADKTVKVWHVE-SRTCYTLRGHTEWV 439

Query: 327 TTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGH---------------------- 364
            T+  +  +    S SDD T+R+W   +     VF GH                      
Sbjct: 440 GTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDR 499

Query: 365 ------SQSITSAHWVD------DDT------IISTSMDGSIRVWSLASNSTVAS--ATV 404
                 +++ T+    D      DD+      ++S S+D +I++W + +   V +    V
Sbjct: 500 TSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHV 559

Query: 405 DGVPNFTGALSPDQGKFATGTLDGEVMVYDIQ 436
           +G+ +    ++ D  +  +G  D  V V+D+Q
Sbjct: 560 EGIWD----IAADNFRIVSGAHDKTVKVWDLQ 587

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 84/199 (42%), Gaps = 24/199 (12%)

Query: 209 LLTGVESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGT 268
           +++G     +++W VE +    L  H   +  +K +       +   D    +W++ S T
Sbjct: 410 IVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNT 469

Query: 269 AVQHFSFKEAGTEESLGV---DATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKT 325
            V+ F       ++ L +   D   +  D+ + P    +    +     P G+L     +
Sbjct: 470 CVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDPPRNEATTAQD----PPDGQLSALDDS 525

Query: 326 LTTIAYNEHNKLLLSASDDNTLRVW--RGGNLNPSHVFYGHSQSITSAHW---VDDDTII 380
           L    Y  H   LLS S DNT+++W  R G    +H  +GH + I    W    D+  I+
Sbjct: 526 L---PYPSH---LLSCSLDNTIKLWEVRTGKCVRTH--FGHVEGI----WDIAADNFRIV 573

Query: 381 STSMDGSIRVWSLASNSTV 399
           S + D +++VW L S   +
Sbjct: 574 SGAHDKTVKVWDLQSGKCI 592

>CAGL0C00737g complement(75028..77478) similar to tr|Q05946
           Saccharomyces cerevisiae YLR222c, hypothetical start
          Length = 816

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 58/121 (47%), Gaps = 3/121 (2%)

Query: 296 FAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNL 355
           FA      +  ++N+   +P+  L  H + L  +++ E  K + + S D T+++W   + 
Sbjct: 510 FATASYDKTCKLWNVDTGEPVATLANHKRGLWDVSFCESEKWIATCSGDKTVKIWSLESF 569

Query: 356 NPSHVFYGHSQSITSAHWVDDDT-IISTSMDGSIRVWSLASNSTVASATVDGVPNFTGAL 414
                  GH+ ++    +++    ++S   DG I+VW +AS   + +  +DG  N   AL
Sbjct: 570 TVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVWDIASGDCIKN--LDGHSNRIWAL 627

Query: 415 S 415
           S
Sbjct: 628 S 628

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/187 (20%), Positives = 75/187 (40%), Gaps = 12/187 (6%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWSVE-GKLQNILSYHRAPIVCIKWNSDETHV 250
             + ++  +  AP      T       +LW+V+ G+    L+ H+  +  + +   E  +
Sbjct: 493 AHEKDINAISMAPNDSIFATASYDKTCKLWNVDTGEPVATLANHKRGLWDVSFCESEKWI 552

Query: 251 LTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNI 310
            TC  D    +W++ S T ++         +    ++     Q +    G  G I V++I
Sbjct: 553 ATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSFMNK----QKQLVSAGADGLIKVWDI 608

Query: 311 GISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRG-------GNLNPSHVFYG 363
                I  L GHS  +  ++  E   L++SA  D+  + W+        G L  + V   
Sbjct: 609 ASGDCIKNLDGHSNRIWALSVLEDGDLIISADADSVFQFWKDCTEAEIQGALEENKVRVE 668

Query: 364 HSQSITS 370
             QS+T+
Sbjct: 669 QEQSLTN 675

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/144 (22%), Positives = 63/144 (43%), Gaps = 5/144 (3%)

Query: 295 KFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGN 354
           K+ IP ++  +      +   I     H K +  I+   ++ +  +AS D T ++W    
Sbjct: 467 KWEIPPMKNDLNEVPFIVKSSIYTRHAHEKDINAISMAPNDSIFATASYDKTCKLWNVDT 526

Query: 355 LNPSHVFYGHSQSITSAHWVDDDTIIST-SMDGSIRVWSLASNSTVASATVDGVPNFTGA 413
             P      H + +    + + +  I+T S D ++++WSL S + +   T++G  N    
Sbjct: 527 GEPVATLANHKRGLWDVSFCESEKWIATCSGDKTVKIWSLESFTVL--KTLEGHTNAVQR 584

Query: 414 LS--PDQGKFATGTLDGEVMVYDI 435
            S    Q +  +   DG + V+DI
Sbjct: 585 CSFMNKQKQLVSAGADGLIKVWDI 608

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 38/83 (45%), Gaps = 10/83 (12%)

Query: 321 GHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFY----GHSQSITSAHWVD- 375
           GHS  L ++A  E  + L +AS D T  +W   N +     Y    GH+ S+++    + 
Sbjct: 388 GHSDLLNSLACTEDGQWLATASKDKTAILWHWNNTSKRFYIYATFVGHAASVSAVCLPNV 447

Query: 376 -----DDTIISTSMDGSIRVWSL 393
                   II+ S D +++ W +
Sbjct: 448 MEKNYPKYIITASNDLTVKKWEI 470

>KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomyces
           cerevisiae YLR222c, start by similarity
          Length = 814

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 65/136 (47%), Gaps = 5/136 (3%)

Query: 296 FAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNL 355
           FA      +  ++N+   +    L  H + L  +A+ +++KLL + S D T+++W   + 
Sbjct: 510 FATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSGDKTIKIWSLESY 569

Query: 356 NPSHVFYGHSQSITSAHWVDDDT-IISTSMDGSIRVWSLASNSTVASATVDGVPNFTGAL 414
                  GH+ ++    +++ +  +IST  DG + +W L++  +V   T+D   N   AL
Sbjct: 570 AVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESV--KTLDAHNNRIWAL 627

Query: 415 S--PDQGKFATGTLDG 428
           +   D   F T   DG
Sbjct: 628 AVMNDGESFVTADADG 643

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 59/120 (49%), Gaps = 7/120 (5%)

Query: 320 RGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDTI 379
           R H K +  I+ + ++ L  +AS D T ++W   +         H + +    +   D +
Sbjct: 492 RAHEKDINAISISPNDSLFATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKL 551

Query: 380 IST-SMDGSIRVWSLASNSTVASATVDGVPNFTGALS---PDQGKFATGTLDGEVMVYDI 435
           ++T S D +I++WSL S + V   T++G  N     S    ++   +TG  DG V+++D+
Sbjct: 552 LATCSGDKTIKIWSLESYAVV--KTLEGHTNAVQRCSFINKNKQLISTGA-DGLVIIWDL 608

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 25/162 (15%), Positives = 67/162 (41%), Gaps = 7/162 (4%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWSVE-GKLQNILSYHRAPIVCIKWNSDETHV 250
             + ++  +  +P      T       ++W+++ G+ Q  L+ H+  +  + +   +  +
Sbjct: 493 AHEKDINAISISPNDSLFATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLL 552

Query: 251 LTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIP-GIQGSILVFN 309
            TC  D    +W++ S   V+         +       ++I+++K  I  G  G +++++
Sbjct: 553 ATCSGDKTIKIWSLESYAVVKTLEGHTNAVQR-----CSFINKNKQLISTGADGLVIIWD 607

Query: 310 IGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWR 351
           +   + +  L  H+  +  +A     +  ++A  D     WR
Sbjct: 608 LSTGESVKTLDAHNNRIWALAVMNDGESFVTADADGFFEFWR 649

>CAGL0E02805g complement(265137..267659) similar to sp|P32479
           Saccharomyces cerevisiae YBL008w HIR1 histone
           transcription regulator, start by similarity
          Length = 840

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/185 (21%), Positives = 78/185 (42%), Gaps = 31/185 (16%)

Query: 196 EVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNI----------------LSYHRAPIV 239
           E+  ++ +P G+ + TG   G++R+WSV+  +                   +S H   + 
Sbjct: 19  EIYTVDVSPDGKRVATGGLDGKIRIWSVDALVSAAAGESGVDRDTHRPLASMSRHTGSVT 78

Query: 240 CIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGV------------D 287
           C+K++ D  ++ +   D + ++W +         SF   G +E   V            D
Sbjct: 79  CVKFSPDGNYLASGSDDRILLIWAM--DEENHGGSFGSEGEKEHWTVRKRLVAHDNDIQD 136

Query: 288 ATWI-DQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNT 346
             W  D       G+  S++V+N    + + +   H   +  + ++  NK   +ASDD T
Sbjct: 137 ICWAPDSSILVTVGLDRSVIVWNGLNFERLKRFDVHQSLVKGVIFDPANKYFATASDDRT 196

Query: 347 LRVWR 351
           +RV+R
Sbjct: 197 MRVFR 201

 Score = 37.4 bits (85), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 41/196 (20%), Positives = 70/196 (35%), Gaps = 38/196 (19%)

Query: 314 KPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW------RGGNLNPS--------- 358
           +P+  +  H+ ++T + ++     L S SDD  L +W       GG+             
Sbjct: 65  RPLASMSRHTGSVTCVKFSPDGNYLASGSDDRILLIWAMDEENHGGSFGSEGEKEHWTVR 124

Query: 359 HVFYGHSQSITSAHWVDDDTIIST-SMDGSIRVWS-----LASNSTVASATVDGVPNFTG 412
                H   I    W  D +I+ T  +D S+ VW+           V  + V GV     
Sbjct: 125 KRLVAHDNDIQDICWAPDSSILVTVGLDRSVIVWNGLNFERLKRFDVHQSLVKGV----- 179

Query: 413 ALSPDQGKFATGTLDGEVMVYDIQKLLQQLNHNGYHGTARSAEVARIPVVGDHRSAREGN 472
              P    FAT + D  + V+             YH T   +      +V    ++    
Sbjct: 180 IFDPANKYFATASDDRTMRVFR------------YHKTGEVSFTIEQVIVEPFIASPLTT 227

Query: 473 YVTQISWSQESTQLSV 488
           Y  ++SWS +   ++V
Sbjct: 228 YFRRLSWSPDGQHIAV 243

>KLLA0D07546g complement(647984..649927) some similarities with
           sp|P07834 Saccharomyces cerevisiae YFL009w CDC4 cell
           division control protein, hypothetical start
          Length = 647

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 41/192 (21%), Positives = 88/192 (45%), Gaps = 32/192 (16%)

Query: 206 GQSLLTGVESGELRLWSVE-GKLQNILSYHRAPIVCIKW--NSDETHVLTCDADNMTIVW 262
           G+ L++G     +R+W++E GK  ++   H + + C++     D  +++T   DN   VW
Sbjct: 311 GKILVSGSTDRSVRIWNIETGKCTHVFKGHTSTVRCLEVVEYGDSKYIVTGSRDNTLHVW 370

Query: 263 NVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGH 322
            +     +      + G++E +       +++ + +                  G LRGH
Sbjct: 371 KLPPMKEL------DKGSQEPIFYRTP--EENPYFV------------------GVLRGH 404

Query: 323 SKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHW-VDDDTIIS 381
             ++ T++   H ++++S S D+ L VW   ++   ++  GH+  + S  +    +  IS
Sbjct: 405 MSSVRTVS--GHGRIVISGSYDHNLMVWDIISMKLLYILTGHTDRVYSTIYDYKRNRCIS 462

Query: 382 TSMDGSIRVWSL 393
            SMD ++ +W L
Sbjct: 463 ASMDTTVMIWDL 474

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 63/148 (42%), Gaps = 24/148 (16%)

Query: 318 KLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWV--- 374
           +L GH   +  + + +  K+L+S S D ++R+W       +HVF GH+ ++     V   
Sbjct: 295 ELNGHEGGVWALKFVD-GKILVSGSTDRSVRIWNIETGKCTHVFKGHTSTVRCLEVVEYG 353

Query: 375 DDDTIISTSMDGSIRVWSL--------ASNSTVASATVDGVPNFTGALSPDQGKFAT--- 423
           D   I++ S D ++ VW L         S   +   T +  P F G L        T   
Sbjct: 354 DSKYIVTGSRDNTLHVWKLPPMKELDKGSQEPIFYRTPEENPYFVGVLRGHMSSVRTVSG 413

Query: 424 -------GTLDGEVMVYDI--QKLLQQL 442
                  G+ D  +MV+DI   KLL  L
Sbjct: 414 HGRIVISGSYDHNLMVWDIISMKLLYIL 441

>KLLA0F04884g complement(478044..481682) similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 coatomer complex
           alpha chain of secretory pathway vesicles, start by
           similarity
          Length = 1212

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 64/135 (47%), Gaps = 5/135 (3%)

Query: 261 VWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLR 320
           +W+   G  +  F   E       G+D     Q  F   G   +I V+++  +K +  L 
Sbjct: 37  LWDYRMGVLLHRFEDHEGPVR---GIDFHPT-QPLFVSAGDDYTIKVWSLESNKCLFTLD 92

Query: 321 GHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVD-DDTI 379
           GH   + T+ ++     ++S+SDD T+R+W   N        GH+  +  A +   +D +
Sbjct: 93  GHLDYVRTVFFHHELPWIISSSDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPVEDLV 152

Query: 380 ISTSMDGSIRVWSLA 394
           +S S+D ++RVW ++
Sbjct: 153 VSASLDETVRVWDIS 167

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/195 (21%), Positives = 87/195 (44%), Gaps = 20/195 (10%)

Query: 209 LLTGVESGELRLWSVEGKLQ-NILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSG 267
           +++  +   +R+W+ + + +   L+ H   ++C +++  E  V++   D    VW++ SG
Sbjct: 110 IISSSDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPVEDLVVSASLDETVRVWDI-SG 168

Query: 268 TAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLT 327
              +H +      EE +      +D       G  G  +V  I        L GH++ + 
Sbjct: 169 LRKRHSAPGTQSFEEQMRQQQNLLD-------GGFGDCVVKFI--------LEGHTRGVN 213

Query: 328 TIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHV--FYGHSQSITSAHW-VDDDTIISTSM 384
             +++    L++S SDD  +++WR        V    GH+ ++ S  +    + IIS   
Sbjct: 214 WASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPQQNLIISVGE 273

Query: 385 DGSIRVWSLASNSTV 399
           D ++RVW L   + +
Sbjct: 274 DKTVRVWDLDKRTPI 288

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 55/127 (43%), Gaps = 1/127 (0%)

Query: 316 IGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVD 375
           + +   H   +  I ++    L +SA DD T++VW   +        GH   + +  +  
Sbjct: 46  LHRFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVWSLESNKCLFTLDGHLDYVRTVFFHH 105

Query: 376 DDT-IISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYD 434
           +   IIS+S D +IR+W+  +   +A  T            P +    + +LD  V V+D
Sbjct: 106 ELPWIISSSDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPVEDLVVSASLDETVRVWD 165

Query: 435 IQKLLQQ 441
           I  L ++
Sbjct: 166 ISGLRKR 172

>KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomyces
           cerevisiae YPL183c, start by similarity
          Length = 990

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 1/93 (1%)

Query: 301 IQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHV 360
           I   I+V+ +   K I  LRGH  ++  +  + + KLL S SDD ++ +W   +      
Sbjct: 159 IMNGIIVWELDSKKKIHTLRGHEGSIFYVTTSNNGKLLASCSDDRSIIIWDMVSGKLLSR 218

Query: 361 FYGHSQSITSAHWVDDDT-IISTSMDGSIRVWS 392
            +GH+  I +  + +DDT +IS S D + RVW+
Sbjct: 219 AWGHTARIWNLKFFNDDTQLISVSEDCTCRVWN 251

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 48/98 (48%), Gaps = 10/98 (10%)

Query: 304 SILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGN--LNPSHVF 361
           SI+++++   K + +  GH+  +  + +   +  L+S S+D T RVW   N  L    +F
Sbjct: 204 SIIIWDMVSGKLLSRAWGHTARIWNLKFFNDDTQLISVSEDCTCRVWNYKNDELTIKDIF 263

Query: 362 YGHSQSITSAHW---VDDDTIISTS--MDGSIRVWSLA 394
             H   +T   W   V++  +I+ S   DG ++V  L 
Sbjct: 264 ESH---LTKNVWGVDVEETNLIAISGGNDGRLKVTELV 298

>CAGL0J01287g 120215..122047 similar to sp|P46680 Saccharomyces
           cerevisiae YMR092c AIP1, hypothetical start
          Length = 610

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 55/125 (44%), Gaps = 4/125 (3%)

Query: 246 DETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSI 305
           DET  +T  AD    VW+V     +  ++  E  T +   +       D+     + G++
Sbjct: 263 DETRFVTASADQKVRVWDVRESKCLHSWTIGEPNTLQQQQIGVVAAKDDQIISLSLDGTL 322

Query: 306 LVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHS 365
               IG  KP+  + GH+K++T +A N     L++ S D  +  W    +  S +  GH+
Sbjct: 323 NFLKIGEDKPVRTMHGHNKSITALAVNP----LVTGSYDGRIMQWVPEKICDSKMQTGHT 378

Query: 366 QSITS 370
             + S
Sbjct: 379 NLVVS 383

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 50/242 (20%), Positives = 94/242 (38%), Gaps = 32/242 (13%)

Query: 191 TGQQNEVTCLEWAPAGQSLLTGVESGELRLWS--------VEGKLQNILSYHRAPIVCIK 242
           TG    V+ + +AP G  + +G ESG++ +WS        VE  ++        P+  I 
Sbjct: 64  TGHGANVSVVRFAPVGAYMCSGDESGKVIVWSWNRDGDGGVECVVKAEFQVLAGPVTDIS 123

Query: 243 WNSDETHVLTC----DADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDK--- 295
           W+ +   +       D   + I W+  +G ++         T  S  V+A  I Q +   
Sbjct: 124 WDFEGKRLCVVGEGRDKFGVFISWD--TGNSLGEV------TAHSSRVNAVHIKQSRPMR 175

Query: 296 FAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNK----LLLSASDDNTLRVWR 351
               G  G+++ +     K +   R H      +   E +K      ++   D  +  + 
Sbjct: 176 CITVGDDGTVVFYQGPPFKFVSSDRTHHDKGKFVRDVEFSKGAGEFAVTVGSDRKIACFD 235

Query: 352 GGNLNPSHVFYGHSQSIT----SAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVDGV 407
           G +           + IT    +  W+D+   ++ S D  +RVW +  +  + S T+ G 
Sbjct: 236 GKSGEFVKYIEDADEPITGGLFAVSWLDETRFVTASADQKVRVWDVRESKCLHSWTI-GE 294

Query: 408 PN 409
           PN
Sbjct: 295 PN 296

 Score = 30.0 bits (66), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 22/102 (21%), Positives = 43/102 (42%), Gaps = 5/102 (4%)

Query: 296 FAIPGIQGSILVFNIGISKPIGKLR--GHSKTLTTIAYN-EHNKLLLSASDDNTLRVWR- 351
            A+  + G I+++++  +K +   R   H+  +  I++  E   L+ + S D  + V+  
Sbjct: 508 LAVGDVMGKIILYDLE-TKTVKTSRWAFHTSKINAISWRPEEEDLVATGSLDTHIIVYSV 566

Query: 352 GGNLNPSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSL 393
              +    V   H   + +  W D D I+S   D  I  W  
Sbjct: 567 SKPMRTVKVLNAHKDGVNAVQWKDRDHIVSAGADACIHTWKF 608

>Scas_630.6
          Length = 621

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 55/266 (20%), Positives = 113/266 (42%), Gaps = 41/266 (15%)

Query: 202 WAPAGQSLLTGVESGELRLWSV-EGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTI 260
           ++P G+ L TG E   +R+W++ E K+  +L  H   I  + +  D   +++   D    
Sbjct: 349 FSPDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSGDRSIR 408

Query: 261 VWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKL- 319
           +W++ +G      S ++  T  ++  +   +     A   +  S+ +++      + +L 
Sbjct: 409 IWDLKTGQCSLTLSIEDGVTTVAVSPNEGKL----IAAGSLDRSVRIWDSSTGFLVERLD 464

Query: 320 ------RGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSH-----VFYGHSQSI 368
                  GH  ++ ++A+ +  + ++S S D T+++W  G+           + GH   +
Sbjct: 465 SDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQSGTGKCEVTYIGHKDFV 524

Query: 369 TSAHWVDDDT-IISTSMDGSIRVWSLAS-----------NSTVASATVDGVPNFTGALSP 416
            S    +DD  I S S D  + +W   S            S ++ ATV+         + 
Sbjct: 525 LSVATSNDDKYIFSGSKDRGVIIWDKDSGNPILMLQGHRKSVISVATVNS--------NV 576

Query: 417 DQGK----FATGTLDGEVMVYDIQKL 438
           D GK    FATG+ D +  ++   K+
Sbjct: 577 DDGKNYKLFATGSGDCKARIWKYFKM 602

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 50/233 (21%), Positives = 105/233 (45%), Gaps = 20/233 (8%)

Query: 177 LWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVE-GKLQNILSYHR 235
           +WNI E  ++     G + ++  L++ P GQ L++G     +R+W ++ G+    LS   
Sbjct: 367 IWNIKERKIVM-VLKGHEQDIYSLDYFPDGQKLVSGSGDRSIRIWDLKTGQCSLTLSIED 425

Query: 236 APIVCIKWNSDETHVLTCDA-DNMTIVWNVLSGTAVQHF-SFKEAGTEESLGVDATWIDQ 293
             +  +  + +E  ++   + D    +W+  +G  V+   S  E+G      V +    +
Sbjct: 426 G-VTTVAVSPNEGKLIAAGSLDRSVRIWDSSTGFLVERLDSDNESGNGHQDSVYSVAFTK 484

Query: 294 D-KFAIPG-IQGSILVFNIGISKP-IGKLR----GHSKTLTTIAYNEHNKLLLSASDDNT 346
           D +  + G +  ++ ++N+G ++   GK      GH   + ++A +  +K + S S D  
Sbjct: 485 DGQHVVSGSLDRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLSVATSNDDKYIFSGSKDRG 544

Query: 347 LRVWRGGNLNPSHVFYGHSQSITSAHWVDDDT--------IISTSMDGSIRVW 391
           + +W   + NP  +  GH +S+ S   V+ +           + S D   R+W
Sbjct: 545 VIIWDKDSGNPILMLQGHRKSVISVATVNSNVDDGKNYKLFATGSGDCKARIW 597

>CAGL0K09284g 914937..917672 highly similar to sp|P25635
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/209 (20%), Positives = 87/209 (41%), Gaps = 18/209 (8%)

Query: 181 SETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSV-EGKLQNILSYHRAPIV 239
           SE+ +L     G  +    L ++P G  ++T  E G++++W V  G        H + + 
Sbjct: 330 SESYILK--QQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVASGFCLATFEEHTSAVT 387

Query: 240 CIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIP 299
            +++      + +   D     W+++     + F+  E      L V+ +     +    
Sbjct: 388 AVQFAKKGQVLFSASLDGTVRAWDLIRYRNFRVFTATERVQFTCLAVEPS----GEVVSA 443

Query: 300 GIQGS--ILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNP 357
           G   S  + V+++   + +  L GH   ++ +A++  N +L SAS D T+R+W       
Sbjct: 444 GSTDSFDVFVWSVQTGQLLDTLSGHEGPVSCLAFSMENAVLASASWDKTIRIWS------ 497

Query: 358 SHVFYGHSQSITSAHWVDDDTIISTSMDG 386
               +G SQ +       D   I+ + DG
Sbjct: 498 ---IFGRSQQVEPLEVFADILAITITPDG 523

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 68/171 (39%), Gaps = 7/171 (4%)

Query: 234 HRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQ 293
           HR  I     N   T +L+ D D   I+ N  +   + HF+FK+         D  +   
Sbjct: 54  HRKNIATFDVNKQGTLLLSVDTDGRAILVNFKTRNVLHHFNFKDKCYSVKFSPDGRYFAL 113

Query: 294 DKFAIPGIQGSILVFNIGISKPIGKLR---GHSKTLTTIAYNEHNKLLLSASDDNTLRVW 350
                  I  +  V       P  + R   GH + +T+  ++  ++ LL+ S D T RVW
Sbjct: 114 AVGRFLQIWKTPDVSQDRQFAPFVRYRVHAGHFQDITSFTWSHDSRFLLTTSKDLTSRVW 173

Query: 351 RGGNLNPSHV---FYGHSQSITSAHW-VDDDTIISTSMDGSIRVWSLASNS 397
              + +   V     GH   +  A++    + I + S DG++  W   S +
Sbjct: 174 SINSEDKELVATTLAGHRDYVLGAYFNSTQEKIYTISKDGAVFTWEYISKA 224

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 69/150 (46%), Gaps = 6/150 (4%)

Query: 303 GSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFY 362
           G +LV+       I K +GH     ++ Y+     +++A++D  ++VW   +      F 
Sbjct: 321 GQLLVYEWQSESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVASGFCLATFE 380

Query: 363 GHSQSITSAHWVDDDTII-STSMDGSIRVWSLASNSTVASATVDGVPNFTG-ALSPDQGK 420
            H+ ++T+  +     ++ S S+DG++R W L         T      FT  A+ P    
Sbjct: 381 EHTSAVTAVQFAKKGQVLFSASLDGTVRAWDLIRYRNFRVFTATERVQFTCLAVEPSGEV 440

Query: 421 FATGTLDG-EVMVYDIQ--KLLQQLN-HNG 446
            + G+ D  +V V+ +Q  +LL  L+ H G
Sbjct: 441 VSAGSTDSFDVFVWSVQTGQLLDTLSGHEG 470

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 56/291 (19%), Positives = 103/291 (35%), Gaps = 51/291 (17%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWSV-EGKLQNILSYHRAPIVCIKW-NSDETH 249
             Q +V C  +      L+ G  +GE RL+ + E  +   LS  + P+  +   NS E  
Sbjct: 254 ANQAKVKCCTFHINSNLLIVGFSNGEFRLYEMPEFVMVQQLSMGQNPVNTVSVNNSGEWL 313

Query: 250 VLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFN 309
                     +V+   S    + +  K+ G  ++        D  +       G I V++
Sbjct: 314 AFGSSKLGQLLVYEWQS----ESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWD 369

Query: 310 IGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW------------------- 350
           +     +     H+  +T + + +  ++L SAS D T+R W                   
Sbjct: 370 VASGFCLATFEEHTSAVTAVQFAKKGQVLFSASLDGTVRAWDLIRYRNFRVFTATERVQF 429

Query: 351 ------------RGGNLNPSHVFY-------------GHSQSITS-AHWVDDDTIISTSM 384
                         G+ +   VF              GH   ++  A  +++  + S S 
Sbjct: 430 TCLAVEPSGEVVSAGSTDSFDVFVWSVQTGQLLDTLSGHEGPVSCLAFSMENAVLASASW 489

Query: 385 DGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDI 435
           D +IR+WS+   S                ++PD    A  TL G++ ++DI
Sbjct: 490 DKTIRIWSIFGRSQQVEPLEVFADILAITITPDGKHVAVSTLKGQLTIFDI 540

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 35/79 (44%), Gaps = 4/79 (5%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNI----LSYHRAPIVCIKWNSDE 247
           G   ++T   W+   + LLT  +    R+WS+  + + +    L+ HR  ++   +NS +
Sbjct: 144 GHFQDITSFTWSHDSRFLLTTSKDLTSRVWSINSEDKELVATTLAGHRDYVLGAYFNSTQ 203

Query: 248 THVLTCDADNMTIVWNVLS 266
             + T   D     W  +S
Sbjct: 204 EKIYTISKDGAVFTWEYIS 222

>AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH]
           complement(216252..216269,216423..218903) [2499 bp, 832
           aa]
          Length = 832

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 84/204 (41%), Gaps = 14/204 (6%)

Query: 241 IKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPG 300
           I ++  E  VL         +WN  + T V+  S  EA           +I +  + I G
Sbjct: 19  IDFHPSEPWVLITLYSGRAEIWNYETQTEVRSISVCEAPVRA-----GKFIPRKSWIIVG 73

Query: 301 IQG-SILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWR-GGNLNPS 358
                I VFN    + +     H   +  +A +     +LSASDD T+++W    N    
Sbjct: 74  SDDFKIRVFNYNTGEKVVDFEAHPDYIRALAVHPTRSYVLSASDDLTVKLWNWEKNWALE 133

Query: 359 HVFYGHSQSITSAHW--VDDDTIISTSMDGSIRVWSLA---SNSTVASATVDGVPNFTGA 413
             F GH   + S  +   D +T  +  +D ++++WSL    SN T+ +    GV NF   
Sbjct: 134 QTFEGHEHFVMSVTFNPKDPNTFATACLDHTVKIWSLGQETSNFTLRAHLEKGV-NFVDY 192

Query: 414 LS-PDQGKFATGTLDGEVMVYDIQ 436
               D+    T + D  V V+D Q
Sbjct: 193 YPFQDKPYLITSSDDRTVKVWDYQ 216

 Score = 36.2 bits (82), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 47/231 (20%), Positives = 102/231 (44%), Gaps = 10/231 (4%)

Query: 168 VVTYSVADGLWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKL 227
           +  YS    +WN  ET     + +  +  V   ++ P    ++ G +  ++R+++     
Sbjct: 30  ITLYSGRAEIWNY-ETQTEVRSISVCEAPVRAGKFIPRKSWIIVGSDDFKIRVFNYNTG- 87

Query: 228 QNILSYHRAP--IVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLG 285
           + ++ +   P  I  +  +   ++VL+   D    +WN     A++  +F E      + 
Sbjct: 88  EKVVDFEAHPDYIRALAVHPTRSYVLSASDDLTVKLWNWEKNWALEQ-TF-EGHEHFVMS 145

Query: 286 VDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGH-SKTLTTIAYN--EHNKLLLSAS 342
           V     D + FA   +  ++ ++++G       LR H  K +  + Y   +    L+++S
Sbjct: 146 VTFNPKDPNTFATACLDHTVKIWSLGQETSNFTLRAHLEKGVNFVDYYPFQDKPYLITSS 205

Query: 343 DDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDD-DTIISTSMDGSIRVWS 392
           DD T++VW     +      GH  +++ A +      IIS S DG++++W+
Sbjct: 206 DDRTVKVWDYQTKSCVATLEGHLSNVSYAVYHPMLPIIISGSEDGTVKIWN 256

>AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH]
           (1107932..1109335) [1404 bp, 467 aa]
          Length = 467

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 56/268 (20%), Positives = 102/268 (38%), Gaps = 23/268 (8%)

Query: 192 GQQNEVTCLEW-APAGQSLLTGVESGELRLWSVEGKLQNILSY--HRAPIVCIKWNSDET 248
           G     T LE+    G   L+G   G L++W +  +   +  Y  HR  I    ++ D  
Sbjct: 172 GHDRGTTALEFLRKTGHLFLSGGNDGVLKIWDMYHERLLLRDYCGHRKAISATSFSHDNV 231

Query: 249 HVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVF 308
              +   D    +W+  +G  +   SFK   T   +       ++++  +      I  F
Sbjct: 232 QFASSSYDKTVKIWDTETGDIINRLSFK--ATPNCMTFHPQ--NKEQLLVGFSDSKIRHF 287

Query: 309 NIGISKPIGKLR---GHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHS 365
           ++ + K  G ++    H   +  + Y       +S+SDD ++R+W      P        
Sbjct: 288 DLRVDKKDGVIQIYDHHLAAINALRYFPDGSKFISSSDDKSIRIWENQINIPIKQISDTD 347

Query: 366 QSITSAHWV----DDDTIISTSMDGSIRVWSLASN-----STVASATVDGVPNFTGALSP 416
           Q    A W+    + +   + SMD SI V+S+                    N    ++P
Sbjct: 348 Q--YPAPWIQLHPEHNQFAAQSMDNSIYVYSMKPKYKRHPRKAFRGHKSAGYNSMFDIAP 405

Query: 417 DQGKFATGTLDGEVMVYDIQ--KLLQQL 442
           D    A G   G + ++D +  K+L+QL
Sbjct: 406 DGRYVAAGDTSGRLFIWDWKTTKILRQL 433

>Kwal_26.7738
          Length = 611

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 59/246 (23%), Positives = 110/246 (44%), Gaps = 34/246 (13%)

Query: 251 LTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNI 310
           +T  AD    +W+V SG  ++ +S +     + +GV A  I   +F    + G + +F +
Sbjct: 266 VTASADAAIRLWDVESGACLEKWSLEATLPNQQVGVAA--ISDTEFVSVSLDGCLNIFKV 323

Query: 311 GISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITS 370
           G   P  ++ GH+K +T +A       L+S S D  +  W  G+ N   V   H+ ++ +
Sbjct: 324 GQKSPSRRIEGHNKAITALAAGP----LVSGSYDGRVVKWGEGS-NSGAVLNFHTNTVIN 378

Query: 371 AHWVDDDTIIS----TSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTL 426
               D     S    + +DG ++ ++ +S   VASA               +G  A  T 
Sbjct: 379 IDSTDGVATTSWDSTSQLDGHVK-YTFSSQPKVASA--------------HEGTEAVVTQ 423

Query: 427 DGEVMVYDIQKLLQQLNHNGYHGTARSAEVARIPVVGDHRSAREGNYVTQISWSQESTQL 486
           + E+++ D+ K  Q ++     GTA +  + ++ V      A E +   ++    + + L
Sbjct: 424 ENELLLLDL-KSGQLVSSLSLPGTASAVSLGKMFVA----VAYEQSNAIEVF---KCSDL 475

Query: 487 SVSYSL 492
           SVS+SL
Sbjct: 476 SVSFSL 481

>KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces
           cerevisiae YBL008w HIR1 histone transcription regulator,
           start by similarity
          Length = 861

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/186 (18%), Positives = 79/186 (42%), Gaps = 30/186 (16%)

Query: 196 EVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQ------------------NILSYHRAP 237
           EV   + +P  Q L TG   G++R+WS+   L+                  + +S H   
Sbjct: 19  EVYTCDVSPDSQRLATGGLDGKIRIWSIPDILKFASNPNASTDKDILMKPLSTMSRHAGS 78

Query: 238 IVCIKWNSDETHVLTCDADNMTIVWNVLSGTA----------VQHFSFKEAGTEESLGV- 286
           +  +K++ D  ++ +   D + ++W +  GT           ++H++ +         + 
Sbjct: 79  VTTVKFSPDGKYLASGSDDRILLIWELEGGTTQPMFGAESTDIEHWNVRRRLVAHDNDIQ 138

Query: 287 DATWIDQDKFAIP-GIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDN 345
           D  W       +  G+  +I+++N    + + +   H   +  + ++  NK   +ASDD 
Sbjct: 139 DICWAPDSSIMVSVGLDRAIIIWNGSTFEKVKRFDVHQSHVKGVVFDPANKYFATASDDR 198

Query: 346 TLRVWR 351
           T++++R
Sbjct: 199 TIKMFR 204

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/240 (19%), Positives = 87/240 (36%), Gaps = 56/240 (23%)

Query: 292 DQDKFAIPGIQGSILVFNIG-----------------ISKPIGKLRGHSKTLTTIAYNEH 334
           D  + A  G+ G I +++I                  + KP+  +  H+ ++TT+ ++  
Sbjct: 28  DSQRLATGGLDGKIRIWSIPDILKFASNPNASTDKDILMKPLSTMSRHAGSVTTVKFSPD 87

Query: 335 NKLLLSASDDNTLRVW--RGGNLNP--------------SHVFYGHSQSITSAHWVDDDT 378
            K L S SDD  L +W   GG   P                    H   I    W  D +
Sbjct: 88  GKYLASGSDDRILLIWELEGGTTQPMFGAESTDIEHWNVRRRLVAHDNDIQDICWAPDSS 147

Query: 379 I-ISTSMDGSIRVWSLASNSTVA-----SATVDGVPNFTGALSPDQGKFATGTLDGEVMV 432
           I +S  +D +I +W+ ++   V       + V GV        P    FAT + D  + +
Sbjct: 148 IMVSVGLDRAIIIWNGSTFEKVKRFDVHQSHVKGV-----VFDPANKYFATASDDRTIKM 202

Query: 433 YDIQKLLQQLNHNGYHGTARSAEVARIPVVGDHRSAREGNYVTQISWSQESTQLSVSYSL 492
           +             YH T  ++      +    + +    Y  ++SWS +   ++   ++
Sbjct: 203 F------------RYHKTGETSFSVEHVITEPFKGSPLTTYFRRLSWSPDGQHIAAPNAM 250

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 21/31 (67%)

Query: 410 FTGALSPDQGKFATGTLDGEVMVYDIQKLLQ 440
           +T  +SPD  + ATG LDG++ ++ I  +L+
Sbjct: 21  YTCDVSPDSQRLATGGLDGKIRIWSIPDILK 51

>Scas_592.4*
          Length = 318

 Score = 48.5 bits (114), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 124/298 (41%), Gaps = 39/298 (13%)

Query: 181 SETVVLADANTGQQNEVTCLEWAPAGQS--LLTGVESGELRLWSVEGKLQNI------LS 232
           +E +VL     G    VT L    AGQ   LL+G     L  W + G  Q          
Sbjct: 4   NEVLVLRGTLEGHNGWVTSLA-TSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFK 62

Query: 233 YHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWID 292
            H   +       D  + L+   D    +W+V +G   Q F   ++        D   + 
Sbjct: 63  GHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKS--------DVMSVA 114

Query: 293 QDKFAIPGIQGS----ILVFNIGISKPIGKLRGHSKTLTTIAY-----NEHNKLLLSASD 343
            D+ A   I GS    I V+ I   + +  L GH+  ++ +       N+    ++SA +
Sbjct: 115 IDRKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGN 173

Query: 344 DNTLRVWRGGNLNPSHV---FYGHSQSITSAHWVDDDTIISTS-MDGSIRVWSLASNSTV 399
           D  ++ W   NLN   +   F GH+ ++ +     D T+I+++  DG I +W+LA    +
Sbjct: 174 DKMVKAW---NLNQFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLWNLAEKKAM 230

Query: 400 ASATV-DGVPNFTGALSPDQGKFATGTLDG-EVMVYDIQKLLQQLNHNGYHGTARSAE 455
            + +  D V  F+ A SP++   A  T  G ++   D Q L+  L    + G  +SAE
Sbjct: 231 YTLSAQDEV--FSLAFSPNRYWLAAATASGIKIFCLDPQSLIDDLRPE-FAGYNKSAE 285

>YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein that
           associates with Ccr4p, contains WD (WD-40) repeats [1980
           bp, 659 aa]
          Length = 659

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 59/283 (20%), Positives = 116/283 (40%), Gaps = 53/283 (18%)

Query: 177 LWNISETVVLADANTGQQNEVTCLEWAPAGQSLL-TGVESGELRLWSVEGKLQNILSYHR 235
           +W+++  + + +   G    V C++      ++L TG +   L+LW +   L   +    
Sbjct: 362 VWDLNHGIQVGEL-PGHLATVNCMQIDKKNYNMLITGSKDATLKLWDL--NLSREIYLDH 418

Query: 236 API---------VCI---KWNSDETHVLTCDA--------DNMTIVWNVLSGTAVQHFSF 275
           +P+          CI   + + DE   L+ D+        D     W++ +G  +Q    
Sbjct: 419 SPLKEKTEEIVTPCIHNFELHKDEITALSFDSEALVSGSRDKKIFHWDLTTGKCIQQLDL 478

Query: 276 KEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKP-IGKLRGHSKTLTTIAYNEH 334
               T   + + A  ++          G+ L   +G   P IG L+ ++  L T      
Sbjct: 479 IFTPTHSDIKMPARSLNN---------GACL---LGTEAPMIGALQCYNSALAT------ 520

Query: 335 NKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLA 394
                  + D  +R+W      P  +  GH+  ITS  + D + +++ SMD S+R+W L 
Sbjct: 521 ------GTKDGIVRLWDLRVGKPVRLLEGHTDGITSLKF-DSEKLVTGSMDNSVRIWDLR 573

Query: 395 SNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQK 437
           ++S +     D +P    +L  D      G  +G V V+++++
Sbjct: 574 TSSILDVIAYD-LP--VSSLDFDGKLITVGANEGGVNVFNMER 613

>Scas_680.11
          Length = 347

 Score = 48.5 bits (114), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 59/134 (44%), Gaps = 7/134 (5%)

Query: 314 KPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHW 373
           +PI  L GH + LT + YN    LL S S DN   VW   N        GH+ +I S   
Sbjct: 2   RPI-VLMGHERPLTQVKYNREGDLLFSCSKDNFASVWYSVNGERLGTLNGHAGTIWSID- 59

Query: 374 VDDDT--IISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVM 431
           VD  T   ++ S D SI++W + +   V S     VP    + SP  G +    LD  VM
Sbjct: 60  VDKFTEYCVTGSADYSIKMWKVETGENVYSWD-SPVPVKNVSFSP-CGNYVAAVLDN-VM 116

Query: 432 VYDIQKLLQQLNHN 445
            Y     + QL  N
Sbjct: 117 KYPGSINIYQLKRN 130

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 34/168 (20%), Positives = 73/168 (43%), Gaps = 27/168 (16%)

Query: 201 EWAPAGQSLLTGVESGELRLWSVEGKLQNI--LSYHRAPIVCIKWNSDETHVLTCDADNM 258
           +W+  G+ ++   + GE+  + V+  LQ +  +  H+A I  ++++ D T+ +T   D+ 
Sbjct: 160 DWSTEGKFIIAAHKEGEVSKYDVDNGLQFVESIKLHKALITDLQFSPDRTYFITSSRDSH 219

Query: 259 TIVWNVLSGTAVQHFS------------FKE----AGTEESLGVDATWIDQDKFAIPGIQ 302
             + +V +   ++ F              KE     G +++  V  T   + KF      
Sbjct: 220 AHIVDVETLAVLKDFEIDCPLNTACITPLKEFVILGGGQDARDVTTTSASEGKFEAR--- 276

Query: 303 GSILVFNIGI-SKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRV 349
                F+  I  + IG+++GH   L  +A +      +S  +D  +R+
Sbjct: 277 -----FHHKIFEEEIGRVKGHFGPLNCVAVSPQGTSYVSGGEDGLVRL 319

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 34/76 (44%), Gaps = 10/76 (13%)

Query: 230 ILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDAT 289
           +L  H  P+  +K+N +   + +C  DN   VW  ++G  +   +   AGT         
Sbjct: 5   VLMGHERPLTQVKYNREGDLLFSCSKDNFASVWYSVNGERLGTLN-GHAGT--------I 55

Query: 290 W-IDQDKFAIPGIQGS 304
           W ID DKF    + GS
Sbjct: 56  WSIDVDKFTEYCVTGS 71

>Scas_721.115*
          Length = 318

 Score = 48.5 bits (114), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 124/298 (41%), Gaps = 39/298 (13%)

Query: 181 SETVVLADANTGQQNEVTCLEWAPAGQS--LLTGVESGELRLWSVEGKLQNI------LS 232
           +E +VL     G    VT L    AGQ   LL+G     L  W + G  Q          
Sbjct: 4   NEVLVLRGTLEGHNGWVTSLA-TSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFK 62

Query: 233 YHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWID 292
            H   +       D  + L+   D    +W+V +G   Q F   ++        D   + 
Sbjct: 63  GHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKS--------DVMSVA 114

Query: 293 QDKFAIPGIQGS----ILVFNIGISKPIGKLRGHSKTLTTIAY-----NEHNKLLLSASD 343
            D+ A   I GS    I V+ I   + +  L GH+  ++ +       N+ +  ++SA +
Sbjct: 115 IDRKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGN 173

Query: 344 DNTLRVWRGGNLNPSHV---FYGHSQSITSAHWVDDDTIISTS-MDGSIRVWSLASNSTV 399
           D  ++ W   NLN   +   F GH+ ++ +     D T+I+++  DG I +W+LA    +
Sbjct: 174 DKMVKAW---NLNQFQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLWNLAEKKAM 230

Query: 400 ASATV-DGVPNFTGALSPDQGKFATGTLDG-EVMVYDIQKLLQQLNHNGYHGTARSAE 455
            + +  D V  F  A SP++   A  T  G ++   D Q L+  L    + G  +SAE
Sbjct: 231 YTLSAQDEV--FALAFSPNRYWLAAATASGIKIFCLDPQSLVDDLRPE-FAGYNKSAE 285

>KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces
           cerevisiae YLR129w DIP2 DOM34P-interacting protein,
           start by similarity
          Length = 936

 Score = 48.9 bits (115), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 50/232 (21%), Positives = 100/232 (43%), Gaps = 23/232 (9%)

Query: 177 LWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSV-EGKLQNILSYHR 235
           +WN++    +   + G      C +  P G  ++ G   GEL+L+ +    L +    H 
Sbjct: 408 VWNLTTKKCIRTFSCGY---ALCSQMLPGGLLVVVGTRQGELQLFDLASSTLLSTTEAHT 464

Query: 236 APIVCIKWNSDETHVLTCDADNMTIVWN------VLSGTAVQHFSFKEAG-------TEE 282
           A I  +   S+   ++T  AD     W+      ++ GT  ++    +         T++
Sbjct: 465 AAIWSLDLTSNGKRLVTGSADKSCKFWDFEVVEQLVPGTKDKYIPQLKLVHDTTLELTDD 524

Query: 283 SLGVDATWIDQDKF-AIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSA 341
            L V  +   +D++ A+  +  ++ VF     K    L GH   + +I ++  +K+L+++
Sbjct: 525 ILAVKIS--SEDRYLAVSLLDNTVKVFFFDSLKFYLSLYGHKLPVLSIDFSVDSKMLITS 582

Query: 342 SDDNTLRVWRGGNLNPSH-VFYGHSQSITSAHW-VDDDTIISTSMDGSIRVW 391
           S D  +++W G +    H   + H  SI S  +  D     S   DG+++ W
Sbjct: 583 SADKNIKIW-GVDFGDCHKSIFAHQDSIMSVRFEADTHNFFSCGKDGAVKRW 633

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 70/146 (47%), Gaps = 20/146 (13%)

Query: 256 DNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGS----ILVFNIG 311
           D +  VW++LS + +  F+  ++G         T +  D      + GS    ++++++ 
Sbjct: 94  DGVIKVWDLLSKSVLMQFNGHKSG--------VTVLRLDSEGTRLVSGSKDSDLIIWDLV 145

Query: 312 ISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW---RGGNLNPSHVFY-GHSQS 367
               + KLR H   +T I  + +   L+S + D  ++VW    GG    +H+ + G   S
Sbjct: 146 GEVGLMKLRSHKDAITGIWIDHNMDWLISVAKDGLIKVWDLKAGGQCVETHMAHTGQCWS 205

Query: 368 ITSAHWVDDDTIISTSMDGSIRVWSL 393
           +     +D++ II+TSMD   ++W L
Sbjct: 206 MA----IDEEVIITTSMDSQAKIWEL 227

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 55/118 (46%), Gaps = 4/118 (3%)

Query: 234 HRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQ 293
           H+ P++ I ++ D   ++T  AD    +W V  G   +   F    +  S+  +A   D 
Sbjct: 563 HKLPVLSIDFSVDSKMLITSSADKNIKIWGVDFGDCHKSI-FAHQDSIMSVRFEA---DT 618

Query: 294 DKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWR 351
             F   G  G++  ++      I KL GH   +  IA +   + ++S S D+++RVW+
Sbjct: 619 HNFFSCGKDGAVKRWDGDKFDCIQKLNGHQSEVWCIAVSPDGRTVVSTSHDHSIRVWQ 676

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 34/73 (46%), Gaps = 2/73 (2%)

Query: 363 GHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFA 422
           GH   I S    DD  ++ST+ +G ++VW+L +   + + +          + P      
Sbjct: 381 GHRTDIRSMDISDDGKLLSTASNGELKVWNLTTKKCIRTFSCGYA--LCSQMLPGGLLVV 438

Query: 423 TGTLDGEVMVYDI 435
            GT  GE+ ++D+
Sbjct: 439 VGTRQGELQLFDL 451

>YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential
           protein required for cell separation, has eight WD
           (WD-40) repeats, component of U3 snoRNP (also called
           small subunit processome), which is required for 18S
           rRNA biogenesis [2772 bp, 923 aa]
          Length = 923

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 71/168 (42%), Gaps = 9/168 (5%)

Query: 234 HRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQ 293
           HR  I  I  N   T +++ D D   I+ N  +   + HF+FKE  +      D      
Sbjct: 54  HRKNIAAIDLNKQGTLLISIDEDGRAILVNFKARNVLHHFNFKEKCSAVKFSPDGRLFAL 113

Query: 294 DKFAIPGIQGSILVFNIGISKPIGKLR---GHSKTLTTIAYNEHNKLLLSASDDNTLRVW 350
                  I  +  V       P  + R   GH + +T++ +++ ++ +L+ S D + ++W
Sbjct: 114 ASGRFLQIWKTPDVNKDRQFAPFVRHRVHAGHFQDITSLTWSQDSRFILTTSKDLSAKIW 173

Query: 351 ----RGGNLNPSHVFYGHSQSITSAHWV-DDDTIISTSMDGSIRVWSL 393
                  NL  +  F GH   +  A +  D + I + S DG++ VW  
Sbjct: 174 SVDSEEKNL-AATTFNGHRDYVMGAFFSHDQEKIYTVSKDGAVFVWEF 220

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/212 (20%), Positives = 86/212 (40%), Gaps = 24/212 (11%)

Query: 181 SETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSV-EGKLQNILSYHRAPIV 239
           SE+ +L     G  +    L ++P G  ++T  E G++++W +  G        H + + 
Sbjct: 334 SESYILK--QQGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITSGFCLATFEEHTSSVT 391

Query: 240 CIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIP 299
            +++      + +   D     W+++     + F+  E      L VD +          
Sbjct: 392 AVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVDPS-------GEV 444

Query: 300 GIQGSILVFNIGI-----SKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGN 354
              GS+  F+I +      + +  L GH   ++ +++++ N +L SAS D T+R+W    
Sbjct: 445 VCAGSLDNFDIHVWSVQTGQLLDALSGHEGPVSCLSFSQENSVLASASWDKTIRIWS--- 501

Query: 355 LNPSHVFYGHSQSITSAHWVDDDTIISTSMDG 386
                  +G SQ +       D   +S   DG
Sbjct: 502 ------IFGRSQQVEPIEVYSDVLALSMRPDG 527

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 58/262 (22%), Positives = 104/262 (39%), Gaps = 52/262 (19%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWSV-EGKLQNILSYHRAPIVCIKWNSDETHV 250
             Q +V C+ + PA + L  G  SGE RL+ + +  L   LS  + P+  +         
Sbjct: 258 ANQAKVKCVTFHPATRLLAVGFTSGEFRLYDLPDFTLIQQLSMGQNPVNTV--------- 308

Query: 251 LTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNI 310
               + N T  W     + +                                G +LV+  
Sbjct: 309 ----SVNQTGEWLAFGSSKL--------------------------------GQLLVYEW 332

Query: 311 GISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITS 370
                I K +GH  +  ++AY+     +++AS+D  ++VW   +      F  H+ S+T+
Sbjct: 333 QSESYILKQQGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITSGFCLATFEEHTSSVTA 392

Query: 371 AHWVDDDTII-STSMDGSIRVWSLASNSTVASATVDGVPNFTG-ALSPDQGKFATGTLDG 428
             +     ++ S+S+DG++R W L       + T      F   A+ P       G+LD 
Sbjct: 393 VQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSLDN 452

Query: 429 -EVMVYDIQ--KLLQQLN-HNG 446
            ++ V+ +Q  +LL  L+ H G
Sbjct: 453 FDIHVWSVQTGQLLDALSGHEG 474

 Score = 33.5 bits (75), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 36/75 (48%), Gaps = 4/75 (5%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNI----LSYHRAPIVCIKWNSDE 247
           G   ++T L W+   + +LT  +    ++WSV+ + +N+     + HR  ++   ++ D+
Sbjct: 144 GHFQDITSLTWSQDSRFILTTSKDLSAKIWSVDSEEKNLAATTFNGHRDYVMGAFFSHDQ 203

Query: 248 THVLTCDADNMTIVW 262
             + T   D    VW
Sbjct: 204 EKIYTVSKDGAVFVW 218

>YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translation
           initiation factor eIF3, p39 subunit, contains two WD
           (WD-40) repeats [1044 bp, 347 aa]
          Length = 347

 Score = 48.1 bits (113), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 61/130 (46%), Gaps = 15/130 (11%)

Query: 318 KLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDD 377
           KL GH + LT + YN+   LL S S D++  VW   N        GH+ +I S   +D D
Sbjct: 5   KLTGHERPLTQVKYNKEGDLLFSCSKDSSASVWYSLNGERLGTLDGHTGTIWS---IDVD 61

Query: 378 TI----ISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLD------ 427
                 ++ S D SI++W +++   VA+     VP      SP  G +    LD      
Sbjct: 62  CFTKYCVTGSADYSIKLWDVSNGQCVATWK-SPVPVKRVEFSP-CGNYFLAILDNVMKNP 119

Query: 428 GEVMVYDIQK 437
           G + +Y+I++
Sbjct: 120 GSINIYEIER 129

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 30/166 (18%), Positives = 69/166 (41%), Gaps = 25/166 (15%)

Query: 202 WAPAGQSLLTGVESGELRLWSVEGKLQNI--LSYHRAPIVCIKWNSDETHVLTCDADNMT 259
           W+  G+ ++ G + G++  + V    + +  +  H   I  ++++ D T+ +T   D  +
Sbjct: 161 WSTKGKYIIAGHKDGKISKYDVSNNYEYVDSIDLHEKSISDMQFSPDLTYFITSSRDTNS 220

Query: 260 IVWNVLSGTAVQHFS------------FKE----AGTEESLGVDATWIDQDKFAIPGIQG 303
            + +V +   ++ +              KE     G +E+  V  T  ++ KF       
Sbjct: 221 FLVDVSTLQVLKKYETDCPLNTAVITPLKEFIILGGGQEAKDVTTTSANEGKF------- 273

Query: 304 SILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRV 349
               ++    + IG+++GH   L T+A +       S  +D  +R+
Sbjct: 274 EARFYHKIFEEEIGRVQGHFGPLNTVAISPQGTSYASGGEDGFIRL 319

>YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 snoRNP
           (renamed small subunit processome - SSU processome),
           which is required for 18S rRNA biogenesis [2832 bp, 943
           aa]
          Length = 943

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 53/232 (22%), Positives = 97/232 (41%), Gaps = 22/232 (9%)

Query: 177 LWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGK--LQNILSYH 234
           +WNI     +     G    +TC ++ P G  ++ G  +GEL+L+ +     L  I   H
Sbjct: 416 IWNIKTHKCIRTFECGYA--LTC-KFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAH 472

Query: 235 RAPIVCIKWNSDETHVLTCDADNMTIVWN------VLSGTAVQ-------HFSFKEAGTE 281
            A I  +   SD   ++T  AD     W+      ++ GT  +       H       T+
Sbjct: 473 DAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVENSLVPGTKNKFLPVLKLHHDTTLELTD 532

Query: 282 ESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSA 341
           + L V  +  D    AI  +  ++ VF +   K    L GH   + +I  +  +K+++++
Sbjct: 533 DILCVRVS-PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITS 591

Query: 342 SDDNTLRVWRGGNLNPSH-VFYGHSQSITSAHWVDDD-TIISTSMDGSIRVW 391
           S D  +++W G +    H   + H  SI +  ++       S S D  ++ W
Sbjct: 592 SADKNIKIW-GLDFGDCHKSLFAHQDSIMNVKFLPQSHNFFSCSKDAVVKYW 642

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 66/149 (44%), Gaps = 8/149 (5%)

Query: 261 VWNVLSGTAVQHFSFK-EAGTEESLGV---DATWI----DQDKFAIPGIQGSILVFNIGI 312
           +W++ +G  V   S     G  ++ G    + T++    D D  A+    G I V+++  
Sbjct: 51  IWDIKTGDLVSKLSDGLPPGASDARGAKPAECTYLEAHKDTDLLAVGYADGVIKVWDLMS 110

Query: 313 SKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAH 372
              +    GH   +T + ++     L+S S D+ + VW        +    H  SIT   
Sbjct: 111 KTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFW 170

Query: 373 WVDDDTIISTSMDGSIRVWSLASNSTVAS 401
              +D +ISTS DG I++W L ++  + +
Sbjct: 171 CQGEDWLISTSKDGMIKLWDLKTHQCIET 199

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 53/280 (18%), Positives = 101/280 (36%), Gaps = 34/280 (12%)

Query: 132 IKTLQCVQTFPPGYVSQWNPKHEGVFA-YGERDSRAAVVTYSVADGLWNISETVVLADAN 190
           IKT +C++TF  GY         G+    G R+             L++++ + +L    
Sbjct: 419 IKTHKCIRTFECGYALTCKFLPGGLLVILGTRNGELQ---------LFDLASSSLLDTIE 469

Query: 191 TGQQNEVTCLEWAPAGQSLLTGVESGELRLWS----------VEGKLQNILSYHRAP--- 237
                 +  L+    G+ L+TG     ++ W            + K   +L  H      
Sbjct: 470 DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVENSLVPGTKNKFLPVLKLHHDTTLE 529

Query: 238 ----IVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTE-ESLGVDATWID 292
               I+C++ + D+ ++     DN   V+ + S      F     G +   L +D ++ D
Sbjct: 530 LTDDILCVRVSPDDRYLAISLLDNTVKVFFLDS----MKFYLSLYGHKLPVLSIDISF-D 584

Query: 293 QDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRG 352
                      +I ++ +        L  H  ++  + +   +    S S D  ++ W G
Sbjct: 585 SKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPQSHNFFSCSKDAVVKYWDG 644

Query: 353 GNLNPSHVFYGHSQSI-TSAHWVDDDTIISTSMDGSIRVW 391
                    Y H   +   A   D   ++S+S D SIR+W
Sbjct: 645 EKFECIQKLYAHQSEVWALAVATDGGFVVSSSHDHSIRIW 684

 Score = 36.6 bits (83), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 45/212 (21%), Positives = 80/212 (37%), Gaps = 57/212 (26%)

Query: 187 ADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNILSY--HRAPIVCIKWN 244
           +DA   +  E T LE       L  G   G +++W +  K   +L++  H+A I  ++++
Sbjct: 72  SDARGAKPAECTYLEAHKDTDLLAVGYADGVIKVWDLMSK-TVLLNFNGHKAAITLLQFD 130

Query: 245 SDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGS 304
              T +++   D+  IVW+                                         
Sbjct: 131 GTGTRLISGSKDSNIIVWD----------------------------------------- 149

Query: 305 ILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGH 364
            LV  +G+     KLR H  ++T   + +    L+S S D  +++W   +L        H
Sbjct: 150 -LVGEVGLY----KLRSHKDSITGF-WCQGEDWLISTSKDGMIKLW---DLKTHQCIETH 200

Query: 365 SQSITSAHW---VDDDTIISTSMDGSIRVWSL 393
               T   W   V DD +I+T  D  +++W L
Sbjct: 201 IAH-TGECWGLAVKDDLLITTGTDSQVKIWKL 231

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/73 (21%), Positives = 37/73 (50%), Gaps = 2/73 (2%)

Query: 363 GHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFA 422
           G    + S    DD+ +++T+ +GS+++W++ ++  +   T +     T    P      
Sbjct: 389 GQRTDVRSIDISDDNKLLATASNGSLKIWNIKTHKCI--RTFECGYALTCKFLPGGLLVI 446

Query: 423 TGTLDGEVMVYDI 435
            GT +GE+ ++D+
Sbjct: 447 LGTRNGELQLFDL 459

>YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that
           targets proteins for ubiquitination by interacting with
           the SCF complex (Skp1p-Cdc53p-Cdc34p), regulates sulfur
           assimilation genes in response to S-adenosylmethionine
           levels, contains five WD (WD-40) repeats [1923 bp, 640
           aa]
          Length = 640

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 66/140 (47%), Gaps = 10/140 (7%)

Query: 261 VWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLR 320
           +W++ +G  ++  S        S GV   + D  K     +  +I V+N    + I   R
Sbjct: 326 IWDLFTGKLIRRLS------GHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGECISTYR 379

Query: 321 GHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDD-TI 379
           GHS ++ ++  + + K+++S S D T++VW   +    +   GH++ +          + 
Sbjct: 380 GHSDSVLSV--DSYQKVIVSGSADKTVKVWHVES-RTCYTLRGHTEWVNCVKLHPKSFSC 436

Query: 380 ISTSMDGSIRVWSLASNSTV 399
            S S D +IR+W + +NS +
Sbjct: 437 FSCSDDTTIRMWDIRTNSCL 456

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 71/158 (44%), Gaps = 12/158 (7%)

Query: 209 LLTGVESGELRLWSV-EGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSG 267
           L TG     + +W +  GKL   LS H   +  + +  D+  ++T   D    VWN ++G
Sbjct: 315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITG 372

Query: 268 TAVQHFSFKEAGTEESLGVDATWIDQDKFAIPG-IQGSILVFNIGISKPIGKLRGHSKTL 326
             +  +      ++  L VD+      K  + G    ++ V+++  S+    LRGH++ +
Sbjct: 373 ECISTY---RGHSDSVLSVDS----YQKVIVSGSADKTVKVWHVE-SRTCYTLRGHTEWV 424

Query: 327 TTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGH 364
             +  +  +    S SDD T+R+W     +   VF GH
Sbjct: 425 NCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGH 462

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 60/121 (49%), Gaps = 5/121 (4%)

Query: 316 IGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVD 375
           I + +GH   + T+ +N   +LL + S D+T+ +W            GHS  + + ++ D
Sbjct: 295 IQEFKGHMDGVLTLQFNY--RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF-D 351

Query: 376 DDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDI 435
           D  +I+ S+D +IRVW+  +   +  +T  G  +   ++   Q    +G+ D  V V+ +
Sbjct: 352 DRKLITGSLDKTIRVWNYITGECI--STYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHV 409

Query: 436 Q 436
           +
Sbjct: 410 E 410

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/200 (22%), Positives = 81/200 (40%), Gaps = 18/200 (9%)

Query: 209 LLTGVESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGT 268
           +++G     +++W VE +    L  H   + C+K +       +C  D    +W++ + +
Sbjct: 395 IVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNS 454

Query: 269 AVQHFSFKEAGTEESLGVDATWIDQDKFAIPGI-QGSILVFNIGISKPIGKLRGHSKTLT 327
            ++ F       ++ + +  T  D +  A      GS    +  ++    +    S    
Sbjct: 455 CLKVFRGHVGQVQKIIPL--TIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQE 512

Query: 328 T-----IAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHW---VDDDTI 379
           T     I Y  H   LLS   DNT+++W           +GH + +    W    D+  I
Sbjct: 513 TVLDENIPYPTH---LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGV----WDIAADNFRI 565

Query: 380 ISTSMDGSIRVWSLASNSTV 399
           IS S DGSI+VW L S   +
Sbjct: 566 ISGSHDGSIKVWDLQSGKCM 585

>CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces
           cerevisiae YCR084c TUP1 general transcription repressor,
           hypothetical start
          Length = 643

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/286 (19%), Positives = 117/286 (40%), Gaps = 44/286 (15%)

Query: 188 DANTGQQNE--VTCLEWAPAGQSLLTGVESGELRLWSV-EGKLQNILSYHRAPIVCIKWN 244
           DAN+    +  +  + ++P G+ L TG E   +R+W + + K+  +L  H   I  + + 
Sbjct: 365 DANSASSADLYIRSVCFSPDGKFLATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYF 424

Query: 245 SDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGS 304
                +++   D    +W++ +G      S ++  T     V  +  + +  A   +  +
Sbjct: 425 QSGNKLVSGSGDRTIRIWDLHTGQCSLTLSIEDGVTT----VAVSPGNGNYVAAGSLDRT 480

Query: 305 ILVFNIGISKPIGKLR-------GHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNP 357
           + V++      + +L        GH  ++ ++ +    K ++S S D ++++W   N+N 
Sbjct: 481 VRVWDSNSGFLVERLDSEGETGVGHKDSVYSVVFTRDGKNIVSGSLDRSVKLWNLRNING 540

Query: 358 SH-------------VFYGHSQSITSAHWVDDDT-IISTSMDGSIRVWSLAS-------- 395
           +               + GH   + S    ++D  I+S S D  +  W   S        
Sbjct: 541 ASTSPQPKTEGNCEMTYIGHKDFVLSVTTTENDQYILSGSKDRGVIFWDKVSGVPLLMLQ 600

Query: 396 ---NSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQKL 438
              NS ++ A  +G P     L  +   FATG+ D +  ++  Q +
Sbjct: 601 GHRNSVISVAVANGKP-----LGANYNVFATGSGDCKAKIWKFQTI 641

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 47/223 (21%), Positives = 95/223 (42%), Gaps = 19/223 (8%)

Query: 234 HRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHF-SFKEAGTEES-------LG 285
           H + + C+K+ S+    L    +  T ++ V +G  V       + GTE++       L 
Sbjct: 317 HDSVVCCVKF-SNNGEYLATGCNKTTKIFEVATGNLVTELVDDTKTGTEDANSASSADLY 375

Query: 286 VDATWIDQD-KFAIPGIQGSIL-VFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASD 343
           + +     D KF   G +  ++ +++I   K +  LRGH + + ++ Y +    L+S S 
Sbjct: 376 IRSVCFSPDGKFLATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSG 435

Query: 344 DNTLRVWRGGNLNPSHVFYGHSQSITSA-HWVDDDTIISTSMDGSIRVWSLASNSTVASA 402
           D T+R+W       S          T A    + + + + S+D ++RVW   S   V   
Sbjct: 436 DRTIRIWDLHTGQCSLTLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNSGFLVERL 495

Query: 403 TVDGVPN-------FTGALSPDQGKFATGTLDGEVMVYDIQKL 438
             +G          ++   + D     +G+LD  V +++++ +
Sbjct: 496 DSEGETGVGHKDSVYSVVFTRDGKNIVSGSLDRSVKLWNLRNI 538

>Kwal_26.8953
          Length = 458

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 70/258 (27%), Positives = 102/258 (39%), Gaps = 44/258 (17%)

Query: 218 LRLWSVEGKLQNILSYHRAPIVCIK-W-NSDETHVLTCDADNMTIVWNVLSGTAVQHFSF 275
            RL + E +L    S H   +  IK W N+ +T V +C  D    + +V +G  ++ F  
Sbjct: 201 FRLINSELQLVRTFSGHEHIVSHIKIWKNATDTLVASCSRDLTCKIGDVSNGYFLKSFQ- 259

Query: 276 KEAGTEESLGVDATWI-----DQDKFAIPGIQGSILVFNIGISKPIGKLR------GHSK 324
             A    SL +   +I     D          G  L F IG   P+ +++        S 
Sbjct: 260 PHAEWVRSLDIMGEYIITGSNDCTVRVSHWPTGRALSFGIGHDFPVEQVKIIPMELSESD 319

Query: 325 TLTTIAYNEHNKLLL--------SASDDNTLRVW----------RGGNLNPSHVFYGHSQ 366
                 Y+  NK  L        S S DNTLR+W          R    NP+   +   +
Sbjct: 320 DPQNNTYSAFNKDYLPLGFSHVVSCSRDNTLRIWQVPIPRLIAHRAPQPNPARAHFTLVK 379

Query: 367 SITS-AHWVDD-----DTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGK 420
           ++   + WV D     + IIS S D S+RVW L +  TV   T D    F   +  D G 
Sbjct: 380 TLKGHSSWVRDIRVRGNFIISCSDDRSVRVWDLETGETVREIT-DSHTGFANCIDTDCGG 438

Query: 421 -----FATGTLDGEVMVY 433
                  +G  DG+V+VY
Sbjct: 439 LNRQLLVSGGADGKVIVY 456

>CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces
           cerevisiae YJL112w MDV1, hypothetical start
          Length = 711

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 95/238 (39%), Gaps = 46/238 (19%)

Query: 197 VTCLEWAPAGQSLLT-GVESGELRLWSVEGKLQ-NILSYHRAPIVCIKWNSDETHVLTCD 254
           +TCL++ P   +L T G     ++LW    K Q   +  H A I C++ + +   V T  
Sbjct: 407 ITCLDFDPHFSTLCTAGYMDHIVKLWDYTKKRQIGAMEGHVATISCMQVDKNYNMVATGS 466

Query: 255 ADNMTIVWNVLSGTAVQHFSFKEAGTEESL--------GVDATWID--------QDK--- 295
            D    +WN           ++E    E+L         V + +ID        QDK   
Sbjct: 467 KDATVKLWNANDVIG----RYEEGNNSEALHTLDAHLDEVSSLYIDGANLMTASQDKTIR 522

Query: 296 ----FAIPGIQGSILVFNIGI------SKPIGKLRGHSKTLTTI------AYNEHNKLLL 339
               ++   IQ    VF++             K    S  L T+      +    +  L 
Sbjct: 523 RWDLYSGKCIQ----VFDVNFPSLSAYKSSFMKSNEDSMILKTVNTPIIGSIQSFDAALA 578

Query: 340 SASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNS 397
           + + D  +R+W         V  GH  +ITS  + D  TIIS S+DG+IR+W L SN+
Sbjct: 579 TGTKDGLIRLWDMRTGEVVRVLEGHMDAITSLKF-DATTIISGSLDGTIRLWDLRSNN 635

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/157 (20%), Positives = 65/157 (41%), Gaps = 36/157 (22%)

Query: 314 KPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW----------RGGNLNPSHVFYG 363
           + IG + GH  T++ +  +++  ++ + S D T+++W           G N    H    
Sbjct: 438 RQIGAMEGHVATISCMQVDKNYNMVATGSKDATVKLWNANDVIGRYEEGNNSEALHTLDA 497

Query: 364 HSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFT------------ 411
           H   ++S  ++D   +++ S D +IR W L S   +    V+  P+ +            
Sbjct: 498 HLDEVSSL-YIDGANLMTASQDKTIRRWDLYSGKCIQVFDVN-FPSLSAYKSSFMKSNED 555

Query: 412 ------------GALSPDQGKFATGTLDGEVMVYDIQ 436
                       G++       ATGT DG + ++D++
Sbjct: 556 SMILKTVNTPIIGSIQSFDAALATGTKDGLIRLWDMR 592

 Score = 32.7 bits (73), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 42/85 (49%), Gaps = 5/85 (5%)

Query: 208 SLLTGVESGELRLWSVE-GKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLS 266
           +L TG + G +RLW +  G++  +L  H   I  +K+  D T +++   D    +W++ S
Sbjct: 576 ALATGTKDGLIRLWDMRTGEVVRVLEGHMDAITSLKF--DATTIISGSLDGTIRLWDLRS 633

Query: 267 GTAVQHFSFKEAGTEESLGVDATWI 291
                  S+++  +  SL  DA  I
Sbjct: 634 NNLTDIISYEKPIS--SLDFDAKHI 656

>Sklu_2416.5 YNL317W, Contig c2416 8692-10071
          Length = 459

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/251 (18%), Positives = 98/251 (39%), Gaps = 53/251 (21%)

Query: 197 VTCLEWAPAGQSLLTGVESGELRLWSVEG-KLQNILSYHRAPIVCIKWNSDETHVLTCDA 255
           +  ++W P G+ L+    SGE  LW+      ++I+  H + +  ++++     +++ D+
Sbjct: 84  IPAIKWTPEGRRLVVATYSGEFSLWNGSTFNFESIMQAHDSAVTTMEYSHAGDWLISGDS 143

Query: 256 DNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKP 315
           D +  +W                              Q  F +      + V +      
Sbjct: 144 DGIIKIW------------------------------QPNFNM------VKVLD------ 161

Query: 316 IGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVD 375
               + H + +  ++++  +   ++ SDDN L++W   N     V  GH   + S  W  
Sbjct: 162 ----QAHMECVRDVSFSGTDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWDVKSCDWHP 217

Query: 376 D-DTIISTSMDGSIRVWSLASNSTVASATVDGVPN--FTGALSPDQGK-FATGTLDGEVM 431
               I+S S D  I++W   S   +  +T+ G  +        P +G   A    D    
Sbjct: 218 TMGLIVSGSKDNLIKLWDPRSGQCI--STILGFKHTIIKTKFQPTKGNLLAVVAKDKSCK 275

Query: 432 VYDIQKLLQQL 442
           ++DI++ +++L
Sbjct: 276 IFDIRQNMKEL 286

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 86/196 (43%), Gaps = 24/196 (12%)

Query: 177 LWNIS----ETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGK--LQNI 230
           +WN S    E V+     +G   +V   +W P    +++G +   ++LW       +  I
Sbjct: 191 IWNFSNGQQERVL-----SGHHWDVKSCDWHPTMGLIVSGSKDNLIKLWDPRSGQCISTI 245

Query: 231 LSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATW 290
           L +    I+  K+   + ++L   A + +     +     +  SF++     SL    TW
Sbjct: 246 LGFKHT-IIKTKFQPTKGNLLAVVAKDKSCKIFDIRQNMKELKSFRDESDYMSL----TW 300

Query: 291 --IDQDKFAIPGIQGSILVFNI----GISKPIGKLR-GHSKTLTTIAYNEHNKLLLSASD 343
             I++  F +    GS+  F++    G S     +   H K +T+++YN    +L SAS 
Sbjct: 301 HPINESIFTVGCYDGSLKHFDLLQDTGSSNSFHDIPYAHDKCITSLSYNPVGHILASASK 360

Query: 344 DNTLRVW-RGGNLNPS 358
           D T+R W R   ++P+
Sbjct: 361 DRTIRFWTRSRPMDPN 376

>Scas_629.12
          Length = 671

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 59/275 (21%), Positives = 112/275 (40%), Gaps = 50/275 (18%)

Query: 202 WAPAGQSLLTGVESGELRLWSV-EGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTI 260
           ++P G+ L TG E   +R+W + E K+  +L  H   +  + +  +   +++   D    
Sbjct: 395 FSPDGEFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSGDRTVR 454

Query: 261 VWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPG-IQGSILVFNIGISKPIGKL 319
           +W++ +G      S      E  +   A   +  KF   G +  ++ V++      + +L
Sbjct: 455 IWDLRTGQCSLTLSI-----EYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTTGFLVERL 509

Query: 320 -------RGHSKTLTTIAYNEHNKLLLSASDDNTLRVWR----GGNLNPSH--------- 359
                   GH  ++ ++ +      ++S S D T+++W     G + N S+         
Sbjct: 510 DSENELGTGHRDSVYSVVFTRDGNEVVSGSLDKTVKLWNMRHSGNSNNESNDKGSASATC 569

Query: 360 --VFYGHSQ---SITSAHWVDDDTIISTSMDGSIRVWSLAS-----------NSTVASAT 403
              + GH     S+T++   DD  I+S S D  I  W   S           NS ++ A 
Sbjct: 570 EVTYVGHKDFVLSVTTSQ--DDKYILSGSKDRGILFWDKESGNPLLMLQGHRNSVISVAV 627

Query: 404 VDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQKL 438
            +G      AL P    FATG+ D +  ++   K+
Sbjct: 628 ANG-----SALGPKYNVFATGSGDCKARIWKYSKI 657

 Score = 42.4 bits (98), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 50/244 (20%), Positives = 108/244 (44%), Gaps = 31/244 (12%)

Query: 234 HRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEES---------- 283
           H + + C+K+++D    L    +  T ++ V  G  +   S     + ++          
Sbjct: 327 HSSVVCCVKFSND-GQFLATGCNKTTQIYRVSDGELIAKLSDDSVTSPDTSSATSGSTPS 385

Query: 284 --LGVDATWIDQD-KFAIPGIQGSIL-VFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLL 339
             L + +     D +F   G +  ++ +++I   K +  L+GH + + ++ Y  + + L+
Sbjct: 386 TDLYIRSVCFSPDGEFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLV 445

Query: 340 SASDDNTLRVW--RGGNLNPS-HVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWS---- 392
           S S D T+R+W  R G  + +  + YG +    S +  D   I + S+D ++RVW     
Sbjct: 446 SGSGDRTVRIWDLRTGQCSLTLSIEYGVTTVAVSPN--DGKFIAAGSLDRAVRVWDSTTG 503

Query: 393 -----LASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQKLLQQLNHNGY 447
                L S + + +   D V  ++   + D  +  +G+LD  V +++++      N +  
Sbjct: 504 FLVERLDSENELGTGHRDSV--YSVVFTRDGNEVVSGSLDKTVKLWNMRHSGNSNNESND 561

Query: 448 HGTA 451
            G+A
Sbjct: 562 KGSA 565

>Kwal_33.15475
          Length = 783

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 78/178 (43%), Gaps = 20/178 (11%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQN------ILSYHRAPIVCIKWNS 245
           G   EVTC+++ P    +++  E  ++RLW+ E K Q+      ++ +H+  I  +   S
Sbjct: 54  GHNAEVTCVKFVPGTNLMVSSSEDSQVRLWAFEEKDQDALKCVQVIDHHKHTITSLSVIS 113

Query: 246 DETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKF--AIPGIQG 303
           +   V  C AD    +W   +  A+   SF        L +    ++ DK+  AI G   
Sbjct: 114 NILSV-GC-ADGSVSLWLTENNQAILLHSFNLQTNVYPLCMALKLVEGDKYLLAIGGTNP 171

Query: 304 SILVFNIGIS-------KPIGKLRGHSKTLTTIAYNEH---NKLLLSASDDNTLRVWR 351
            + +++  +        +   +L GH   +  + + E    N LL + S D  +R+WR
Sbjct: 172 RVFIYSFTLQDGTLNNFQLAAELEGHEDWVKAMDFYEESPGNMLLATGSQDRYIRLWR 229

 Score = 33.5 bits (75), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 43/87 (49%), Gaps = 8/87 (9%)

Query: 319 LRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWR-----GGNLNPSHVFYGHSQSITSAHW 373
           L+GH+  +T + +     L++S+S+D+ +R+W         L    V   H  +ITS   
Sbjct: 52  LKGHNAEVTCVKFVPGTNLMVSSSEDSQVRLWAFEEKDQDALKCVQVIDHHKHTITSLSV 111

Query: 374 VDDDTIIST-SMDGSIRVWSLASNSTV 399
           + +  I+S    DGS+ +W   +N  +
Sbjct: 112 ISN--ILSVGCADGSVSLWLTENNQAI 136

>YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protein
           containing six WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to S. cerevisiae Ykl121p, which binds
           phosphatidylinositol [2505 bp, 834 aa]
          Length = 834

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 56/236 (23%), Positives = 105/236 (44%), Gaps = 32/236 (13%)

Query: 201 EWAPAGQSLLTGVESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTI 260
           +++  G+ + TG + G++R+W V G          +P+   + +S         A +M I
Sbjct: 180 KFSRDGKFMATGSKDGKIRIWKVIG----------SPVERAELDSSAESNKEARAKSMRI 229

Query: 261 VWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLR 320
              V S    +   F ++ TE+       + +++K     +     VF+     P+   +
Sbjct: 230 KQQVSSLNNPKEKQFLDSATEK-------YEEKEKL----LNLYAPVFH---PTPLRLYK 275

Query: 321 GHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSA--HWVDDDT 378
            H + +  I ++++N  +LSAS D T+++W     N    F  H   +T    H  DD  
Sbjct: 276 EHVQDVLDINWSKNN-FILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRF 333

Query: 379 IISTSMDGSIRVWSLASNS-TVASATVDGVPNFTGALSPDQGKFA-TGTLDGEVMV 432
            IS  +D   R+WS+  +  +      D + + T  LSP++GK+   GT +G V +
Sbjct: 334 FISGCLDHKCRLWSILDDEVSFEYDCQDLITSVT--LSPEEGKYTIIGTFNGYVHI 387

>Scas_603.5
          Length = 589

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 60/252 (23%), Positives = 101/252 (40%), Gaps = 51/252 (20%)

Query: 197 VTCLEWAPAGQSLLT-GVESGELRLWSVEGKLQNI-LSYHRAPIVCIKWNSDETHVLTCD 254
           VTCL++  + + L T G  +  +++W +E   Q + L  H A + C++ + D   ++T  
Sbjct: 297 VTCLDFDLSTKMLYTAGKYNTSIKVWDLETNDQVMDLDDHIASVTCMQLHPDSKTLITGS 356

Query: 255 ADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISK 314
            D    +W++  G A Q              +D+T                      I  
Sbjct: 357 KDATLKLWDL--GLAPQ------------TSLDSTS--------------------NIDS 382

Query: 315 PIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWV 374
            I     H+  +T+++Y+  N+ LLSAS D ++R W     N        + S  S   +
Sbjct: 383 CINTFEAHTAEITSVSYD--NEYLLSASRDKSIRQWDLTTGNCVQTLEA-TLSHNSGTNI 439

Query: 375 DDDTI----------ISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATG 424
            D T+           + S DG IR+W L S   V +      P    +L  D  K  TG
Sbjct: 440 KDSTVEALQSVGAALATGSKDGIIRLWDLRSGKVVRTLLKHQGP--ITSLQFDSTKIITG 497

Query: 425 TLDGEVMVYDIQ 436
           + D  + V D++
Sbjct: 498 STDANISVSDLR 509

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 39/183 (21%), Positives = 75/183 (40%), Gaps = 33/183 (18%)

Query: 197 VTCLEWAPAGQSLLTGVESGELRLWSVEGKLQ-------------NILSYHRAPIVCIKW 243
           VTC++  P  ++L+TG +   L+LW +    Q             N    H A I  + +
Sbjct: 340 VTCMQLHPDSKTLITGSKDATLKLWDLGLAPQTSLDSTSNIDSCINTFEAHTAEITSVSY 399

Query: 244 NSDETHVLTCDADNMTIVWNVLSGTAVQHF----------SFKEAGTEESLGVDATWIDQ 293
             D  ++L+   D     W++ +G  VQ            + K++  E    V A     
Sbjct: 400 --DNEYLLSASRDKSIRQWDLTTGNCVQTLEATLSHNSGTNIKDSTVEALQSVGAA---- 453

Query: 294 DKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDN-TLRVWRG 352
              A     G I ++++   K +  L  H   +T++ ++   K++  ++D N ++   R 
Sbjct: 454 --LATGSKDGIIRLWDLRSGKVVRTLLKHQGPITSLQFDS-TKIITGSTDANISVSDLRT 510

Query: 353 GNL 355
           GN+
Sbjct: 511 GNI 513

>Kwal_56.23920
          Length = 937

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/232 (22%), Positives = 96/232 (41%), Gaps = 22/232 (9%)

Query: 177 LWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGK--LQNILSYH 234
           +WNI     +     G    + C ++ P G  ++ G ++G+L L+ +     L  I   H
Sbjct: 410 IWNIKTNSCIRTFECGYA--LAC-KFLPGGALVVLGTKTGDLHLYDLASSTLLNTIEGAH 466

Query: 235 RAPIVCIKWNSDETHVLTCDADNMTIVWNV------LSGTAVQHFS-----FKEAGTEES 283
              I  +   +D   ++T  AD     W+       + GT    F+     F +   E +
Sbjct: 467 SGAIWSLDMTTDGKRLVTGSADKTVCFWDFQVEQEPVPGTT-DKFNPKLKMFHDTTLELN 525

Query: 284 LGVDATWIDQDK--FAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSA 341
             V A  I  D    A+  +  ++ VF +   K    L GH   + +I  +  +KLL+++
Sbjct: 526 DDVLAVKISPDNRLLAVSLLDNTVKVFFMDSMKFFLSLYGHKLPVLSIDISFDSKLLITS 585

Query: 342 SDDNTLRVWRGGNLNPSH-VFYGHSQSITSAHWVDDD-TIISTSMDGSIRVW 391
           S D  +++W G +    H   + H+ SI    +V +     S S D  ++ W
Sbjct: 586 SADKNIKIW-GLDFGDCHRSLFAHNDSIMKVVFVPESHNFFSCSKDALVKYW 636

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 46/99 (46%)

Query: 303 GSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFY 362
           G+I ++++     +    GH   +T + +++    L+S S D+ + VW        +   
Sbjct: 97  GAIKIWDLLSKSVLISFNGHKSAITILTFDQTGTRLISGSRDSDIIVWDLVGEVGLYKLR 156

Query: 363 GHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVAS 401
            H  SIT      ++ +ISTS DG I+VW L     V +
Sbjct: 157 SHKDSITGLWCEGEEWLISTSKDGLIKVWDLKVQQCVET 195

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 35/173 (20%), Positives = 84/173 (48%), Gaps = 15/173 (8%)

Query: 187 ADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNILSY--HRAPIVCIKWN 244
            DA + +  E + L++ P  + L  G   G +++W +  K   ++S+  H++ I  + ++
Sbjct: 68  VDAKSTKPAETSYLQYHPETRLLAVGYNDGAIKIWDLLSK-SVLISFNGHKSAITILTFD 126

Query: 245 SDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQ-G 303
              T +++   D+  IVW+++    +    +K    ++S  +   W + +++ I   + G
Sbjct: 127 QTGTRLISGSRDSDIIVWDLVGEVGL----YKLRSHKDS--ITGLWCEGEEWLISTSKDG 180

Query: 304 SILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLN 356
            I V+++ + + +     H     ++    H  L+++A  DN +++W   NLN
Sbjct: 181 LIKVWDLKVQQCVETHVAHVGECWSMGV--HEDLVITAGADNQIKLW---NLN 228

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 52/130 (40%), Gaps = 30/130 (23%)

Query: 234 HRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGT----------AVQHFSF-KEAGTEE 282
           H+ P++ I  + D   ++T  AD    +W +  G           ++    F  E+    
Sbjct: 566 HKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHRSLFAHNDSIMKVVFVPESHNFF 625

Query: 283 SLGVDA--TWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLS 340
           S   DA   + D DKF                   I KL  H K + T+A +   + ++S
Sbjct: 626 SCSKDALVKYWDGDKFEC-----------------IQKLAAHQKEVWTLAISSDGRFVVS 668

Query: 341 ASDDNTLRVW 350
           AS D ++RVW
Sbjct: 669 ASHDQSIRVW 678

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/73 (20%), Positives = 36/73 (49%), Gaps = 2/73 (2%)

Query: 363 GHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFA 422
           GH   + +     D+ +++T+ +G++++W++ +NS +   T +          P      
Sbjct: 383 GHRSDVRAIDISGDNKLLATASNGTLKIWNIKTNSCI--RTFECGYALACKFLPGGALVV 440

Query: 423 TGTLDGEVMVYDI 435
            GT  G++ +YD+
Sbjct: 441 LGTKTGDLHLYDL 453

 Score = 29.6 bits (65), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 56/123 (45%), Gaps = 11/123 (8%)

Query: 319 LRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDT 378
           +RGH   +  I  +  NKLL +AS + TL++W     N     +    ++          
Sbjct: 381 IRGHRSDVRAIDISGDNKLLATAS-NGTLKIW-NIKTNSCIRTFECGYALACKFLPGGAL 438

Query: 379 IISTSMDGSIRVWSLASNSTVASATVDGVPNFTGA-----LSPDQGKFATGTLDGEVMVY 433
           ++  +  G + ++ LAS++ +   T++G    +GA     ++ D  +  TG+ D  V  +
Sbjct: 439 VVLGTKTGDLHLYDLASSTLL--NTIEGA--HSGAIWSLDMTTDGKRLVTGSADKTVCFW 494

Query: 434 DIQ 436
           D Q
Sbjct: 495 DFQ 497

>ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH]
           (538948..540657) [1710 bp, 569 aa]
          Length = 569

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 58/271 (21%), Positives = 114/271 (42%), Gaps = 58/271 (21%)

Query: 209 LLTGVESGELRLWSVE-GKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSG 267
           LLTG     + +W +  GKL   LS H   +  +++  D+  ++T   D    VWN ++G
Sbjct: 272 LLTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTG 329

Query: 268 TAVQHFSFKEAGTEES-LGVDATWIDQDKFAIPG-IQGSILVFNIGISKPIGKLRGHSKT 325
             V  +     G ++S L VD+      K  + G    ++ V+++  S+    LRGH+  
Sbjct: 330 ACVSTYR----GHQDSVLSVDSF----RKLIVSGSADKTVKVWHVE-SRTCYTLRGHTGW 380

Query: 326 LTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITS-------AHWVDDDT 378
           +  +  +  +    S SDD T+R+W         VF+GH   +         +  ++D  
Sbjct: 381 VNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEDPK 440

Query: 379 -------------------------------IISTSMDGSIRVWSLASNSTVAS--ATVD 405
                                          ++S S+D +I++W++ + + + +    V+
Sbjct: 441 DAVVPPDATAPAHDPSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVE 500

Query: 406 GVPNFTGALSPDQGKFATGTLDGEVMVYDIQ 436
           GV +    ++ D  +  +G+ D    V+D+Q
Sbjct: 501 GVWD----IAADNFRIVSGSHDRSCKVWDLQ 527

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 54/238 (22%), Positives = 97/238 (40%), Gaps = 34/238 (14%)

Query: 209 LLTGVESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVLTC--DADNMTI-VWNVL 265
           +++G     +++W VE +    L  H   + C+K +       TC   +D+MTI +W++ 
Sbjct: 352 IVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKS---FTCFSGSDDMTIRMWDIR 408

Query: 266 SGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNI--GISKPIGKLRGHS 323
           + T V+ F                 + Q +  IP   GS L+ +    +  P      H 
Sbjct: 409 TNTCVRVFHGH--------------VGQVQKVIPLTLGSDLIEDPKDAVVPPDATAPAHD 454

Query: 324 KTLT------TIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDD 377
            ++       ++ Y  H   LLS S DNT+++W           +GH + +      D+ 
Sbjct: 455 PSVQAANFDHSLPYPTH---LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA-ADNF 510

Query: 378 TIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDI 435
            I+S S D S +VW L +   +   T  G+      +     +F +G   G V +Y+ 
Sbjct: 511 RIVSGSHDRSCKVWDLQTGKCM--HTFVGIHAPVACVGIGDSEFVSGDELGCVKLYNF 566

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 60/121 (49%), Gaps = 5/121 (4%)

Query: 316 IGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVD 375
           I + +GH   + ++     NKLLL+ S D+T+ +W            GH+  + +  + D
Sbjct: 252 IQEFKGHMDGVLSLQLT--NKLLLTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF-D 308

Query: 376 DDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDI 435
           D  +I+ S+D +IRVW+  + + V  +T  G  +   ++   +    +G+ D  V V+ +
Sbjct: 309 DQKLITGSLDKTIRVWNYVTGACV--STYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHV 366

Query: 436 Q 436
           +
Sbjct: 367 E 367

>CAGL0L06952g complement(780793..781836) highly similar to sp|P40217
           Saccharomyces cerevisiae YMR146c TIF34 translation
           initiation factor eIF3, start by similarity
          Length = 347

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 60/134 (44%), Gaps = 16/134 (11%)

Query: 314 KPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHW 373
           +PI  L GH + LT + YN    LL + S D +  VW   N        GH  SI S   
Sbjct: 2   RPI-VLMGHERPLTQVKYNREGDLLFTCSKDISASVWYSNNGERLGTLDGHMGSIWS--- 57

Query: 374 VDDD----TIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLD-- 427
           +D D      ++ S D +I+VW+L +   V +     VP      SP  GK+    LD  
Sbjct: 58  IDSDHTSLYCVTGSADYTIKVWTLMNGQCVQTWNCP-VPVKRVEFSP-CGKYILAILDNV 115

Query: 428 ----GEVMVYDIQK 437
               G + +Y++++
Sbjct: 116 MKKPGSIEIYEVKR 129

>CAGL0A00605g complement(67281..69203) similar to sp|P53197
           Saccharomyces cerevisiae YGL003c CDH1 substrate-specific
           activator of APC-dependent proteolysis, hypothetical
           start
          Length = 640

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/270 (22%), Positives = 102/270 (37%), Gaps = 62/270 (22%)

Query: 180 ISETVVLADANTGQ-------QNEVTCLEWAPAGQSLLTGVESGELRLWSV-EGKLQNIL 231
           + ++V L++  TG+        NE T L W  AG  L  G  +G + ++ V + K    L
Sbjct: 355 LGKSVFLSEHQTGEVIHLCDTPNEYTSLSWMGAGSHLAIGQGNGIVEIYDVTKEKCIRTL 414

Query: 232 SYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWI 291
           S H   + C+ WN+   H+L+  + + TI+   +   A   F   E   +E  G+   W 
Sbjct: 415 SGHLDRVACLSWNN---HILSSGSRDRTILHRDVR-MADPFFEKIETHEQEICGLK--WN 468

Query: 292 DQD-KFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLS---ASDDNTL 347
             D K A  G    + V++     P   +  H   +  +A++ H + +L+    + D TL
Sbjct: 469 TNDNKLASGGNDNMVFVYDGTSRTPFLSINEHKAAVKAMAWSPHKQGILATGGGTADRTL 528

Query: 348 R-------------------------------------------VWRGGNLNPSHVFYGH 364
           +                                           +W   NL P  +  GH
Sbjct: 529 KMWNVNTSVKLNDVDTGSQVCNMVWSTNTDEIVTSHGYSKYNLTIWEASNLEPLAILKGH 588

Query: 365 SQSITSAHW-VDDDTIISTSMDGSIRVWSL 393
           S  +       D  TI+S + D ++R W L
Sbjct: 589 SFRVLHLTLSADGTTIVSGAGDETLRYWKL 618

 Score = 30.4 bits (67), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 41/225 (18%), Positives = 92/225 (40%), Gaps = 25/225 (11%)

Query: 136 QCVQTFPPGYVSQ-----WNPKHEGVFAYGERDSRAAVVTYSVADGLWNISETVVLADAN 190
           +C++T   G++ +     WN     + + G RD         +AD  +   ET       
Sbjct: 409 KCIRTLS-GHLDRVACLSWN---NHILSSGSRDRTILHRDVRMADPFFEKIET------- 457

Query: 191 TGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNI-LSYHRAPIVCIKWNSDETH 249
              + E+  L+W      L +G     + ++    +   + ++ H+A +  + W+  +  
Sbjct: 458 --HEQEICGLKWNTNDNKLASGGNDNMVFVYDGTSRTPFLSINEHKAAVKAMAWSPHKQG 515

Query: 250 VLTC---DADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSIL 306
           +L      AD    +WNV +   +      + G++    V +T  D+   +    + ++ 
Sbjct: 516 ILATGGGTADRTLKMWNVNTSVKLNDV---DTGSQVCNMVWSTNTDEIVTSHGYSKYNLT 572

Query: 307 VFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWR 351
           ++     +P+  L+GHS  +  +  +     ++S + D TLR W+
Sbjct: 573 IWEASNLEPLAILKGHSFRVLHLTLSADGTTIVSGAGDETLRYWK 617

>ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH]
           complement(647933..649102) [1170 bp, 389 aa]
          Length = 388

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 67/143 (46%), Gaps = 14/143 (9%)

Query: 305 ILVFNIGISKPIGKLRGHSKTLTTIAYN----------EHNKLLLSASDDNTLRVWRGGN 354
           I ++++   K +G L  H+ ++T++ ++          + NK LLSAS+D+T+ +WR  +
Sbjct: 63  IRIYDLQKRKELGTLLNHNGSITSLRFSRATTDKDGKQQGNKWLLSASEDHTIIIWRVKD 122

Query: 355 LNPSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVDGVP---NFT 411
                   GH+  I        + + S S D SIR+W+L +    A   +        + 
Sbjct: 123 WENFGKLKGHNARINDLDIHPSNRVASVSEDHSIRLWNLMTAKKAAVLKLKKYNQNGKYV 182

Query: 412 GALSPDQGKFATGTLDGEVMVYD 434
                D G FA G L  +V++Y+
Sbjct: 183 RWCGKDAGFFAVG-LVTKVLIYN 204

>YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription
           inhibitor, required for periodic repression of 3 of the
           4 histone gene loci and for autogenous repression of
           HTA1-HTB1 locus by H2A and H2B, member of WD (WD-40)
           repeat family [2523 bp, 840 aa]
          Length = 840

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/199 (18%), Positives = 84/199 (42%), Gaps = 33/199 (16%)

Query: 186 LADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNI--------------- 230
           LA     ++ E+  ++ +  G+ L TG   G++R+WS++  L+ +               
Sbjct: 9   LAHREESRKYEIYTVDVSHDGKRLATGGLDGKIRIWSIDSILRCMELESLTPEIPLPQDL 68

Query: 231 ------LSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQ----------HFS 274
                 +S H   I C+K++ D  ++ +   D + ++W +    + Q          H++
Sbjct: 69  QMPLCSMSRHTGSITCVKFSPDGKYLASGSDDRILLIWALDEEQSSQPAFGSEHEREHWT 128

Query: 275 FKEAGTEESLGV-DATWI-DQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYN 332
            ++        + D  W  D       G+  S++V+N    + + +   H   +  + ++
Sbjct: 129 VRKRLVAHDNDIQDICWAPDSSILVTVGLDRSVIVWNGSTFEKLKRFDVHQSLVKGVVFD 188

Query: 333 EHNKLLLSASDDNTLRVWR 351
             NK   + SDD T++++R
Sbjct: 189 PANKYFATTSDDRTMKIFR 207

>AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C
           (CAF4) - SH] complement(52978..55125) [2148 bp, 715 aa]
          Length = 715

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 54/243 (22%), Positives = 112/243 (46%), Gaps = 35/243 (14%)

Query: 177 LWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQN-ILSYHR 235
           +WN+S+   +A   TG    V+C++      +L+TG     L++W ++  + N  +    
Sbjct: 438 VWNLSKNKHVASI-TGHLATVSCMQMDQYN-TLITGGRDALLKMWDIQKAIDNDSIPSDE 495

Query: 236 APIVCIKWNSDETHVLTCDADNM-------TIV-WNVLSGTAVQ--HFSFKEAG--TEES 283
             I     + DE   L+ +A+N+       TI  W++ +G  VQ    +F   G  +   
Sbjct: 496 VCIYTFDSHIDEITALSFEANNLVSGSQDRTIRQWDLNNGKCVQTLDINFATGGNLSRSM 555

Query: 284 LGVDATWIDQDKFAIPGIQ------------GSILVFNIGISKPIGKLRGHSKTLTTIAY 331
           +G      + D   I  IQ            G + ++++   + +  L GHS  +T++ +
Sbjct: 556 IGSGFLNTNNDHPIIGAIQCYDAALATGTKDGIVRLWDLRSGRVVRTLEGHSDAVTSLQF 615

Query: 332 NEHNKLLLSASDDNTLRVW--RGGNLNPSHVFYGHSQSITSAHWVDDDTIISTSMDGSIR 389
           +  N  L++ S DN++R+W  R G L  +   + +   +T   + D + I+  + +G+++
Sbjct: 616 DSLN--LVTGSLDNSIRIWDLRTGTLADT---FSYEHPVTCLQF-DLNKIVVANQEGTVK 669

Query: 390 VWS 392
           V++
Sbjct: 670 VYN 672

 Score = 37.7 bits (86), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 72/163 (44%), Gaps = 32/163 (19%)

Query: 304 SILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWR-----GGNLNPS 358
           +I V+N+  +K +  + GH  T++ +  +++N  L++   D  L++W        +  PS
Sbjct: 435 TIKVWNLSKNKHVASITGHLATVSCMQMDQYNT-LITGGRDALLKMWDIQKAIDNDSIPS 493

Query: 359 -----HVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVD-------- 405
                + F  H   IT+  + + + ++S S D +IR W L +   V +  ++        
Sbjct: 494 DEVCIYTFDSHIDEITALSF-EANNLVSGSQDRTIRQWDLNNGKCVQTLDINFATGGNLS 552

Query: 406 ------GVPN------FTGALSPDQGKFATGTLDGEVMVYDIQ 436
                 G  N        GA+       ATGT DG V ++D++
Sbjct: 553 RSMIGSGFLNTNNDHPIIGAIQCYDAALATGTKDGIVRLWDLR 595

 Score = 30.0 bits (66), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 384 MDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQ-GKFATGTLDGEVMVYDIQKLL 439
           +D +I+VW+L+ N  VAS T  G       +  DQ     TG  D  + ++DIQK +
Sbjct: 432 LDPTIKVWNLSKNKHVASIT--GHLATVSCMQMDQYNTLITGGRDALLKMWDIQKAI 486

>YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein
           containing three WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           weak similarity to a region of S. pombe Cwf1p, which is
           a putative spliceosomal subunit and component of a 40S
           snRNP-containing complex [1254 bp, 417 aa]
          Length = 417

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 56/118 (47%), Gaps = 5/118 (4%)

Query: 285 GVDATWIDQDKFAIPGIQGSILVF--NIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSAS 342
            VD   +   +F +   +G I V   N  + + I +   H   +T + +    + L+S+S
Sbjct: 98  AVDTAKLQMRRFILGTTEGDIKVLDSNFNLQREIDQ--AHVSEITKLKFFPSGEALISSS 155

Query: 343 DDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDD-DTIISTSMDGSIRVWSLASNSTV 399
            D  L++W   + +      GH  ++T    +D    ++S S+DG+IR+W   + +T+
Sbjct: 156 QDMQLKIWSVKDGSNPRTLIGHRATVTDIAIIDRGRNVLSASLDGTIRLWECGTGTTI 213

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 45/83 (54%), Gaps = 1/83 (1%)

Query: 196 EVTCLEWAPAGQSLLTGVESGELRLWSV-EGKLQNILSYHRAPIVCIKWNSDETHVLTCD 254
           E+T L++ P+G++L++  +  +L++WSV +G     L  HRA +  I       +VL+  
Sbjct: 138 EITKLKFFPSGEALISSSQDMQLKIWSVKDGSNPRTLIGHRATVTDIAIIDRGRNVLSAS 197

Query: 255 ADNMTIVWNVLSGTAVQHFSFKE 277
            D    +W   +GT +  F+ KE
Sbjct: 198 LDGTIRLWECGTGTTIHTFNRKE 220

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 24/43 (55%)

Query: 319 LRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVF 361
           L GH  T+T IA  +  + +LSAS D T+R+W  G     H F
Sbjct: 174 LIGHRATVTDIAIIDRGRNVLSASLDGTIRLWECGTGTTIHTF 216

>Scas_670.21
          Length = 595

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 81/183 (44%), Gaps = 18/183 (9%)

Query: 180 ISETVVLADANTGQ-------QNEVTCLEWAPAGQSLLTGVESGELRLWS-VEGKLQNIL 231
           + +++ L D  +G+       +NE T L W  AG  L  G  +G + ++  V+ K    L
Sbjct: 310 LGKSIFLTDNGSGEVVHLCDTENEYTSLSWVGAGSHLAVGQGNGLVEIYDVVKRKCVRTL 369

Query: 232 SYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATW- 290
           S H   + C+ WN    H+LT  + +  I+   +       F      ++E  G+   W 
Sbjct: 370 SGHVDRVACLSWNG---HILTSGSRDHNILHRDVR-MPDPFFERLNTHSQEVCGLQ--WN 423

Query: 291 IDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLS---ASDDNTL 347
            +++K A  G    + V++     P+ K   H   +  +A++ H + +L+    + D  L
Sbjct: 424 TEENKLASGGNDNVVCVYDGTSRNPMIKFIEHKAAVKALAWSPHKRGILATGGGTVDRRL 483

Query: 348 RVW 350
           ++W
Sbjct: 484 KIW 486

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 47/115 (40%), Gaps = 20/115 (17%)

Query: 149 WNPKHEGVFAYGERDSRAAVVTYSVADGLWNISETVVLADANTGQQNEVTCLEWAPAGQS 208
           W+P   G+ A G        V   +   +WN++ ++ L+D +TG Q  V  + W+     
Sbjct: 464 WSPHKRGILATG-----GGTVDRRLK--IWNVNTSMKLSDVDTGSQ--VCNMIWSKNTDE 514

Query: 209 LLT--GVESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIV 261
           ++T  G     L LW               P+  +K +S     LT  AD  T+V
Sbjct: 515 IVTSHGYSKYHLTLWDYPTM---------NPVAILKGHSFRVLHLTLSADGTTVV 560

>YLR222C (UTP13) [3622] chr12 complement(579320..581773) Component
           of U3 snoRNP (also called small subunit processome),
           which is required for 18S rRNA biogenesis,
           overproduction causes chromosome instability and
           increased mitotic recombination, contains WD (WD-40)
           repeats [2454 bp, 817 aa]
          Length = 817

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 59/121 (48%), Gaps = 3/121 (2%)

Query: 296 FAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNL 355
           FA      +  ++N+   +    L  H + L  +++ +++KLL ++S D T+++W     
Sbjct: 506 FATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTF 565

Query: 356 NPSHVFYGHSQSITSAHWVDDDT-IISTSMDGSIRVWSLASNSTVASATVDGVPNFTGAL 414
           +      GH+ ++    +++    +IS   DG I++W  +S   +   T+DG  N   AL
Sbjct: 566 SVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIWDCSSGECL--KTLDGHNNRLWAL 623

Query: 415 S 415
           S
Sbjct: 624 S 624

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 65/143 (45%), Gaps = 7/143 (4%)

Query: 295 KFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGN 354
           K+ IP    S+ V  I +S+       H K +  ++ + ++ +  +AS D T ++W   N
Sbjct: 465 KWIIPKPTASMDVQIIKVSEYTR--HAHEKDINALSVSPNDSIFATASYDKTCKIWNLEN 522

Query: 355 LNPSHVFYGHSQSITSAHWVDDDTIISTSM-DGSIRVWSLASNSTVASATVDGVPNFTGA 413
                    H + +    +   D +++TS  D ++++WSL + S +   T++G  N    
Sbjct: 523 GELEATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSVM--KTLEGHTNAVQR 580

Query: 414 LS--PDQGKFATGTLDGEVMVYD 434
            S    Q +  +   DG + ++D
Sbjct: 581 CSFINKQKQLISCGADGLIKIWD 603

 Score = 32.3 bits (72), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 29/160 (18%), Positives = 64/160 (40%), Gaps = 7/160 (4%)

Query: 234 HRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQ 293
           H   I  +  + +++   T   D    +WN+ +G      +  + G       D ++   
Sbjct: 490 HEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLANHKRGLW-----DVSFCQY 544

Query: 294 DKF-AIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRG 352
           DK  A      ++ ++++     +  L GH+  +   ++    K L+S   D  +++W  
Sbjct: 545 DKLLATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIWDC 604

Query: 353 GNLNPSHVFYGHSQSITSAHWVDD-DTIISTSMDGSIRVW 391
            +        GH+  + +   ++D D I+S   DG  + W
Sbjct: 605 SSGECLKTLDGHNNRLWALSTMNDGDMIVSADADGVFQFW 644

 Score = 30.4 bits (67), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 26/162 (16%), Positives = 68/162 (41%), Gaps = 7/162 (4%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWSVE-GKLQNILSYHRAPIVCIKWNSDETHV 250
             + ++  L  +P      T       ++W++E G+L+  L+ H+  +  + +   +  +
Sbjct: 489 AHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDKLL 548

Query: 251 LTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIP-GIQGSILVFN 309
            T   D    +W++ + + ++         +       ++I++ K  I  G  G I +++
Sbjct: 549 ATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQR-----CSFINKQKQLISCGADGLIKIWD 603

Query: 310 IGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWR 351
               + +  L GH+  L  ++      +++SA  D   + W+
Sbjct: 604 CSSGECLKTLDGHNNRLWALSTMNDGDMIVSADADGVFQFWK 645

>Scas_704.40
          Length = 608

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 86/208 (41%), Gaps = 30/208 (14%)

Query: 209 LLTGVESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGT 268
           +++G     +++W VE +    L  H   + C+K +       +   D    +W++ + +
Sbjct: 346 IVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNS 405

Query: 269 AVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRG------- 321
            ++ F       ++ + +  T ID +   +  I GS    N G  +P             
Sbjct: 406 CLKVFRGHVGQVQKVIPL--TIIDAENLVVDNISGS----NEGDDEPASTTTPTAAIAAE 459

Query: 322 ------HSKTL-TTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHW- 373
                  ++TL  +I Y  H   LLS S DNT+++W           +GH + +    W 
Sbjct: 460 AATNDEENQTLDKSIPYPTH---LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGV----WD 512

Query: 374 --VDDDTIISTSMDGSIRVWSLASNSTV 399
              D+  IIS S DGSI++W L S   +
Sbjct: 513 IAADNFRIISGSHDGSIKIWDLQSGKCM 540

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 80/184 (43%), Gaps = 15/184 (8%)

Query: 209 LLTGVESGELRLWSV-EGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSG 267
           L TG     + +W +   KL   LS H   +  + +  DE  ++T   D    VWN  +G
Sbjct: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYKTG 323

Query: 268 TAVQHFSFKEAGTEESLGVDATWIDQDKFAIPG-IQGSILVFNIGISKPIGKLRGHSKTL 326
             +  +      T+  + VDA      K  + G    ++ ++++  S+    LRGH++ +
Sbjct: 324 ECISTY---RGHTDSVMSVDAF----KKIIVSGSADKTVKIWHVE-SRTCYTLRGHTEWV 375

Query: 327 TTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGH---SQSITSAHWVDDDTIISTS 383
             +  +  +    S SDD T+R+W     +   VF GH    Q +     +D + ++  +
Sbjct: 376 NCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDN 435

Query: 384 MDGS 387
           + GS
Sbjct: 436 ISGS 439

 Score = 36.6 bits (83), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 41/89 (46%), Gaps = 8/89 (8%)

Query: 350 WRGGNLNPSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVA--SATVDGV 407
           WR GN      F GH   + +  + +   + + S D ++ +W L SN  +   S   DGV
Sbjct: 239 WRKGNCQVQE-FKGHMDGVLTLQF-NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGV 296

Query: 408 PNFTGALSPDQGKFATGTLDGEVMVYDIQ 436
                 L  D+ K  TG+LD  + V++ +
Sbjct: 297 K----TLYFDEAKLVTGSLDKTIRVWNYK 321

>Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement
          Length = 997

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 54/98 (55%), Gaps = 7/98 (7%)

Query: 301 IQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHV 360
           + G + ++++     +  L GH  ++  +  +++ + ++S SDD ++++W   NL    +
Sbjct: 159 VMGGVFIWDLFSETKVHNLLGHEGSIFYVTLSKNGEYVVSCSDDRSIKLW---NLKSGEL 215

Query: 361 F---YGHSQSITSAHWVDDDT-IISTSMDGSIRVWSLA 394
               +GH+  I    ++D+DT ++S S D + RVW +A
Sbjct: 216 LSTGWGHTARIWQLKFIDNDTKVVSVSEDCTCRVWDIA 253

>YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741)
           Coatomer (COPI) complex beta' chain (beta'-COP) of
           secretory pathway vesicles, required for retrograde
           transport from Golgi to endoplasmic reticulum, member of
           the WD (WD-40) repeat family [2670 bp, 889 aa]
          Length = 889

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 58/138 (42%), Gaps = 6/138 (4%)

Query: 305 ILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWR-GGNLNPSHVFYG 363
           I VFN    + +     H   + +IA +     +LS SDD T+++W    N      F G
Sbjct: 79  IRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEG 138

Query: 364 HSQSITSAHW--VDDDTIISTSMDGSIRVWSLA---SNSTVASATVDGVPNFTGALSPDQ 418
           H   +    +   D  T  S  +D +++VWSL     N T+ +    GV        PD+
Sbjct: 139 HEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDK 198

Query: 419 GKFATGTLDGEVMVYDIQ 436
               T + D  + ++D Q
Sbjct: 199 PYMITASDDLTIKIWDYQ 216

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 68/338 (20%), Positives = 125/338 (36%), Gaps = 33/338 (9%)

Query: 160 GERDSRAAVVTYSVADGLWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELR 219
           G  D R  V  Y       N  E VV  +A     + +  +   P    +L+G +   ++
Sbjct: 73  GSDDFRIRVFNY-------NTGEKVVDFEA---HPDYIRSIAVHPTKPYVLSGSDDLTVK 122

Query: 220 LWSVEGK--LQNILSYHRAPIVCIKWNSDETHVLTCDADNMTI-VWNVLSGTAVQHFSFK 276
           LW+ E    L+     H   ++C+ +N  +         + T+ VW++  G +  +F+  
Sbjct: 123 LWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSL--GQSTPNFTLT 180

Query: 277 EAGTEESLG-VDATWIDQDKFAIPGIQG-SILVFNIGISKPIGKLRGHSKTLTTIAYNEH 334
             G E  +  VD   +    + I      +I +++      +  L GH   ++   ++  
Sbjct: 181 -TGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPT 239

Query: 335 NKLLLSASDDNTLRVWRGGNLNPSHVF-YGHSQS-ITSAHWVDDDTIISTSMDGSIRVWS 392
             +++S S+D TL++W             G  +S   + H       I++  D    V S
Sbjct: 240 LPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLS 299

Query: 393 LASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQKLLQQLNHNGY----- 447
           L ++    S    G   ++G  +       T  + G   V   + L  Q    G      
Sbjct: 300 LGNDEPTLSLDPVGKLVWSGGKNAAASDIFTAVIRGNEEVEQDEPLSLQTKELGSVDVFP 359

Query: 448 HGTARSAEVARIPVVGDHRSAREGNYV--TQISWSQES 483
              A S     + VVGD      G YV  T ++W  ++
Sbjct: 360 QSLAHSPNGRFVTVVGD------GEYVIYTALAWRNKA 391

>AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146)
           [2931 bp, 976 aa]
          Length = 976

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 51/106 (48%), Gaps = 1/106 (0%)

Query: 301 IQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHV 360
           + G ++V+ +     + +L GH  ++     ++  +L+ S SDD ++RVW         +
Sbjct: 159 VMGGVVVWELHTGAVVQRLEGHEGSIFCAVVSDDGRLVASCSDDRSIRVWSLETGEQVGI 218

Query: 361 FYGHSQSITSAHWVD-DDTIISTSMDGSIRVWSLASNSTVASATVD 405
            +GH+  I    ++   D ++S S D + RVW++ +      A  D
Sbjct: 219 AWGHTARIWDLRFLRVADKLVSVSEDCTCRVWAVGAERMQEEAVYD 264

>ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH]
           complement(590077..591354) [1278 bp, 425 aa]
          Length = 425

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 69/161 (42%), Gaps = 9/161 (5%)

Query: 291 IDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW 350
           +D   FA      +I V+++   K    L+GH  T+  I  +  +  + SAS D  ++ W
Sbjct: 124 VDNAWFATGSNDSTIRVWDLATGKLKVTLQGHIMTVRDICISARHPYMFSASQDKLVKCW 183

Query: 351 RGGNLNPSHVFYGHSQSITSAHWVD----DDTIISTSMDGSIRVWSLASNSTVASATVDG 406
              +L  + V      +++  H VD     D I+S   D  +RVW + S S V +     
Sbjct: 184 ---DLERNTVVRDFHGTLSGVHSVDLHPSLDLIVSAGRDSVVRVWDIRSRSCVLTLAGHR 240

Query: 407 VPNFTGALSPDQGKFATGTLDGEVMVYDI--QKLLQQLNHN 445
            P       P   +  + + D  V ++D+   K ++ L H+
Sbjct: 241 GPINKVRCLPVDPQIVSCSTDATVKLWDLVAGKPMKTLTHH 281

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 50/249 (20%), Positives = 98/249 (39%), Gaps = 10/249 (4%)

Query: 192 GQQNEVTCLEWAPAGQS-LLTGVESGELRLWSVE-GKLQNILSYHRAPIVCIKWNSDETH 249
           G    V C+   P   +   TG     +R+W +  GKL+  L  H   +  I  ++   +
Sbjct: 111 GHTGWVRCVCVDPVDNAWFATGSNDSTIRVWDLATGKLKVTLQGHIMTVRDICISARHPY 170

Query: 250 VLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFN 309
           + +   D +   W++   T V+ F    +G   S+ +  +    D     G    + V++
Sbjct: 171 MFSASQDKLVKCWDLERNTVVRDFHGTLSGVH-SVDLHPS---LDLIVSAGRDSVVRVWD 226

Query: 310 IGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSIT 369
           I     +  L GH   +  +     +  ++S S D T+++W      P      H +++ 
Sbjct: 227 IRSRSCVLTLAGHRGPINKVRCLPVDPQIVSCSTDATVKLWDLVAGKPMKTLTHHKRNVR 286

Query: 370 SAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVD--GVPNFTGALSPDQGKFATGTLD 427
              +   +   +++    IR W L     + +   +  G+ N T A + D   FA G   
Sbjct: 287 DLAFNPTEFSFASACTDDIRSWKLVDGQLLTNFNSEALGIVN-TLACNQDGVLFAGGDT- 344

Query: 428 GEVMVYDIQ 436
           GE+  +D +
Sbjct: 345 GELSFFDYK 353

>CAGL0H08932g join(871668..871685,872089..874779) highly similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
          Length = 902

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 58/138 (42%), Gaps = 6/138 (4%)

Query: 305 ILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGN-LNPSHVFYG 363
           + VFN    + +     H   + +IA +     +L+ SDD T+++W   N  +    F G
Sbjct: 79  VRVFNYNTGEKVADFVAHPDYIRSIAVHPSKPYILTGSDDLTVKLWNWENDWSLEQTFKG 138

Query: 364 HSQSITSAHW--VDDDTIISTSMDGSIRVWSLA---SNSTVASATVDGVPNFTGALSPDQ 418
           H   +    +   D +   S  +D  ++VWSL     N T+ +    GV        PD+
Sbjct: 139 HEHFVMCVAFNPKDPNVFASGCLDHKVKVWSLGQSTPNFTLHTGQEKGVNYVDYYPLPDK 198

Query: 419 GKFATGTLDGEVMVYDIQ 436
               T + D  V ++D Q
Sbjct: 199 PYMITSSDDTTVKIFDYQ 216

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 41/205 (20%), Positives = 86/205 (41%), Gaps = 10/205 (4%)

Query: 204 PAGQSLLTGVESGELRLWSVEG--KLQNILSYHRAPIVCIKWNSDETHVLTCDA-DNMTI 260
           P+   +LTG +   ++LW+ E    L+     H   ++C+ +N  + +V      D+   
Sbjct: 107 PSKPYILTGSDDLTVKLWNWENDWSLEQTFKGHEHFVMCVAFNPKDPNVFASGCLDHKVK 166

Query: 261 VWNVLSGTAVQHFSFKEAGTEESLG-VDATWIDQDKFAIPGIQGS-ILVFNIGISKPIGK 318
           VW++  G +  +F+    G E+ +  VD   +    + I     + + +F+      +  
Sbjct: 167 VWSL--GQSTPNFTL-HTGQEKGVNYVDYYPLPDKPYMITSSDDTTVKIFDYQTKSCVAT 223

Query: 319 LRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVF-YGHSQS-ITSAHWVDD 376
           L GH   ++   ++    +++S S+D T+++W             G  +S   + H V  
Sbjct: 224 LEGHMSNVSFAVFHPTLPIIISGSEDGTVKLWNSSTYKLEKTLNLGLERSWCIATHPVGR 283

Query: 377 DTIISTSMDGSIRVWSLASNSTVAS 401
              I++  D    V SL ++    S
Sbjct: 284 KNCIASGFDNGFTVLSLGNDMPTLS 308

>Kwal_27.12053
          Length = 755

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 52/259 (20%), Positives = 110/259 (42%), Gaps = 20/259 (7%)

Query: 195 NEVTCLEWAPAGQSLLTGVESGELRLWSVEGK-LQNILSY-------------HRAPIVC 240
           +E+T LE++   +    G +   +++WS++G+ L+N L               H   +  
Sbjct: 428 SEMTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLVGHSGTVYS 487

Query: 241 IKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPG 300
             ++ D  ++L+   D    +W+  + T++ ++     G    +   A       FA   
Sbjct: 488 TSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNY----KGHNHPIWDVAFSPLGHYFATAS 543

Query: 301 IQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHV 360
              +  +++     P+    GH   + T++++ +   + + S D T R+W   + +   +
Sbjct: 544 HDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDSVRL 603

Query: 361 FYGHSQSITSAHWVDDDTIIST-SMDGSIRVWSLASNSTVASATVDGVPN-FTGALSPDQ 418
           F GH+  +TS     D   +ST S DG I VW + +   +      G    ++ + S + 
Sbjct: 604 FLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEG 663

Query: 419 GKFATGTLDGEVMVYDIQK 437
               +G  D  V V+D++K
Sbjct: 664 HVLISGGADHSVRVWDVKK 682

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/224 (20%), Positives = 88/224 (39%), Gaps = 50/224 (22%)

Query: 177 LWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQ-NILSYHR 235
           LW+      L +   G  + +  + ++P G    T       RLWS +      I + H 
Sbjct: 508 LWSTDTYTSLVNYK-GHNHPIWDVAFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHL 566

Query: 236 APIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAG-TEESLGVDATWIDQD 294
             +  + ++ + T+V T  +D    +W++ SG +V+ F    A  T  ++  D  W+   
Sbjct: 567 NDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSPDGRWL--- 623

Query: 295 KFAIPGIQGSILVFNIGISKPIGKLRGHSKT-LTTIAYNEHNKLLLSASDDNTLRVWRGG 353
             +     G I V++IG  K + ++RGH K  + +++Y++   +L+S           GG
Sbjct: 624 --STGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLIS-----------GG 670

Query: 354 NLNPSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNS 397
                                          D S+RVW +  ++
Sbjct: 671 ------------------------------ADHSVRVWDVKKST 684

 Score = 33.1 bits (74), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 41/81 (50%), Gaps = 4/81 (4%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWSV-EGK-LQNILSYHRAPIVCIKWNSDETH 249
           G    VT    +P G+ L TG E G + +W +  GK L+ +  + +  +  + + S E H
Sbjct: 606 GHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLSY-SKEGH 664

Query: 250 VL-TCDADNMTIVWNVLSGTA 269
           VL +  AD+   VW+V   TA
Sbjct: 665 VLISGGADHSVRVWDVKKSTA 685

>AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH]
           complement(1061522..1063999) [2478 bp, 825 aa]
          Length = 825

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 73/193 (37%), Gaps = 28/193 (14%)

Query: 312 ISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRG--GNLNP------------ 357
           + KP+  +  H+ ++T + ++  NK L S SDD  L +W    G + P            
Sbjct: 66  LRKPLANMSRHTGSVTALKFSPDNKYLASGSDDKILLIWEKEEGAVQPLFDMENDLEHWN 125

Query: 358 -SHVFYGHSQSITSAHWVDDDTIIST-SMDGSIRVWSLASNSTVASATVDGVPNFTGALS 415
                  H   I    W  D +I+ T  +D SI VW+ ++   +    V           
Sbjct: 126 VRRRLVAHDNDIQDICWAPDSSILVTVGLDRSIIVWNGSTFEKIKRFDVHQSHVKGVVFD 185

Query: 416 PDQGKFATGTLDGEVMVYDIQKLLQQLNHNGYHGTARSAEVARIPVVGDHRSAREGNYVT 475
           P    FAT + D  V V+   K           GT  S  +  I +    + +    Y  
Sbjct: 186 PANKYFATASDDRTVKVFRYHK-----------GTDLSFTIEHI-ITEPFQGSPLTTYFR 233

Query: 476 QISWSQESTQLSV 488
           ++SWS +   ++V
Sbjct: 234 RLSWSPDGQHIAV 246

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 2/58 (3%)

Query: 335 NKLLLSASDDNTLRVWRGGNLNPSHVFYG-HSQSITSAHWVDDDT-IISTSMDGSIRV 390
           + ++ +A  D TL VW      P  V Y   S+S+T   W  D T +  TS+DG I V
Sbjct: 326 DSVIATAGQDKTLAVWSTSRARPIFVAYDLTSKSVTDIAWTCDGTALFLTSLDGRIIV 383

 Score = 29.6 bits (65), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 41/98 (41%), Gaps = 16/98 (16%)

Query: 197 VTCLEWAPAGQSLLTGVESGELRLWSVE-GKLQNI---------------LSYHRAPIVC 240
           VT L+++P  + L +G +   L +W  E G +Q +               L  H   I  
Sbjct: 80  VTALKFSPDNKYLASGSDDKILLIWEKEEGAVQPLFDMENDLEHWNVRRRLVAHDNDIQD 139

Query: 241 IKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEA 278
           I W  D + ++T   D   IVWN  +   ++ F   ++
Sbjct: 140 ICWAPDSSILVTVGLDRSIIVWNGSTFEKIKRFDVHQS 177

>KLLA0B01958g join(170646..170663,170896..173550) similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
           coatomer complex beta chain (beta -cop) of secretory
           pathway vesicles, hypothetical start
          Length = 890

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/213 (22%), Positives = 85/213 (39%), Gaps = 12/213 (5%)

Query: 231 LSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATW 290
           LS     +  I ++ +E  VL         +WN  + T V+     +A           +
Sbjct: 9   LSARTDRVKGIDFHPEEPWVLITLYSGRIEIWNYETQTQVRSIPLCDAPVRA-----GRF 63

Query: 291 IDQDKFAIPGIQG-SILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRV 349
           I +  + + G     + V+N    + + +   H   + +IA +     +L+ SDD T+++
Sbjct: 64  IARKNWVVVGSDDFKLRVYNYNTGEKVTEFEAHPDYIRSIAVHPTKPFVLTGSDDLTIKL 123

Query: 350 WR-GGNLNPSHVFYGHSQSITSAHW--VDDDTIISTSMDGSIRVWSLA---SNSTVASAT 403
           W    N      F GH   + S  +   D +   S  +D +I+VWS+     N T+ +  
Sbjct: 124 WNWEKNWGCQQTFTGHEHFVMSVAFNPKDPNQFASGCLDHTIKVWSIGQDVPNFTLKAHE 183

Query: 404 VDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQ 436
             GV         D+    T + DG + V+D Q
Sbjct: 184 TKGVNYVDYYPLQDKPYLITTSDDGTIKVWDYQ 216

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 62/270 (22%), Positives = 117/270 (43%), Gaps = 29/270 (10%)

Query: 191 TGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQ-NILSYHRAPIVCIKWNSDETH 249
           + + + V  +++ P    +L  + SG + +W+ E + Q   +    AP+   ++ + +  
Sbjct: 10  SARTDRVKGIDFHPEEPWVLITLYSGRIEIWNYETQTQVRSIPLCDAPVRAGRFIARKNW 69

Query: 250 VLTCDADNMTIVWNVLSGTAVQHFSFKEAGTE--ESLGVDATWIDQDKFAIPGIQGSILV 307
           V+    D    V+N  +G  V  F   EA  +   S+ V  T      F + G     + 
Sbjct: 70  VVVGSDDFKLRVYNYNTGEKVTEF---EAHPDYIRSIAVHPT----KPFVLTGSDDLTIK 122

Query: 308 F-----NIGISKPIGKLRGHSKTLTTIAYNEHN-KLLLSASDDNTLRVWRGGNLNPSHVF 361
                 N G  +      GH   + ++A+N  +     S   D+T++VW  G   P+   
Sbjct: 123 LWNWEKNWGCQQ---TFTGHEHFVMSVAFNPKDPNQFASGCLDHTIKVWSIGQDVPNFTL 179

Query: 362 YGH-SQSITSAHWV---DDDTIISTSMDGSIRVWSLASNSTVASATVDG-VPNFTGA-LS 415
             H ++ +    +    D   +I+TS DG+I+VW   + S V  AT++G + N + A   
Sbjct: 180 KAHETKGVNYVDYYPLQDKPYLITTSDDGTIKVWDYQTKSNV--ATLEGHMANVSYAVFH 237

Query: 416 PDQGKFATGTLDGEVMVYDIQ--KLLQQLN 443
           P      +G+ DG + +++    KL + LN
Sbjct: 238 PTLPIIISGSEDGTLKIWNANTYKLEKTLN 267

>Sklu_675.1 YMR146C, Contig c675 761-1687
          Length = 308

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 44/88 (50%), Gaps = 4/88 (4%)

Query: 314 KPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHW 373
           +PI  L+GH ++LT + YN    L+ S + D+   VW   N      F GH  +I S   
Sbjct: 2   RPI-MLKGHERSLTQVKYNREGDLIFSCAKDSVASVWYAINGERLGTFEGHMGTIWSID- 59

Query: 374 VDDDT--IISTSMDGSIRVWSLASNSTV 399
           VD  T   ++ S D S+++W +   S V
Sbjct: 60  VDQFTEYAVTGSADFSVKLWKVCDGSNV 87

>Scas_679.28
          Length = 815

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/121 (20%), Positives = 59/121 (48%), Gaps = 3/121 (2%)

Query: 296 FAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNL 355
           FA      +  ++++   +    L  H + L  +A+ +++KL+ + S D T+++W     
Sbjct: 506 FATASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDKLIATCSGDKTIKIWSLDTF 565

Query: 356 NPSHVFYGHSQSITSAHWVDDDT-IISTSMDGSIRVWSLASNSTVASATVDGVPNFTGAL 414
           +      GH+ ++    +++    ++S+  DG I++W  ++   +   T+DG  N   AL
Sbjct: 566 SVMKTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWDCSTGDCL--KTLDGHDNRIWAL 623

Query: 415 S 415
           +
Sbjct: 624 T 624

 Score = 38.5 bits (88), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 55/118 (46%), Gaps = 5/118 (4%)

Query: 320 RGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDTI 379
           R H K +  +A + ++ +  +AS D T ++W   N   +     H + +    +   D +
Sbjct: 488 RAHEKDINALAISPNDSIFATASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDKL 547

Query: 380 IST-SMDGSIRVWSLASNSTVASATVDGVPNFT--GALSPDQGKFATGTLDGEVMVYD 434
           I+T S D +I++WSL + S +   T++G  N          Q +  +   DG + ++D
Sbjct: 548 IATCSGDKTIKIWSLDTFSVM--KTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWD 603

 Score = 36.6 bits (83), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 60/138 (43%), Gaps = 22/138 (15%)

Query: 321 GHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNL----NPSHVFYGHSQSITSAHWVD- 375
           GH   L ++   +    + +AS D+T  VW+  ++     P   F GHS ++T+    + 
Sbjct: 384 GHEDLLNSLDTTDDGLWMATASKDHTAIVWKYNSIINKFQPYVKFIGHSATVTAVGLPNV 443

Query: 376 -----DDTIISTSMDGSIRVWSLASNSTVA--SATVDGVPNFTG----------ALSPDQ 418
                 + +++ S D +I+ W +   ST       +  V  +T           A+SP+ 
Sbjct: 444 MLRGYPEFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINALAISPND 503

Query: 419 GKFATGTLDGEVMVYDIQ 436
             FAT + D    ++D++
Sbjct: 504 SIFATASYDKTCKIWDLE 521

 Score = 33.5 bits (75), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 25/161 (15%), Positives = 62/161 (38%), Gaps = 5/161 (3%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWSVE-GKLQNILSYHRAPIVCIKWNSDETHV 250
             + ++  L  +P      T       ++W +E G+L   LS H+  +  + +   +  +
Sbjct: 489 AHEKDINALAISPNDSIFATASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDKLI 548

Query: 251 LTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNI 310
            TC  D    +W++ + + ++         +  + ++     Q +    G  G I +++ 
Sbjct: 549 ATCSGDKTIKIWSLDTFSVMKTLEGHTNAVQRCMFINK----QLQLVSSGADGLIKIWDC 604

Query: 311 GISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWR 351
                +  L GH   +  +       +++SA  D   + W+
Sbjct: 605 STGDCLKTLDGHDNRIWALTEINDGDMIVSADADGVFQFWK 645

>KLLA0E21879g complement(1944865..1945866) similar to sgd|S0002675
           Saccharomyces cerevisiae YDR267c, start by similarity
          Length = 333

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 65/326 (19%), Positives = 118/326 (36%), Gaps = 86/326 (26%)

Query: 155 GVFAYGERDSRAAVVTYSVADGLWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVE 214
           G+ A G  D +  +V           S  ++    +T  +  V  + W P    L  G  
Sbjct: 26  GIMATGSTDRKIKLVDIR--------SFQIIEELDDTAHKKTVRSVAWRPHSNILAAGSF 77

Query: 215 SGELRLW-----------SVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWN 263
              + +W            +E +L  I+  H   I C+ W+ D   + TC  D    +W 
Sbjct: 78  DSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWE 137

Query: 264 VLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHS 323
                        E G E                                + I  L+ HS
Sbjct: 138 A-----------DEMGEE-------------------------------FECISVLQEHS 155

Query: 324 KTLTTIAYNEHNKLLLSASDDNTLRVWR--GGNLNPSHVFYGHSQSITSAHWVDDDT--- 378
           + +  + +++   LL S+S D+T+R+W+    +     V  GH  ++ S+ +   ++   
Sbjct: 156 QDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVR 215

Query: 379 IISTSMDGSIRVWSLASN-----------STVASATVDGVPNFTGALSPDQGKFATGTLD 427
           + S S DG++R+W L  +           S +  A    V  ++   SP +G  A+   D
Sbjct: 216 LCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAV--YSVNWSP-KGYIASTGSD 272

Query: 428 GEVMVYD------IQKLLQQLNHNGY 447
           G +++Y       I + + +L H  Y
Sbjct: 273 GRLVIYKESEDGWIVECIHELTHGVY 298

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 53/261 (20%), Positives = 92/261 (35%), Gaps = 67/261 (25%)

Query: 149 WNPKHEGVFAYGERDSRAAVVTYSVADGLWNIS---ETVVLADANTGQQNEVTCLEWAPA 205
           W P H  + A G  DS  ++  +   D  +N     ET +LA    G +NE+ C+ W+  
Sbjct: 65  WRP-HSNILAAGSFDSTVSI--WGKDDDGYNDENDLETELLA-IIEGHENEIKCVAWSHD 120

Query: 206 GQSLLTGVESGELRLWSV-----EGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTI 260
           G+ L T      + +W       E +  ++L  H   +  + W+     + +   D+   
Sbjct: 121 GELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVR 180

Query: 261 VWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLR 320
           +W                        D  W                       +    L 
Sbjct: 181 IWK---------------------DCDDDW-----------------------ECCAVLN 196

Query: 321 GHSKTLTTIAYNEHNK--LLLSASDDNTLRVWRGGNLN---------PSHVFYGHSQSIT 369
           GH  T+ +  + + N    L S SDD T+R+W   + N          S +   H++++ 
Sbjct: 197 GHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVY 256

Query: 370 SAHWVDDDTIISTSMDGSIRV 390
           S +W     I ST  DG + +
Sbjct: 257 SVNWSPKGYIASTGSDGRLVI 277

>Scas_658.1
          Length = 442

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 61/136 (44%), Gaps = 6/136 (4%)

Query: 306 LVFNIGISKPIG-KLRGHSKTLTTIAY--NEHNKLLLSASDDNTLRVWRG-GNLNPSHVF 361
           L F   + K I   + GH+   T++ +  N  N LLLS  +DN ++VW      N    +
Sbjct: 131 LSFKCFLPKKIKYAMDGHTNGTTSLTFLPNSGN-LLLSGGNDNIVKVWDFYHKRNLLRDY 189

Query: 362 YGHSQSITSAHWVDDDT-IISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGK 420
            GHS++I S  + DD T  IS+S D +I++W                PN       +  +
Sbjct: 190 KGHSKAINSLDFNDDGTNFISSSFDHTIKIWDTEQGKVKTKLHFKSTPNDVKFRPFNSSE 249

Query: 421 FATGTLDGEVMVYDIQ 436
           F  G  + ++  YD +
Sbjct: 250 FIVGFANSKIYHYDTR 265

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/168 (21%), Positives = 70/168 (41%), Gaps = 10/168 (5%)

Query: 189 ANTGQQNEVTCLEWAP-AGQSLLTGVESGELRLWSVEGKLQNILSY--HRAPIVCIKWNS 245
           A  G  N  T L + P +G  LL+G     +++W    K   +  Y  H   I  + +N 
Sbjct: 144 AMDGHTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDFYHKRNLLRDYKGHSKAINSLDFND 203

Query: 246 DETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSI 305
           D T+ ++   D+   +W+   G       FK    +    V     +  +F +      I
Sbjct: 204 DGTNFISSSFDHTIKIWDTEQGKVKTKLHFKSTPND----VKFRPFNSSEFIVGFANSKI 259

Query: 306 LVFNIGISKPIGKLR---GHSKTLTTIAYNEHNKLLLSASDDNTLRVW 350
             ++  IS+  G+++    H  ++  + +       +S+S+D T+R+W
Sbjct: 260 YHYDTRISENDGRVQVYDHHMSSILALKFFPDGSKFISSSEDKTVRIW 307

>AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH]
           complement(1497416..1499560) [2145 bp, 714 aa]
          Length = 714

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 57/117 (48%), Gaps = 6/117 (5%)

Query: 319 LRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDT 378
           L GHS  +   A    +  L+S+S D T RVWR G         GH+ ++  A  +  D 
Sbjct: 104 LAGHSGNVC--ALEARDGQLVSSSWDQTARVWREG--TEERALSGHNATVWHALALGYDR 159

Query: 379 IISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDI 435
            ++ S D +I++W  A +    +   D V +   AL+PD   FA+ + DG V V+ +
Sbjct: 160 FLTASADKTIKLWDGARDLATYNVHTDVVRHL--ALAPDGHHFASCSNDGSVKVHTL 214

 Score = 33.1 bits (74), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 54/122 (44%), Gaps = 9/122 (7%)

Query: 200 LEWAPAGQSLLTGVESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMT 259
           L  AP G    +    G +++ +++GK       H + + C+K+  D   +++C  D   
Sbjct: 191 LALAPDGHHFASCSNDGSVKVHTLDGKTVRTFDGHESFVYCVKYLPD-GGLVSCGEDKTV 249

Query: 260 IVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISK--PIG 317
            VW+ +SG   Q      A +  SL V    +      + G  G IL+F +  ++  P+ 
Sbjct: 250 RVWD-MSGHVRQVIRLC-ATSLWSLDV----LPNGDIVVGGSDGKILIFTVDPARVAPVE 303

Query: 318 KL 319
           +L
Sbjct: 304 EL 305

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 19/35 (54%)

Query: 358 SHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWS 392
           S    GHS  + S   + D  I S S DG++RVW+
Sbjct: 11  SSSLLGHSMDVKSVVAISDTQIASGSRDGTVRVWT 45

>Kwal_23.4118
          Length = 939

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 74/169 (43%), Gaps = 7/169 (4%)

Query: 261 VWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLR 320
           V+N+ SG   + +   +      + VD       K    G+ G +  ++   S  +GKL+
Sbjct: 487 VYNLQSGLPRKKYRLHKKAVS-GIAVDGM---NRKMVSCGLDGIVGFYDFSKSSYLGKLQ 542

Query: 321 GHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDT-I 379
             +  +T++ Y+  + L   A DD ++ V            +GHS  I+S  +  D   I
Sbjct: 543 LDA-PVTSMVYHRSSDLFALALDDFSIVVVDAVTQKVVRQLWGHSNRISSFDFSPDGRWI 601

Query: 380 ISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDG 428
           ISTS+DG+ R W L +   +    +D V       SP+    AT  ++G
Sbjct: 602 ISTSLDGTARTWDLPTGCCIDGIRLDSVAT-NIRFSPNADFVATTHVNG 649

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 31/155 (20%), Positives = 64/155 (41%), Gaps = 18/155 (11%)

Query: 203 APAGQSLLTGVESGELRLWSVEGKL-QNILSYHRAPIVCIKWNSDETHVLTCDADNMTIV 261
           +P G     G  +G + +++++  L +     H+  +  I  +     +++C  D +   
Sbjct: 470 SPCGNFGFVGSSNGGIGVYNLQSGLPRKKYRLHKKAVSGIAVDGMNRKMVSCGLDGI--- 526

Query: 262 WNVLSGTAVQHFSFKEAGTEESLGVDATWIDQ------DKFAIPGIQGSILVFNIGISKP 315
                   V  + F ++     L +DA           D FA+     SI+V +    K 
Sbjct: 527 --------VGFYDFSKSSYLGKLQLDAPVTSMVYHRSSDLFALALDDFSIVVVDAVTQKV 578

Query: 316 IGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW 350
           + +L GHS  +++  ++   + ++S S D T R W
Sbjct: 579 VRQLWGHSNRISSFDFSPDGRWIISTSLDGTARTW 613

>Kwal_26.8776
          Length = 433

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 45/247 (18%), Positives = 97/247 (39%), Gaps = 6/247 (2%)

Query: 192 GQQNEVTCLEWAPAGQS-LLTGVESGELRLWSV-EGKLQNILSYHRAPIVCIKWNSDETH 249
           G    V C+   P   +   TG     +++W +  GKL+  L+ H   +  +  +     
Sbjct: 119 GHNGWVRCVCPDPVDNAWFATGSNDTTIKVWDMASGKLKLTLTGHVMTVRSVAVSQRHPL 178

Query: 250 VLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFN 309
           + +   D M   W++    A++ +    +G   ++ V  T    D  A  G    + +++
Sbjct: 179 MFSASEDKMVKCWDLERNAAIRDYHGHFSGVN-TVDVHPT---LDLIASAGRDAVVRLWD 234

Query: 310 IGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSIT 369
           I    P+  L GH   +  +     +  ++S S D T+R+W       + +   HS+S+ 
Sbjct: 235 IRTRLPVMTLAGHKSPINQVKCFPVDPQIMSCSSDATVRLWDIRAGKATKILTHHSKSVR 294

Query: 370 SAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGE 429
           +      ++ ++T+    +R W  +    + +   +G+           G    G  DG 
Sbjct: 295 AIAAHPAESSVATASTSDVRSWRHSDGQLLTNYHSEGIGIINSLSVNADGVLFGGGDDGN 354

Query: 430 VMVYDIQ 436
           +  +D +
Sbjct: 355 LSFFDYK 361

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 73/173 (42%), Gaps = 9/173 (5%)

Query: 291 IDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW 350
           +D   FA      +I V+++   K    L GH  T+ ++A ++ + L+ SAS+D  ++ W
Sbjct: 132 VDNAWFATGSNDTTIKVWDMASGKLKLTLTGHVMTVRSVAVSQRHPLMFSASEDKMVKCW 191

Query: 351 RGGNLNPSHVFYGHSQSITSAHWVDD----DTIISTSMDGSIRVWSLASNSTVASATVDG 406
                     ++GH   + +   VD     D I S   D  +R+W + +   V +     
Sbjct: 192 DLERNAAIRDYHGHFSGVNT---VDVHPTLDLIASAGRDAVVRLWDIRTRLPVMTLAGHK 248

Query: 407 VPNFTGALSPDQGKFATGTLDGEVMVYDIQ--KLLQQLNHNGYHGTARSAEVA 457
            P       P   +  + + D  V ++DI+  K  + L H+     A +A  A
Sbjct: 249 SPINQVKCFPVDPQIMSCSSDATVRLWDIRAGKATKILTHHSKSVRAIAAHPA 301

 Score = 36.2 bits (82), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 19/95 (20%), Positives = 46/95 (48%), Gaps = 2/95 (2%)

Query: 178 WNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNI-LSYHRA 236
           W++     + D + G  + V  ++  P    + +      +RLW +  +L  + L+ H++
Sbjct: 191 WDLERNAAIRDYH-GHFSGVNTVDVHPTLDLIASAGRDAVVRLWDIRTRLPVMTLAGHKS 249

Query: 237 PIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQ 271
           PI  +K    +  +++C +D    +W++ +G A +
Sbjct: 250 PINQVKCFPVDPQIMSCSSDATVRLWDIRAGKATK 284

>YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protein
           containing five WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           low similarity to a region of S. pombe Tup11p, which is
           a transcriptional repressor functioning redundantly with
           Tup12p [3042 bp, 1013 aa]
          Length = 1013

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 73/160 (45%), Gaps = 11/160 (6%)

Query: 250 VLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFN 309
           VL CD +   +    L G      S   +G  +  G D  +++        + G +++++
Sbjct: 115 VLICDLNCEVLFRKSLGGER----SILYSGIIKVFGPDKVYVNAGT-----VMGGVIIWD 165

Query: 310 IGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSIT 369
           +     I  L GH  ++  +  + + + + S SDD ++R+W         V + H+  I 
Sbjct: 166 LFSETKIHNLLGHEGSIFYVNLSNNGRYVASCSDDRSIRLWDLETGKQLSVGWSHTARIW 225

Query: 370 SAHWVDDDT-IISTSMDGSIRVWSLA-SNSTVASATVDGV 407
           +  + D+D+ +IS S D + RVW++  S   VA  ++  V
Sbjct: 226 NLMFFDNDSKLISVSEDCTCRVWNIIESRENVAELSISNV 265

>Kwal_33.13515
          Length = 398

 Score = 45.1 bits (105), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 42/85 (49%), Gaps = 3/85 (3%)

Query: 185 VLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEG---KLQNILSYHRAPIVCI 241
           + A  N    N+VT L+W+  G+ L  G ESGE+ L+ VE    KL+     H   I C+
Sbjct: 183 LCAGENLASLNKVTALQWSHDGKWLYAGFESGEIVLFEVEMAAVKLKVRACGHTGAITCM 242

Query: 242 KWNSDETHVLTCDADNMTIVWNVLS 266
           K + D   ++    D +   W++ S
Sbjct: 243 KLDPDNRFLVAGSLDTICSFWDLSS 267

>CAGL0F06853g 671942..673108 highly similar to sp|P20484
           Saccharomyces cerevisiae YKL021c MAK11 involved in cell
           growth and replication of M1 dsRNA virus, hypothetical
           start
          Length = 388

 Score = 45.1 bits (105), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 65/143 (45%), Gaps = 14/143 (9%)

Query: 305 ILVFNIGISKPIGKLRGHSKTLTTIAYNE---------HNKLLLSASDDNTLRVWRGGNL 355
           I ++++   K +G L  H  ++T + +++           K LLSAS+DN + VWR  + 
Sbjct: 63  IRIYDLQKRKELGTLLAHQGSITNLKFSKVSDQEPKSTSGKWLLSASEDNKIIVWRVKDW 122

Query: 356 NPSHVFYGHSQSITSAHWVDDDTII-STSMDGSIRVWSLASNSTVASATVDGVP---NFT 411
                  GH+  I        + ++ S S D SIR+W+L +    A   +        F 
Sbjct: 123 ENFGTLKGHTARINDMDIHPSNRVVASVSEDHSIRLWNLMTVKKAAVLKLKKYNQNGQFV 182

Query: 412 GALSPDQGKFATGTLDGEVMVYD 434
             L   QGK+   +L  +V++YD
Sbjct: 183 RWLKA-QGKYFAVSLMTKVLIYD 204

>Sklu_1645.2 YGL116W, Contig c1645 887-2650 reverse complement
          Length = 587

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 90/211 (42%), Gaps = 19/211 (9%)

Query: 200 LEWAPAGQSLLTGVESGELRLWSVE-GKLQNILSYHRAPIVCIKWNSDETHVLTCDADNM 258
           L W+     L   +ES  L LW+ E G +  +  +    I  + W+ D+ HV    +D  
Sbjct: 257 LSWSKK-NCLAIALESS-LYLWNGESGDVTLLTEFEAETISSVTWSDDDCHVSIGKSDGN 314

Query: 259 TIVWNVLSGTAVQHFSFKEAGTEESLGV---DATWIDQDKFAIPGIQGSILVFNIGISKP 315
           T +W+V + + V+            LGV     +W+D    A     G I + ++ I   
Sbjct: 315 TEIWDVETMSLVRTM-------RSGLGVRIGSQSWLDT-LVACGTKSGEIQINDVRIKNH 366

Query: 316 I-GKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWV 374
           I    + HS  +  ++Y +    L S S+DN++ +W      P  V   H+ ++ +  W 
Sbjct: 367 IVSAWQEHSGEVCGLSYRKDGLQLASGSNDNSVMIWDTRTSMPQFVKRNHTAAVKAISWC 426

Query: 375 DD-DTIIST---SMDGSIRVWSLASNSTVAS 401
            D   +++T     D  I  W+  + + V+S
Sbjct: 427 PDVPNLLATGGGQTDKYIHFWNTTTGARVSS 457

>Scas_702.16
          Length = 816

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 34/190 (17%), Positives = 79/190 (41%), Gaps = 35/190 (18%)

Query: 196 EVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNI---------------------LSYH 234
           E+  ++ +P G+ + TG   G++R+WSV+   Q +                     +S H
Sbjct: 19  EIYTVDVSPDGKRVATGGLDGKIRIWSVDSIKQIVKILSLKDEVPIDKELKKPLASMSRH 78

Query: 235 RAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGV-------- 286
              + C+K++ +  ++ +   D + ++W +     +Q   F     +E   V        
Sbjct: 79  TGSVTCLKFSPNGKYLASGSDDRILLIWTLDEERPIQPI-FGGESEKERWAVRKRLVAHD 137

Query: 287 ----DATWIDQDKFAIP-GIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSA 341
               D  W       +  G+  +++++N    + + +   H   +  + ++  NK   +A
Sbjct: 138 NDIQDICWAPDSSLLVSVGLDRAVIIWNGITFEKLKRFDVHQSHVKGVIFDPANKYFATA 197

Query: 342 SDDNTLRVWR 351
           SDD T++++R
Sbjct: 198 SDDRTMKIFR 207

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/149 (20%), Positives = 57/149 (38%), Gaps = 27/149 (18%)

Query: 312 ISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYG-------- 363
           + KP+  +  H+ ++T + ++ + K L S SDD  L +W      P    +G        
Sbjct: 68  LKKPLASMSRHTGSVTCLKFSPNGKYLASGSDDRILLIWTLDEERPIQPIFGGESEKERW 127

Query: 364 --------HSQSITSAHWVDDDT-IISTSMDGSIRVWS-----LASNSTVASATVDGVPN 409
                   H   I    W  D + ++S  +D ++ +W+           V  + V GV  
Sbjct: 128 AVRKRLVAHDNDIQDICWAPDSSLLVSVGLDRAVIIWNGITFEKLKRFDVHQSHVKGV-- 185

Query: 410 FTGALSPDQGKFATGTLDGEVMVYDIQKL 438
                 P    FAT + D  + ++   K+
Sbjct: 186 ---IFDPANKYFATASDDRTMKIFRYHKI 211

>Scas_721.7
          Length = 325

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 57/131 (43%), Gaps = 11/131 (8%)

Query: 318 KLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWV--- 374
           +L GH+  + ++ YN+   LL ++S D ++++W   +         HS+S+ S       
Sbjct: 93  RLMGHTAPVISLTYNDSGNLLFTSSMDESIKIWDTFHGAILKTISAHSESVVSLSICPDR 152

Query: 375 DDDTIISTSMDGSIRVWSLASNSTVASATVDG--------VPNFTGALSPDQGKFATGTL 426
           D   + S S DG IR++   +   + + T D         VP      SP+       + 
Sbjct: 153 DSSVLASGSFDGLIRLFDTRTGHCLKTLTYDKDWKSDDGVVPISQVRFSPNGKFLLVSSF 212

Query: 427 DGEVMVYDIQK 437
           DG V ++D  +
Sbjct: 213 DGIVKIWDCVR 223

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 29/160 (18%), Positives = 61/160 (38%), Gaps = 12/160 (7%)

Query: 200 LEWAPAGQSLLTGVESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMT 259
           + W+P  Q L +  +   + +  +     + L  H AP++ + +N     + T   D   
Sbjct: 63  VAWSPDNQCLASASDDFTIEITHLTHGCLHRLMGHTAPVISLTYNDSGNLLFTSSMDESI 122

Query: 260 IVWNVLSGTAVQHFS-FKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGK 318
            +W+   G  ++  S   E+    S+  D    D    A     G I +F+      +  
Sbjct: 123 KIWDTFHGAILKTISAHSESVVSLSICPDR---DSSVLASGSFDGLIRLFDTRTGHCLKT 179

Query: 319 LRGHSK--------TLTTIAYNEHNKLLLSASDDNTLRVW 350
           L              ++ + ++ + K LL +S D  +++W
Sbjct: 180 LTYDKDWKSDDGVVPISQVRFSPNGKFLLVSSFDGIVKIW 219

>ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH]
           (1158218..1159258) [1041 bp, 346 aa]
          Length = 346

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 52/123 (42%), Gaps = 24/123 (19%)

Query: 314 KPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHW 373
           +PI  L GH ++LT + YN    L+ ++  DN   VW   N        GH+ SI S   
Sbjct: 2   RPI-MLMGHERSLTQVKYNREGDLIFTSGKDNVASVWYAMNGERLGTLEGHNGSIWSID- 59

Query: 374 VDDDT--IISTSMDGSIRVWSLASNSTVAS--------------------ATVDGVPNFT 411
           VD  T   ++ S D S++VW +   S   S                    A +D V N+ 
Sbjct: 60  VDQHTEYAVTGSADFSVKVWRVRDGSIAHSWDTRTPVRRVEFSPTGDRVLAVLDNVMNYA 119

Query: 412 GAL 414
           GA+
Sbjct: 120 GAI 122

>CAGL0D02090g join(214357..214893,215564..215860) highly similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1
          Length = 277

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 37/81 (45%), Gaps = 3/81 (3%)

Query: 315 PIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWV 374
           P+   +GHS  +      E+    LS S D TLR+W          F GH   + S   +
Sbjct: 57  PVKSFKGHSHIVQDCTLTENGAYALSGSWDKTLRLWDVATGETFQTFVGHKGDVMSVA-I 115

Query: 375 DDDT--IISTSMDGSIRVWSL 393
           D     IIS S D SI+VWS+
Sbjct: 116 DKKASMIISGSRDKSIKVWSI 136

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 67/153 (43%), Gaps = 21/153 (13%)

Query: 317 GKLRGHSKTLTTIAYNE-HNKLLLSASDDNTLRVWR--GGNLN---PSHVFYGHSQSITS 370
           G L GH+  +T++A +     LLLSAS D TL  W+  G +     P   F GHS     
Sbjct: 11  GTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVKSFKGHS----- 65

Query: 371 AHWVDDDTI-------ISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFAT 423
            H V D T+       +S S D ++R+W +A+  T  +         + A+        +
Sbjct: 66  -HIVQDCTLTENGAYALSGSWDKTLRLWDVATGETFQTFVGHKGDVMSVAIDKKASMIIS 124

Query: 424 GTLDGEVMVYDIQK--LLQQLNHNGYHGTARSA 454
           G+ D  + V+ I+   L   + HN +    R A
Sbjct: 125 GSRDKSIKVWSIKGDCLATLIGHNDWVSQVRIA 157

>Sklu_1659.2 YMR092C, Contig c1659 410-2251
          Length = 613

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 94/199 (47%), Gaps = 18/199 (9%)

Query: 251 LTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNI 310
           +T  AD    +W+V S   +Q +S +   + + +GV  T  D +  A+  + G++ +F I
Sbjct: 268 VTSSADCTLKLWDVESSKCLQSWSLENTLSNQQVGVAVT-KDHEIVAL-SLDGTLNIFKI 325

Query: 311 GISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITS 370
           G    + ++ GH+K +T +  N     L+S S D  +  W   N N  H+   H   I S
Sbjct: 326 GEDSLVRRIEGHNKGITALVVNP----LVSGSYDGRVVQWI--NENEPHMENYHGNMIVS 379

Query: 371 AHWVDDDTIIST-SMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGE 429
               + D I+ST S D +++V++  + S          P  + A   + G  A  T + E
Sbjct: 380 ID--NTDKIVSTVSWDDTLKVFN--NGSAEVKYNFSQQPKVSSA---NNGAVAVITDNDE 432

Query: 430 VMVYDIQ--KLLQQLNHNG 446
           +++ D Q  +LLQ+   +G
Sbjct: 433 LLIIDSQSGELLQKTQLSG 451

>AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH]
           (1146710..1147672) [963 bp, 320 aa]
          Length = 320

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 83/203 (40%), Gaps = 37/203 (18%)

Query: 165 RAAVVTYSVADGLWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVE 224
           R A+  YSV DG     ET      +T   N++    W+P    + +G E   + +  +E
Sbjct: 34  RTAICVYSVGDGGCARYET-----THTEPINDIC---WSPDSACVASGSEDFTVEITHLE 85

Query: 225 -GKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEES 283
            G+L   L  H AP++ + +N     + T   D     W+VLSGT ++  S   A ++  
Sbjct: 86  YGRLHK-LRGHSAPVLSVVFNCKGNLLCTASVDESIKQWDVLSGTLLKTMS---AHSDPV 141

Query: 284 LGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHS-KTLT--------------- 327
           + +D    D    +     G I +F+           GH  KTLT               
Sbjct: 142 VSIDTPDCDATILSSGSYDGLIRIFDTE--------SGHCLKTLTYDKDWQTDDGVVPIS 193

Query: 328 TIAYNEHNKLLLSASDDNTLRVW 350
            + ++ + K LL  S D  +++W
Sbjct: 194 QVKFSRNGKFLLVRSLDGVVKLW 216

 Score = 36.6 bits (83), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 68/160 (42%), Gaps = 19/160 (11%)

Query: 209 LLTGVESGELRLWSVE-GKLQNILSYHR--------APIVCIKWNSDETHVLTCDADNMT 259
           L +G   G +R++  E G     L+Y +         PI  +K++ +   +L    D + 
Sbjct: 154 LSSGSYDGLIRIFDTESGHCLKTLTYDKDWQTDDGVVPISQVKFSRNGKFLLVRSLDGVV 213

Query: 260 IVWNVLSGTAVQHFSFKEAGTEE----SLGVDATWIDQDK----FAIPGIQGSILVFNIG 311
            +W+ + G  V+  +FK+A  E     S G+D  + D +       + G  G+I V+N  
Sbjct: 214 KLWDFIRGCVVR--TFKDASGESRMKYSCGMDFLYPDSEAADVMVVVGGEDGNICVWNAQ 271

Query: 312 ISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWR 351
                  L+G  +    IA +    L+ + S +    +WR
Sbjct: 272 SKAVAQTLKGQHEDSPVIAVSCKETLVCTLSLNGICHLWR 311

>CAGL0A02772g complement(289274..290599) similar to sp|P40968
           Saccharomyces cerevisiae YDR364c CDC40, hypothetical
           start
          Length = 441

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/172 (20%), Positives = 68/172 (39%), Gaps = 24/172 (13%)

Query: 192 GQQNEVTCLEWAPA-GQSLLTGVESGELRLWSVEGKLQNILSY--HRAPIVCIKWNSDET 248
           G  N  T L   P  G  +L+G     ++LW      + +  +  H  PI  + + SD +
Sbjct: 146 GHHNGTTSLRLLPGTGHLILSGGNDNTVKLWDFYHDRKCLRDFVGHSKPIKTLDFTSDSS 205

Query: 249 HVLTCDADNMTIVWNVLSGTAVQHFS---------FKE-AGTEESLGVDATWIDQDKFAI 298
             L+   D    +W+  +G   +  +         F+  +G E  +G+ ++ I      +
Sbjct: 206 QFLSGSYDQQVKIWDTETGKVTKRLNTYSTPNSAEFRPTSGNEFVVGLSSSKIKHYDTRV 265

Query: 299 PGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW 350
               G + V++            H  ++  I Y       +S+S+D TLR+W
Sbjct: 266 SEKDGLVQVYD-----------HHLSSILAIKYFPDGSKFISSSEDKTLRIW 306

 Score = 36.2 bits (82), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 54/127 (42%), Gaps = 5/127 (3%)

Query: 314 KPIGKLRGHSKTLTTIAY-NEHNKLLLSASDDNTLRVWRGGNLNPS-HVFYGHSQSITSA 371
           K I + +GH    T++        L+LS  +DNT+++W   +       F GHS+ I + 
Sbjct: 139 KVIYRYKGHHNGTTSLRLLPGTGHLILSGGNDNTVKLWDFYHDRKCLRDFVGHSKPIKTL 198

Query: 372 HWVDDDT-IISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQG-KFATGTLDGE 429
            +  D +  +S S D  +++W   +            PN +    P  G +F  G    +
Sbjct: 199 DFTSDSSQFLSGSYDQQVKIWDTETGKVTKRLNTYSTPN-SAEFRPTSGNEFVVGLSSSK 257

Query: 430 VMVYDIQ 436
           +  YD +
Sbjct: 258 IKHYDTR 264

 Score = 34.3 bits (77), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 2/64 (3%)

Query: 200 LEWAPAGQSLLTGVESGELRLW--SVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADN 257
           L ++P G+ L +G   G+L LW  +   KL ++    ++PI  + W+  ET  + C   +
Sbjct: 375 LTFSPDGRFLCSGDARGQLFLWDWNTNRKLCDLKLPTKSPITQVSWHPKETSKVICSGPD 434

Query: 258 MTIV 261
             I 
Sbjct: 435 GRIF 438

>Scas_701.45
          Length = 1276

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/277 (20%), Positives = 101/277 (36%), Gaps = 55/277 (19%)

Query: 197 VTCLEWAPAGQSLLTGV-ESGELRLWSVEGKLQNILSYHRAP---------IVCIKWNSD 246
           V  L + P  Q++L     +GE+ +W +   L +      AP         I  + WN  
Sbjct: 116 VNTLRFNPKQQNVLASAGNNGEILIWDINKTLSSTDYSPSAPGIAMSTQDEIKSVSWNKS 175

Query: 247 ETHVLTCDADNMTI--VWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGS 304
             HV     D  T   +W++ +   V H ++    T                   G++ +
Sbjct: 176 LAHVFASAGDTTTYASIWDLKAKKEVIHLNYTSPKT-------------------GLKPN 216

Query: 305 ILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASD-DNTLRVW--RGGNLNPSHVF 361
           + V           +  H K  T +A         S SD D  + +W  R  N+  + + 
Sbjct: 217 LAV-----------VEWHPKVTTYVA-------TASGSDSDPVILIWDLRNSNMPMTTLE 258

Query: 362 YGHSQSITSAHWV--DDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQG 419
             H++ I S  W   D+  ++S+  DG + +W   +N    +        F    +P+  
Sbjct: 259 GPHTKGIMSLDWCTKDESLLLSSGRDGIVALWDTKANEVSTTYPTRSQWCFKTKFAPENP 318

Query: 420 K-FATGTLDGEVMVYDIQKLLQQLNHNGYHGTARSAE 455
             FA+   DG++ V  +Q L    +      T + +E
Sbjct: 319 DIFASAGFDGQINVNTLQDLTNSQDSQTQADTNKESE 355

>Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement
          Length = 263

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 83/183 (45%), Gaps = 17/183 (9%)

Query: 141 FPPGYVSQWNPK-HEGVFAYGERDSRAAVVTYSVADG---LWNISETVVLADANTGQQNE 196
            PPG V   + K  E  +     ++    V Y  ADG   +W++    VL + N G ++ 
Sbjct: 63  LPPGAVDAKSTKLAESTYLQYHPETNLLAVGY--ADGVIKIWDLISKTVLINFN-GHKSA 119

Query: 197 VTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNI-LSYHRAPIVCIKWNSDETHVLTCDA 255
           +T L + P G  L++G +  ++ +W + G++    L  H+  I  I W  +E  +++   
Sbjct: 120 ITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGI-WCENEDWLISTSK 178

Query: 256 DNMTIVWNVLSGTAVQ-HFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISK 314
           D +  +W++ +   V+ H     A T E  G+    I  D       +  I ++N+ + K
Sbjct: 179 DGLIKIWDLKTQQCVETHM----AHTSECWGLA---IHNDLVITTSTESQIKIWNLDLDK 231

Query: 315 PIG 317
            +G
Sbjct: 232 DMG 234

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 47/104 (45%)

Query: 296 FAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNL 355
            A+    G I ++++     +    GH   +T + ++     L+S S D+ + +W     
Sbjct: 90  LAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGE 149

Query: 356 NPSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTV 399
              +    H  SIT     ++D +ISTS DG I++W L +   V
Sbjct: 150 VGLYKLRSHKDSITGIWCENEDWLISTSKDGLIKIWDLKTQQCV 193

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 31/166 (18%), Positives = 79/166 (47%), Gaps = 10/166 (6%)

Query: 187 ADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNI-LSYHRAPIVCIKWNS 245
            DA + +  E T L++ P    L  G   G +++W +  K   I  + H++ I  ++++ 
Sbjct: 68  VDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDP 127

Query: 246 DETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQ-GS 304
             T +++   D+  I+W+++    +    +K    ++S  +   W + + + I   + G 
Sbjct: 128 TGTRLISGSKDSDIIIWDLVGEVGL----YKLRSHKDS--ITGIWCENEDWLISTSKDGL 181

Query: 305 ILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW 350
           I ++++   + +     H+     +A   HN L+++ S ++ +++W
Sbjct: 182 IKIWDLKTQQCVETHMAHTSECWGLAI--HNDLVITTSTESQIKIW 225

>KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces
           cerevisiae YKL021c MAK11 involved in cell growth and
           replication of M1 dsRNA virus singleton, start by
           similarity
          Length = 390

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 55/112 (49%), Gaps = 14/112 (12%)

Query: 304 SILVFNIGISKPIGKLRGHSKTLTTIAYN----------EHNKLLLSASDDNTLRVWRGG 353
           +I ++++   K +G L GH  ++T + ++          + NK LLSAS+D+ + VWR  
Sbjct: 62  NIRIYDLQKRKELGTLLGHQGSITNLRFSRGKDADGQDIQLNKWLLSASEDHKIIVWRVK 121

Query: 354 NLNPSHVFYGHSQSITSAHWVDDDTI-ISTSMDGSIRVWSLASNSTVASATV 404
           +        GH+  I        + + +S S D SIR+W+L    TV  A V
Sbjct: 122 DWENFGTLKGHTARINDFDIHPSNRVAVSVSEDHSIRLWNLM---TVKKAGV 170

>AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH]
           (799876..800298,800493..801074) [1005 bp, 334 aa]
          Length = 334

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 58/142 (40%), Gaps = 10/142 (7%)

Query: 315 PIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWV 374
           P+   +GHS  +         K  LSAS D TLR+W   +      F GH   + S   +
Sbjct: 73  PVRSFKGHSHIVQDCTVTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVS-I 131

Query: 375 DDDT--IISTSMDGSIRVWSLASNSTVA----SATVDGVPNFTGALSPDQGKFATGTLDG 428
           D     I+S S D +++VW+   +  V     +  V  V       S D     +  +D 
Sbjct: 132 DPRATQIVSASRDKTVKVWNTVGDCVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDK 191

Query: 429 EVMVYDIQKLLQQ---LNHNGY 447
            V V+D+Q    +   + HN Y
Sbjct: 192 VVKVWDLQSFTIEADFIGHNNY 213

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 69/142 (48%), Gaps = 11/142 (7%)

Query: 304 SILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYG 363
           ++ ++++   K I +  GH   + +++ +     ++SAS D T++VW     +      G
Sbjct: 104 TLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTVKVWNTVG-DCVVTLLG 162

Query: 364 HSQSITSAHWV------DDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGAL--S 415
           H+  +++          D  T+IS  MD  ++VW L S +    A   G  N+   +  S
Sbjct: 163 HNDWVSNVRIAPSEKSDDAVTVISAGMDKVVKVWDLQSFTI--EADFIGHNNYVTTVTPS 220

Query: 416 PDQGKFATGTLDGEVMVYDIQK 437
           PD   FA+   DG+++++++ +
Sbjct: 221 PDGSIFASAGKDGQIILWNLNE 242

>KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces
           cerevisiae YLR409c singleton, start by similarity
          Length = 942

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 56/227 (24%), Positives = 92/227 (40%), Gaps = 24/227 (10%)

Query: 224 EGKLQNILSYHRAPIVCIKWNS-------------DE---THVLTCDADNMTIVWNVLSG 267
           +G+ +NIL+ H+       WNS             DE     V      N  +V +   G
Sbjct: 426 QGQWENILTVHKGEKFARTWNSRTKRVGRWTIPTNDEGFAKSVAISQCGNFGLVGSSNGG 485

Query: 268 TAVQHFSFKEAGTEESLGVDA-TWIDQD----KFAIPGIQGSILVFNIGISKPIGKLRGH 322
            +V +    +      L   A T I  D    K    G+ G +  ++   S  +GKL+  
Sbjct: 486 ISVHNLQSGQKRKVYRLHKKAVTGIAMDGMNRKMVSCGLDGIVGFYDFSKSTFLGKLKLD 545

Query: 323 SKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDT-IIS 381
           S  +T++ Y+  + L   A DD ++ V            +GHS  I+S  +  D   I+S
Sbjct: 546 S-PITSMVYHRSSDLFALALDDLSIVVVDSVTQKVVRQLWGHSNRISSFDFSPDGRWIVS 604

Query: 382 TSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDG 428
           +S+D +IR W L +   +    V+ V       SP+    AT ++ G
Sbjct: 605 SSLDSTIRTWDLPTGGCIDGMKVENVITNI-KFSPNGDLLATTSVSG 650

 Score = 32.7 bits (73), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 27/142 (19%), Positives = 62/142 (43%), Gaps = 6/142 (4%)

Query: 210 LTGVESGELRLWSVE-GKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGT 268
           L G  +G + + +++ G+ + +   H+  +  I  +     +++C  D +   ++    T
Sbjct: 478 LVGSSNGGISVHNLQSGQKRKVYRLHKKAVTGIAMDGMNRKMVSCGLDGIVGFYDFSKST 537

Query: 269 AVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTT 328
            +         T             D FA+     SI+V +    K + +L GHS  +++
Sbjct: 538 FLGKLKLDSPITSM-----VYHRSSDLFALALDDLSIVVVDSVTQKVVRQLWGHSNRISS 592

Query: 329 IAYNEHNKLLLSASDDNTLRVW 350
             ++   + ++S+S D+T+R W
Sbjct: 593 FDFSPDGRWIVSSSLDSTIRTW 614

>Kwal_34.15818
          Length = 349

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 44/90 (48%), Gaps = 8/90 (8%)

Query: 314 KPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHW 373
           +PI  L+GH ++LT + +N    L+ + + DN   VW   N      F GH  +I S   
Sbjct: 2   RPI-LLKGHERSLTQVKFNREGDLIFTCAKDNVASVWYSINGERLGTFEGHQGTIWS--- 57

Query: 374 VDDDTI----ISTSMDGSIRVWSLASNSTV 399
           +D D      ++ S D SI++W +   + V
Sbjct: 58  IDVDQFTQYAVTGSADFSIKLWKVQDGTNV 87

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 49/238 (20%), Positives = 89/238 (37%), Gaps = 44/238 (18%)

Query: 230 ILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDAT 289
           +L  H   +  +K+N +   + TC  DN+  VW  ++G  +  F   + GT  S+ VD  
Sbjct: 5   LLKGHERSLTQVKFNREGDLIFTCAKDNVASVWYSINGERLGTFEGHQ-GTIWSIDVDQF 63

Query: 290 WIDQDKFAIPG----------IQGSILVFNIGISKPIGKLR----------------GH- 322
                ++A+ G          +Q    VF      P+ +++                G+ 
Sbjct: 64  ----TQYAVTGSADFSIKLWKVQDGTNVFTWKTKTPVRRVQFSPSGDKILAVLDGVMGYP 119

Query: 323 -SKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDT-II 380
            S T+ T+  +   K ++  S++ T  +        + V          A W  +DT I+
Sbjct: 120 GSVTVYTVRRDPETKDIVDISEEPTFNILTREGFEIAAV----------AAWSFNDTYIV 169

Query: 381 STSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQKL 438
           +   DG +  +   S   + SA +          SPD   F T + D    + D + L
Sbjct: 170 AGHKDGRVSKYEGHSGEYIDSAALHTQNVSDIQFSPDGTYFITSSRDSAAKLVDTETL 227

>Scas_711.11
          Length = 695

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 71/174 (40%), Gaps = 45/174 (25%)

Query: 305 ILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWR------------- 351
           I ++++  SK IG++ GH  T+  +     N +L+S   D  L++W              
Sbjct: 397 IKIWDLSRSKQIGRMTGHVATVNCMQIT--NNMLVSGGKDALLKLWNLNVGVQSFRNVLP 454

Query: 352 --GGNLNPS-------HVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASN------ 396
               NL P        H F  H   ITS   V  + +IS S D +IR W + S       
Sbjct: 455 TNNSNLEPISSSASCIHTFDSHVDEITSV-TVAGENLISGSQDRTIRQWDIPSGKCLQTI 513

Query: 397 --STVASAT----VDGVPNFT--------GALSPDQGKFATGTLDGEVMVYDIQ 436
             S VA A+    V   P  T        GAL       ATGT DG V ++D++
Sbjct: 514 DLSFVAIASPPIQVTDSPFLTTTKATAIIGALQCFDAALATGTRDGIVRLWDLR 567

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 64/272 (23%), Positives = 115/272 (42%), Gaps = 36/272 (13%)

Query: 177 LWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQ---NILSY 233
           +W++S +  +    TG    V C++       L++G +   L+LW++   +Q   N+L  
Sbjct: 399 IWDLSRSKQIGRM-TGHVATVNCMQIT--NNMLVSGGKDALLKLWNLNVGVQSFRNVLPT 455

Query: 234 HRAPIVCIKWNSDETHVLTCDADNMTIVW----NVLSGTAVQHFSFKEAGTEESL-GVDA 288
           + + +  I  ++   H      D +T V     N++SG+  +     +  + + L  +D 
Sbjct: 456 NNSNLEPISSSASCIHTFDSHVDEITSVTVAGENLISGSQDRTIRQWDIPSGKCLQTIDL 515

Query: 289 TWIDQDKFAIPGIQ--GSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNT 346
           +++     A P IQ   S  +     +  IG L+     L T             + D  
Sbjct: 516 SFV---AIASPPIQVTDSPFLTTTKATAIIGALQCFDAALAT------------GTRDGI 560

Query: 347 LRVW--RGGNLNPSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATV 404
           +R+W  R G +       GHS SIT   + D+  I++ S+D ++R+W L S       T 
Sbjct: 561 VRLWDLRAGKV--VRALEGHSGSITCLKF-DNKNIVTGSIDKTVRIWDLRSGILSDMLTF 617

Query: 405 DGVPNFTGALSPDQGKFATGTLDGEVMVYDIQ 436
           +  P    ++  D+ K A  T D    VYD Q
Sbjct: 618 EK-PVL--SVDFDKNKIAIATHDEACKVYDRQ 646

>Scas_692.29
          Length = 456

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/228 (23%), Positives = 98/228 (42%), Gaps = 31/228 (13%)

Query: 197 VTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDAD 256
           ++ ++ +   ++++T    G +R W++ GK+Q   S H  PI  +K+ SD T +++   D
Sbjct: 106 ISSIDVSQDKKAIITASYDGVIRTWNLSGKVQKQYSGHSGPIRAVKFISD-TRLVSAGND 164

Query: 257 NMTIVWNVLSG-TAVQHFSFK--EAGTEESL------GVDATWIDQDKFAIPGIQGSILV 307
               +W   +  + VQHF  +  EA  E+        G  A  +  D      I  S   
Sbjct: 165 RTLRLWKTKNNDSVVQHFDEEDEEANIEDGKTLAILEGHKAPVVSLDVSNTSRILSSSYD 224

Query: 308 FNIG----------ISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNP 357
            +IG          +  P+ ++      ++T A  +  KL L    D T+R        P
Sbjct: 225 NSIGLWSTIYKEMTVVDPMEEINNADNKISTAA-RKRRKLTLK---DGTIR-----RRAP 275

Query: 358 SHVFYGHSQSITSAHW-VDDDTI-ISTSMDGSIRVWSLASNSTVASAT 403
             +   H+  +  A + ++DDT+  S S D +I+ W L +   + + T
Sbjct: 276 LSLLESHTAPVEQASFDINDDTVGYSVSQDHTIKTWDLVTARCIDTKT 323

>Kwal_27.11126
          Length = 996

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 78/160 (48%), Gaps = 18/160 (11%)

Query: 250 VLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPG--IQGSILV 307
           VL CD       +NVL   AV    F E     S  +  T   QDK  I    +   ++V
Sbjct: 117 VLCCDHS-----FNVLKRKAV----FGERSILYSGTI--TVYSQDKVHINAGTVMDGVIV 165

Query: 308 FNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW--RGGNLNPSHVFYGHS 365
           +++   + +     H   +  +  +++ K   S SDD ++++W  + G L  +   +GH+
Sbjct: 166 WDLESEQNLHHFTDHEGAIFFVTASKNGKYAASCSDDRSIKLWDLKSGQLLSTA--WGHT 223

Query: 366 QSITSAHWVDDDT-IISTSMDGSIRVWSLASNSTVASATV 404
             I +  + D+D+ +IS S D + RVW ++ ++T++ A+V
Sbjct: 224 ARIWNLLFFDNDSKVISVSEDCTCRVWDISEDNTLSQASV 263

>CAGL0K00275g complement(25300..27447) similar to sp|P36037
           Saccharomyces cerevisiae YKL213c DOA1, hypothetical
           start
          Length = 715

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 77/186 (41%), Gaps = 28/186 (15%)

Query: 301 IQGSILVFNIGIS-KPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSH 359
           I GS +   IG S  P+  L GH+  +  + +   N LLLS+S D T ++W    L   +
Sbjct: 79  INGSHIEDVIGSSADPMYTLVGHTGNVCGLRF--QNGLLLSSSWDKTAKIWDNNKL--KY 134

Query: 360 VFYGHSQSITSAHWVDDDTIISTSMDGSIRVW-------SLASNSTVASATVDGVPNFTG 412
               H  S+  +  V DD I++ S D SI VW        L++        ++ + N   
Sbjct: 135 DLRNHEASVWDSTMVSDDIILTASADKSIGVWMEGKLIKKLSNIHDDVIRHLEYISNDIF 194

Query: 413 ALSPDQGKFATGTLDGEV---------MVYDIQKLLQQLNHNGYHGTAR-------SAEV 456
           A   + G      L+GE+          VY ++ +   L   G   T R       + +V
Sbjct: 195 ASCSNDGTIKLLNLEGEIKNVFEGHESFVYCVKHMNNTLFSCGEDSTVRIWSINGSTKQV 254

Query: 457 ARIPVV 462
            RIP V
Sbjct: 255 IRIPAV 260

 Score = 36.2 bits (82), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 30/61 (49%)

Query: 358 SHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPD 417
           S    GHSQ +     V+D+ I S S DGS+RVW+ +S+       V     F  A+  D
Sbjct: 5   SATLRGHSQDVKDITAVNDNKIASVSRDGSLRVWTRSSSGDWEDVLVYQSDKFLNAVCYD 64

Query: 418 Q 418
           +
Sbjct: 65  K 65

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 11/49 (22%), Positives = 30/49 (61%), Gaps = 2/49 (4%)

Query: 216 GELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNV 264
           G ++L ++EG+++N+   H + + C+K  ++   + +C  D+   +W++
Sbjct: 201 GTIKLLNLEGEIKNVFEGHESFVYCVKHMNNT--LFSCGEDSTVRIWSI 247

 Score = 29.6 bits (65), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 58/136 (42%), Gaps = 19/136 (13%)

Query: 219 RLWSVEGKLQNILSYHRAPIVCIKWNS---DETHVLTCDADNMTIVWNVLSGTAVQHFSF 275
           ++W    KL+  L  H A +    W+S    +  +LT  AD    VW  + G  ++  S 
Sbjct: 125 KIWD-NNKLKYDLRNHEASV----WDSTMVSDDIILTASADKSIGVW--MEGKLIKKLS- 176

Query: 276 KEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNI-GISKPIGKLRGHSKTLTTIAYNEH 334
                 + +     +I  D FA     G+I + N+ G  K +    GH   +  + +   
Sbjct: 177 ---NIHDDVIRHLEYISNDIFASCSNDGTIKLLNLEGEIKNV--FEGHESFVYCVKH--M 229

Query: 335 NKLLLSASDDNTLRVW 350
           N  L S  +D+T+R+W
Sbjct: 230 NNTLFSCGEDSTVRIW 245

>CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces
           cerevisiae YBR175w, start by similarity
          Length = 316

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 59/115 (51%), Gaps = 3/115 (2%)

Query: 322 HSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDD-DTII 380
           H+  ++ I ++   K + S SDD T+ V     L   H   GH+  + S  + +  + + 
Sbjct: 54  HAAGVSQICWSPDGKCIASCSDDFTVVVTHR-QLGLLHRLVGHTAPVISLCYNNKGNLLF 112

Query: 381 STSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGK-FATGTLDGEVMVYD 434
           ++SMD SI+VW + + + + + +    P  +  LS + G   ++G+ DG + ++D
Sbjct: 113 TSSMDESIKVWDVLTGTVMKTMSAHSEPVVSIDLSDNDGSILSSGSHDGLIRIFD 167

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 92/213 (43%), Gaps = 24/213 (11%)

Query: 151 PKHEGVFAYGERDSR-AAVV----TYSVADGLWNISETVVLADANTGQQNEVTCLEWAPA 205
           P   GVF+   RD +  AVV     Y      + + ET+VL  A    Q     + W+P 
Sbjct: 15  PSTCGVFS---RDGQWLAVVRGIEVYIYETSGYQLRETLVLEHAAGVSQ-----ICWSPD 66

Query: 206 GQSLLTGVESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVL 265
           G+ + +  +   + +   +  L + L  H AP++ + +N+    + T   D    VW+VL
Sbjct: 67  GKCIASCSDDFTVVVTHRQLGLLHRLVGHTAPVISLCYNNKGNLLFTSSMDESIKVWDVL 126

Query: 266 SGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRG---- 321
           +GT ++  S   A +E  + +D +  D    +     G I +F+      +  L      
Sbjct: 127 TGTVMKTMS---AHSEPVVSIDLSDNDGSILSSGSHDGLIRIFDTATGHCLKTLTYDKDW 183

Query: 322 HSKT----LTTIAYNEHNKLLLSASDDNTLRVW 350
            S+T    +  + ++ + K LL  S D  +++W
Sbjct: 184 QSETGVVPIAKVKFSANTKYLLVKSYDGVVKIW 216

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 34/160 (21%), Positives = 67/160 (41%), Gaps = 14/160 (8%)

Query: 206 GQSLLTGVESGELRLW-SVEGKLQNILSYHR--------APIVCIKWNSDETHVLTCDAD 256
           G  L +G   G +R++ +  G     L+Y +         PI  +K++++  ++L    D
Sbjct: 151 GSILSSGSHDGLIRIFDTATGHCLKTLTYDKDWQSETGVVPIAKVKFSANTKYLLVKSYD 210

Query: 257 NMTIVWNVLSGTAVQHF--SFKEAGTEESLGVDATWID--QDKFAIPGIQ-GSILVFNIG 311
            +  +W+ +SG  V+ F  S K+       G+D  +    Q    + G + G I  ++  
Sbjct: 211 GVVKIWDSVSGDVVRTFKPSNKKYNLTHCCGMDFMYPQSTQSPLILSGYEKGEIYCWDSN 270

Query: 312 ISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWR 351
               +  L+        I+ + HN L+ S S      +W+
Sbjct: 271 TKAELQVLKIEECDSAIISIDCHNNLMCSLSLAGNCTIWK 310

>CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP, hypothetical start
          Length = 500

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/204 (20%), Positives = 76/204 (37%), Gaps = 49/204 (24%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNILSY-HRAPIVCIKWNSDETHV 250
           G +  +T L+  P+G+ + T       RLW +E + Q +L   H   + C+ + +D   V
Sbjct: 296 GHEGRITDLQVHPSGKFIGTSSFDSTWRLWDIEKQKQLLLQEGHSKELYCLAFQADGALV 355

Query: 251 LTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNI 310
            T   D   I+W++ SG                                           
Sbjct: 356 STAGTDKTAIIWDLRSG------------------------------------------- 372

Query: 311 GISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITS 370
              K + +L+GH+KT+  + ++     L +   D  + +W     +       H   +TS
Sbjct: 373 ---KAVSQLQGHAKTIYCMDWSIDGHTLATGGGDGVITIWDLRKSDKLTKITEHKSIVTS 429

Query: 371 AHW--VDDDTIISTSMDGSIRVWS 392
             +   +D  +IS+  D SI V+S
Sbjct: 430 LKFDKANDHNLISSGYDRSIFVYS 453

 Score = 36.6 bits (83), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 53/118 (44%), Gaps = 1/118 (0%)

Query: 321 GHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDTII 380
           GH   +T +  +   K + ++S D+T R+W         +  GHS+ +    +  D  ++
Sbjct: 296 GHEGRITDLQVHPSGKFIGTSSFDSTWRLWDIEKQKQLLLQEGHSKELYCLAFQADGALV 355

Query: 381 STS-MDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQK 437
           ST+  D +  +W L S   V+         +    S D    ATG  DG + ++D++K
Sbjct: 356 STAGTDKTAIIWDLRSGKAVSQLQGHAKTIYCMDWSIDGHTLATGGGDGVITIWDLRK 413

>YBL106C (SRO77) [97] chr2 complement(10847..13879) Protein that
           functions together with Sec9p in exocytosis downstream
           of the Rho3p GTPase [3033 bp, 1010 aa]
          Length = 1010

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 48/94 (51%), Gaps = 12/94 (12%)

Query: 195 NEVTCLEWAPAGQSLLTGVESGELRLWSVEG------KLQNI-----LSYHR-APIVCIK 242
           N +TC E  P    +L G+ESG + ++ V+       K++N      L   R +P++ I+
Sbjct: 125 NSITCFETDPPLDWMLIGLESGSILIYDVDRNQMSKLKIENFQKSVFLPKERLSPVISIQ 184

Query: 243 WNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFK 276
           WN  +   +    +++T++++ +     QHF ++
Sbjct: 185 WNPRDIGTILISYEHITVIYSFIDYKVKQHFFYQ 218

>Kwal_56.22345
          Length = 396

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 97/222 (43%), Gaps = 34/222 (15%)

Query: 193 QQNEVTCLEWAPAGQSLLTGVE-SGELRLWSV----EGKLQNILSYHRAPIVCIKWN-SD 246
            +NEVT   +AP   +L+  +  +G + L+      E  L+   +YH+     + ++ + 
Sbjct: 112 HENEVTRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVAS 171

Query: 247 ETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVD----ATWIDQDKFAIPGIQ 302
              +++C  D    +W++ SG  V         +  SL  D      W + D    P I 
Sbjct: 172 PGELISCSDDGSIAIWDIKSGKTV-------PTSVNSLHSDIVNECKWHESD----PNIY 220

Query: 303 GSI------LVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLN 356
           GS+      ++ +    KP+ KL    +   TIA+++H+  L +A+  + + V+   +  
Sbjct: 221 GSVSEDSFLMIHDKRSEKPLQKLL-QKEPFNTIAFSKHSSNLFAAAGTDAM-VYLFDSRK 278

Query: 357 PS---HVFYGHSQSITSAHWV--DDDTIISTSMDGSIRVWSL 393
           P+   H   GH +++TS  +    D  + S   D  + +W L
Sbjct: 279 PTEALHSMSGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDL 320

 Score = 29.3 bits (64), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 9/72 (12%)

Query: 379 IISTSMDGSIRVWSLASNSTVASATV---DGVPNFTGALSPDQGKFATGTLDGEVMVYD- 434
           +IS S DGSI +W + S  TV ++       + N       D   + + + D  +M++D 
Sbjct: 175 LISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDK 234

Query: 435 -----IQKLLQQ 441
                +QKLLQ+
Sbjct: 235 RSEKPLQKLLQK 246

>YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and
           COMPASS complex, has several WD (WD-40) repeats and may
           be involved in chromatin remodeling [948 bp, 315 aa]
          Length = 315

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 37/196 (18%), Positives = 79/196 (40%), Gaps = 11/196 (5%)

Query: 163 DSRAAVVTYSVADGLWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWS 222
           D +   +T  +   +++I+   V     T      + L W+P GQ + T  +   + +  
Sbjct: 24  DGQFLAITQGLNILIYDINRRTVSQTLVTSHARPFSELCWSPDGQCIATASDDFSVEIIH 83

Query: 223 VEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEE 282
           +   L +    H AP++ + +N     + T   D    +W+ L+G+ ++  S   A +E 
Sbjct: 84  LSYGLLHTFIGHTAPVISLTFNRKGNLLFTSSMDESIKIWDTLNGSLMKTIS---AHSEA 140

Query: 283 SLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSK--------TLTTIAYNEH 334
            + VD    D    +     G I +F+      +  L              ++ + ++E+
Sbjct: 141 VVSVDVPMNDSSILSSGSYDGLIRIFDAETGHCLKTLTYDKDWKRENGVVPISQVKFSEN 200

Query: 335 NKLLLSASDDNTLRVW 350
            + LL  S D  +++W
Sbjct: 201 ARYLLVKSLDGVVKIW 216

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 59/124 (47%), Gaps = 10/124 (8%)

Query: 321 GHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHW-VDDDTI 379
           GH+  + ++ +N    LL ++S D ++++W   N +       HS+++ S    ++D +I
Sbjct: 94  GHTAPVISLTFNRKGNLLFTSSMDESIKIWDTLNGSLMKTISAHSEAVVSVDVPMNDSSI 153

Query: 380 IST-SMDGSIRVWSLASNSTVASATVDG--------VPNFTGALSPDQGKFATGTLDGEV 430
           +S+ S DG IR++   +   + + T D         VP      S +       +LDG V
Sbjct: 154 LSSGSYDGLIRIFDAETGHCLKTLTYDKDWKRENGVVPISQVKFSENARYLLVKSLDGVV 213

Query: 431 MVYD 434
            ++D
Sbjct: 214 KIWD 217

>YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in
           mitochondrial division and mitochondrial fission,
           contains WD (WD-40) repeats [2145 bp, 714 aa]
          Length = 714

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 71/177 (40%), Gaps = 48/177 (27%)

Query: 304 SILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYG 363
           ++ ++++     IG+L GH  T+  +  N     L++   D  L++W   NLN +   Y 
Sbjct: 422 TVKIWDLSKQNKIGELAGHLATINCMQINRDYGTLVTGGRDAALKLW---NLNLAQQLYQ 478

Query: 364 HSQSITS--------------AHW-------VDDDTIISTSMDGSIRVWSLAS------- 395
            +Q++TS              AH        +D   ++S S D +IR W L S       
Sbjct: 479 ETQNLTSPTNHIDSPCVHTFEAHTDEVTALSLDPSFLVSGSQDRTIRQWDLRSGKCLQTI 538

Query: 396 -----NSTVASATVD-----------GVPNFTGALSPDQGKFATGTLDGEVMVYDIQ 436
                N    S  VD             P+  GAL       ATGT DG V ++D++
Sbjct: 539 DLSFANVLTTSTNVDLSKSTLLTQRNERPSI-GALQSFDAALATGTKDGVVRLWDLR 594

 Score = 37.0 bits (84), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 65/253 (25%), Positives = 107/253 (42%), Gaps = 32/253 (12%)

Query: 197 VTCLEW-APAGQSLLTGVESGELRLWSVEGKLQNI--LSYHRAPIVCIKWNSDETHVLTC 253
           +TCL++ AP G     G     +++W +  K   I  L+ H A I C++ N D   ++T 
Sbjct: 401 LTCLDFDAPFGTLCTAGYLDHTVKIWDL-SKQNKIGELAGHLATINCMQINRDYGTLVTG 459

Query: 254 DADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWI-----DQDKFAIPGIQGSILVF 308
             D    +WN+    A Q +   +  T  +  +D+  +       D+     +  S LV 
Sbjct: 460 GRDAALKLWNL--NLAQQLYQETQNLTSPTNHIDSPCVHTFEAHTDEVTALSLDPSFLVS 517

Query: 309 NIGISKPIGK--LRGHSKTLTTIAYNEHNKLLLSASDD---NTLRVWRGGNLNPSHVFYG 363
                + I +  LR   K L TI  +  N L  S + D   +TL   R  N  PS    G
Sbjct: 518 G-SQDRTIRQWDLRS-GKCLQTIDLSFANVLTTSTNVDLSKSTLLTQR--NERPS---IG 570

Query: 364 HSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFAT 423
             QS  +A       + + + DG +R+W L S   +   T+ G  +   +L  D     T
Sbjct: 571 ALQSFDAA-------LATGTKDGVVRLWDLRSGKVI--RTLKGHTDAITSLKFDSACLVT 621

Query: 424 GTLDGEVMVYDIQ 436
           G+ D  V ++D++
Sbjct: 622 GSYDRTVRIWDLR 634

>Kwal_14.884
          Length = 395

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 66/154 (42%), Gaps = 28/154 (18%)

Query: 305 ILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKL-------------------LLSASDDN 345
           I ++++   K +G L  H  ++T + +++  K+                   L+SASDD+
Sbjct: 63  IRIYDLQKRKELGTLLSHQGSITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDH 122

Query: 346 TLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDTI-ISTSMDGSIRVWSLASNSTVASATV 404
            L +WR  +        GH+  I        + I IS S D SIR+W+L    TV  A V
Sbjct: 123 NLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLM---TVKKAGV 179

Query: 405 DGVPNF--TGAL---SPDQGKFATGTLDGEVMVY 433
             +  +   G       D G+F    L  +V++Y
Sbjct: 180 LKLKKYNQNGQFVRWCGDSGEFFAVALLTKVLIY 213

>AGR180W [4491] [Homologous to ScYLR222C - SH]
           complement(1090647..1093067) [2421 bp, 806 aa]
          Length = 806

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/121 (21%), Positives = 57/121 (47%), Gaps = 3/121 (2%)

Query: 296 FAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNL 355
           FA      +  ++N+   +    L  H + L  +A+ E++ LL + S D ++ +W   + 
Sbjct: 503 FATASYDKTCKIWNVDTGEVEATLANHKRGLWGVAFCEYDWLLATCSGDRSINLWSLESF 562

Query: 356 NPSHVFYGHSQSITSAHWVD-DDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGAL 414
                  GH+ ++    +++ +  ++ST  DG +++W  ++   V   T+D   N   AL
Sbjct: 563 TVLKTLEGHTNAVQRVSFINGNKQLVSTGADGLVKIWDCSTGECV--RTLDAHNNRIWAL 620

Query: 415 S 415
           +
Sbjct: 621 A 621

 Score = 36.2 bits (82), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 55/118 (46%), Gaps = 5/118 (4%)

Query: 320 RGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDTI 379
           R H K +  I+ + ++ +  +AS D T ++W             H + +    + + D +
Sbjct: 485 RAHEKDINAISMSPNDSIFATASYDKTCKIWNVDTGEVEATLANHKRGLWGVAFCEYDWL 544

Query: 380 IST-SMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQG--KFATGTLDGEVMVYD 434
           ++T S D SI +WSL S + +   T++G  N    +S   G  +  +   DG V ++D
Sbjct: 545 LATCSGDRSINLWSLESFTVL--KTLEGHTNAVQRVSFINGNKQLVSTGADGLVKIWD 600

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 24/161 (14%), Positives = 68/161 (42%), Gaps = 7/161 (4%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWSVE-GKLQNILSYHRAPIVCIKWNSDETHV 250
             + ++  +  +P      T       ++W+V+ G+++  L+ H+  +  + +   +  +
Sbjct: 486 AHEKDINAISMSPNDSIFATASYDKTCKIWNVDTGEVEATLANHKRGLWGVAFCEYDWLL 545

Query: 251 LTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIP-GIQGSILVFN 309
            TC  D    +W++ S T ++         +       ++I+ +K  +  G  G + +++
Sbjct: 546 ATCSGDRSINLWSLESFTVLKTLEGHTNAVQR-----VSFINGNKQLVSTGADGLVKIWD 600

Query: 310 IGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW 350
               + +  L  H+  +  +A     +L+++A  D   + W
Sbjct: 601 CSTGECVRTLDAHNNRIWALAVANDGQLIITADADGVFQFW 641

>Kwal_23.6429
          Length = 750

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 58/267 (21%), Positives = 109/267 (40%), Gaps = 39/267 (14%)

Query: 202 WAPAGQSLLTGVESGELRLWSVEG-KLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTI 260
           ++P G+ L TG E   +R+W +   ++   L  H   I  + +      +++   D    
Sbjct: 478 FSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVR 537

Query: 261 VWNVLSGTAVQHFSFKEAGTEESLG------VDATWIDQDKFAIPGIQGSILVFNIGISK 314
           +W++ +G      S ++  T  ++       + A  +D+    I   +   LV  +    
Sbjct: 538 IWDLRTGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDR-TVRIWDSETGFLVERLDSEN 596

Query: 315 PIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW-----RGG------NLNPSHVFY- 362
            +G   GH  ++ ++ +      ++S S D ++++W      GG      N   S V Y 
Sbjct: 597 ELGT--GHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGTAEGKANTAASEVTYT 654

Query: 363 GHSQSITS-AHWVDDDTIISTSMDGSIRVWSLAS-----------NSTVASATVDGVPNF 410
           GH   + S A   +D+ I+S S D  +  W   S           NS ++ A  +  P  
Sbjct: 655 GHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNSVISVAVANDHP-- 712

Query: 411 TGALSPDQGKFATGTLDGEVMVYDIQK 437
              L P+ G FATG+ D +  ++   K
Sbjct: 713 ---LGPEYGVFATGSGDCKARIWKYSK 736

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/234 (20%), Positives = 93/234 (39%), Gaps = 27/234 (11%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWSVE-GKLQNILSYHRAPIVCIKWNSDETHV 250
           G + ++  L++ P+G  L++G     +R+W +  G+    LS             D   +
Sbjct: 510 GHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKLI 569

Query: 251 LTCDADNMTIVWNVLSGTAVQHF-SFKEAGTEESLGVDATWIDQDKFAI--PGIQGSILV 307
                D    +W+  +G  V+   S  E GT     V +    +D   +    +  S+ +
Sbjct: 570 AAGSLDRTVRIWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKL 629

Query: 308 FNI-----GISKPIGKLR---------GHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGG 353
           +N+     G ++  GK           GH   + ++A  ++++ +LS S D  +  W   
Sbjct: 630 WNLRSANGGTAE--GKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTP 687

Query: 354 NLNPSHVFYGHSQSITSAHWVDDDTI-------ISTSMDGSIRVWSLASNSTVA 400
           + NP  +  GH  S+ S    +D  +        + S D   R+W  +  ++ A
Sbjct: 688 SGNPLLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIWKYSKQTSNA 741

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 36/187 (19%), Positives = 75/187 (40%), Gaps = 33/187 (17%)

Query: 234 HRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQ 293
           H + + C++++ D    L    +  T V+ V +G  +   S  E  +    G DA+   +
Sbjct: 399 HSSVVCCVRFSHD-GEFLATGCNKTTQVYKVSTGELIARLS--EDASSAPSGADASATSE 455

Query: 294 DKFAIPGIQGS---------------------------ILVFNIGISKPIGKLRGHSKTL 326
           +  A P +  S                           I ++++   + +  L+GH + +
Sbjct: 456 NAKASPAVATSASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDI 515

Query: 327 TTIAYNEHNKLLLSASDDNTLRVW--RGGNLNPSHVFYGHSQSITSAHWVDDDTIISTSM 384
            ++ Y      L+S S D T+R+W  R G  + +        ++  +   D   I + S+
Sbjct: 516 YSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPG-DGKLIAAGSL 574

Query: 385 DGSIRVW 391
           D ++R+W
Sbjct: 575 DRTVRIW 581

>CAGL0M02277g complement(271836..273119) highly similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46 Pre-mRNA splicing
           factor PRP46, hypothetical start
          Length = 427

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/166 (19%), Positives = 74/166 (44%), Gaps = 19/166 (11%)

Query: 291 IDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW 350
           +D + FA      +I ++N+   K    L+ H  T+  +A +  +  + S S+D T++ W
Sbjct: 126 VDNEWFATGSNDKTIKIWNLASGKLKVTLKAHDMTVRDLAISNRHPYMFSVSEDKTVKCW 185

Query: 351 RGGNLNPSHVFYGHSQSITSAHWVDD----DTIISTSMDGSIRVWSLASNSTVASATVDG 406
                     ++GH   ++  H VD     D +++   D  ++VW + +   V +     
Sbjct: 186 DLEKNTAIRNYHGH---LSGVHTVDIHPTVDVVVTAGRDSVVKVWDIRTRLPVMT----- 237

Query: 407 VPNFTGALS-----PDQGKFATGTLDGEVMVYDI--QKLLQQLNHN 445
           +P   G ++     P   +  + ++D  + ++D+   K ++ L H+
Sbjct: 238 LPGHKGPITKVRCLPVDPQVISSSVDASIRLWDLVAGKSMKVLTHH 283

 Score = 37.7 bits (86), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 28/141 (19%), Positives = 64/141 (45%), Gaps = 5/141 (3%)

Query: 211 TGVESGELRLWSV-EGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTA 269
           TG     +++W++  GKL+  L  H   +  +  ++   ++ +   D     W++   TA
Sbjct: 133 TGSNDKTIKIWNLASGKLKVTLKAHDMTVRDLAISNRHPYMFSVSEDKTVKCWDLEKNTA 192

Query: 270 VQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTI 329
           ++++    +G   ++ +  T    D     G    + V++I    P+  L GH   +T +
Sbjct: 193 IRNYHGHLSGV-HTVDIHPT---VDVVVTAGRDSVVKVWDIRTRLPVMTLPGHKGPITKV 248

Query: 330 AYNEHNKLLLSASDDNTLRVW 350
                +  ++S+S D ++R+W
Sbjct: 249 RCLPVDPQVISSSVDASIRLW 269

>Scas_465.4
          Length = 1002

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 50/94 (53%), Gaps = 1/94 (1%)

Query: 301 IQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHV 360
           + G +L++++ +   +  L GH  ++     +++ + + S SDD ++++W          
Sbjct: 157 VMGGVLIWDLFLETKLYNLVGHEGSIFYATISDNGRYITSCSDDRSIKLWNLQTGEELCT 216

Query: 361 FYGHSQSITSAHWVDDDT-IISTSMDGSIRVWSL 393
            +GH+  I +  + ++DT +IS S D + RVW +
Sbjct: 217 GWGHTARIWNLKFFNNDTQLISVSEDNTCRVWDI 250

>KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46, start by
           similarity
          Length = 434

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 63/149 (42%), Gaps = 7/149 (4%)

Query: 291 IDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW 350
           +D + FA      +I ++++   K    L GH  ++  IA ++ +  + SAS+D  ++ W
Sbjct: 133 VDNEWFATGSNDTTIKIWDLAAGKLKITLIGHVMSVRDIAISKRHPYMFSASEDKLVKCW 192

Query: 351 RGGNLNPSHVFYGHSQSITSAHWVDD----DTIISTSMDGSIRVWSLASNSTVASATVDG 406
                     F+GH   ++  H VD     D I +   D  +R+W + S S +       
Sbjct: 193 DLERNTAIRDFHGH---LSGVHTVDVHPSLDIIATAGRDAVVRLWDIRSRSEIMVLPGHK 249

Query: 407 VPNFTGALSPDQGKFATGTLDGEVMVYDI 435
            P       P   +  + + D  V ++DI
Sbjct: 250 SPINKVKCLPVDPQIISCSGDATVRLWDI 278

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 54/263 (20%), Positives = 103/263 (39%), Gaps = 16/263 (6%)

Query: 178 WNISETVVLADANTGQQNEVTCLEWAPAGQS-LLTGVESGELRLWSVE-GKLQNILSYHR 235
           W +S+ +       G    V C+   P       TG     +++W +  GKL+  L  H 
Sbjct: 112 WKLSKVI------NGHTGWVRCVCVDPVDNEWFATGSNDTTIKIWDLAAGKLKITLIGHV 165

Query: 236 APIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDK 295
             +  I  +    ++ +   D +   W++   TA++ F    +G   ++ V  +    D 
Sbjct: 166 MSVRDIAISKRHPYMFSASEDKLVKCWDLERNTAIRDFHGHLSGV-HTVDVHPS---LDI 221

Query: 296 FAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNL 355
            A  G    + +++I     I  L GH   +  +     +  ++S S D T+R+W     
Sbjct: 222 IATAGRDAVVRLWDIRSRSEIMVLPGHKSPINKVKCLPVDPQIISCSGDATVRLWDIIAG 281

Query: 356 NPSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVAS--ATVDGVPNFTGA 413
             S V   HS++I        +   ++     +R W L     + +  +   G+ N T +
Sbjct: 282 KASKVLTHHSRNIRDLTLHPAEFSFASVSTNDVRSWKLPEGQLLTNFQSQNTGILN-TVS 340

Query: 414 LSPDQGKFATGTLDGEVMVYDIQ 436
           ++ D    A G  DG +  YD +
Sbjct: 341 INHDNVLLAGGD-DGTLCFYDYK 362

>CAGL0M09845g 975007..977817 highly similar to sp|Q06078
           Saccharomyces cerevisiae YLR409c, start by similarity
          Length = 936

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 75/165 (45%), Gaps = 9/165 (5%)

Query: 261 VWNVLSGTAVQHFSF-KEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKL 319
           V+N+ SG   + +   K A T    GV    +++ K    G+ G I  ++   SK +GKL
Sbjct: 484 VYNMQSGMLRKKYRLHKRAVT----GVAVDGMNR-KMVSCGLDGIIGFYDFNESKYLGKL 538

Query: 320 RGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDT- 378
           +  +  +T++ Y+  + L   A DD ++ V            +GH   IT+  +  D   
Sbjct: 539 QMDA-PITSMVYHRSSDLCAFALDDLSIVVVDTVTQKVVRQLWGHGNRITAFDFSPDGRW 597

Query: 379 IISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFAT 423
           ++S S+D +IR W L + S +    ++ V       SP+    AT
Sbjct: 598 LVSASLDSTIRTWDLPTGSCIDGVKIESVAT-NLKFSPNGDMLAT 641

>YER066W (YER066W) [1497] chr5 (290240..290797) Protein containing
           three WD domains (WD-40 repeat), which may mediate
           protein-protein interactions, has high similarity to a
           region of S. cerevisiae Cdc4p, which is a component of
           the SCF-Cdc4p complex involved in ubiquitin-dependent
           degradation [558 bp, 185 aa]
          Length = 185

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 7/93 (7%)

Query: 319 LRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQ--SITSAHWVDD 376
           LRGH   +  +  ++  K L+SAS D ++R W        H F+ H+Q  +IT+ H V D
Sbjct: 69  LRGHRALVGLLGLSD--KFLVSASVDGSIRCWDANTYFLKH-FFDHTQLNTITALH-VSD 124

Query: 377 DTIISTSMDGSIRVWSLASNSTVASATVDGVPN 409
           + ++S S +G + ++ L S   V S T+ G  N
Sbjct: 125 EVLVSGS-EGLLNIYDLNSGLLVRSDTLSGADN 156

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 42/98 (42%), Gaps = 21/98 (21%)

Query: 314 KPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGN------------------- 354
           K +  L GH+  + +  Y+   K  +SAS D T+R+W   N                   
Sbjct: 2   KCLYILSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLENIRNNGECSYATNSASPCAK 61

Query: 355 -LNPSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVW 391
            L   +   GH +++     + D  ++S S+DGSIR W
Sbjct: 62  ILGAMYTLRGH-RALVGLLGLSDKFLVSASVDGSIRCW 98

>Scas_558.3
          Length = 725

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 76/164 (46%), Gaps = 17/164 (10%)

Query: 315 PIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHW- 373
           P+  L GH   +  ++Y +H   ++S S D T +VW  G L  S    GH  S+  A   
Sbjct: 94  PLYTLIGHHSNVCALSY-KHMSAIISGSWDTTAKVWINGALQWS--LEGHQASVWDAKII 150

Query: 374 -VDDDTIISTSMDGSIRVWS----LASNSTVASATVDGVPNFTGALSPDQGKFATGTLDG 428
            V+++T I+ S D ++++W     L + S + S  +  +   +        + AT + DG
Sbjct: 151 SVEENTFITASADRTVKLWKENKLLKTFSGIHSDVIRNIEVLSSG-----KEIATCSNDG 205

Query: 429 EVMVYDIQKLLQQL--NHNGY-HGTARSAEVARIPVVGDHRSAR 469
            + + D+   ++Q+   H  + +    S +  ++   G+ RS R
Sbjct: 206 TIKISDLDGNIKQVLSGHESFVYNVKLSKQGDKLVSCGEDRSLR 249

 Score = 33.5 bits (75), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 35/82 (42%), Gaps = 8/82 (9%)

Query: 358 SHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPD 417
           S    GH+Q +     +DD  + S S DG++R+W    N T     +     F  A+  D
Sbjct: 5   SATLLGHTQDVKDIVVIDDSQVASVSRDGTLRLWKHNDNGTWQDIVMATSEKFLNAVCYD 64

Query: 418 QGKFATGTLDGEVMVYDIQKLL 439
           +        D E++ Y  Q+ L
Sbjct: 65  K--------DHELLFYSGQESL 78

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 12/65 (18%), Positives = 34/65 (52%)

Query: 200 LEWAPAGQSLLTGVESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMT 259
           +E   +G+ + T    G +++  ++G ++ +LS H + +  +K +     +++C  D   
Sbjct: 189 IEVLSSGKEIATCSNDGTIKISDLDGNIKQVLSGHESFVYNVKLSKQGDKLVSCGEDRSL 248

Query: 260 IVWNV 264
            +W++
Sbjct: 249 RIWDI 253

 Score = 30.4 bits (67), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 25/121 (20%), Positives = 51/121 (42%), Gaps = 11/121 (9%)

Query: 319 LRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWR-GGNLNPSHVFYGHSQSITSAHWVDDD 377
           L GH   +  +  ++    L+S  +D +LR+W    N N   V    + SI     + + 
Sbjct: 220 LSGHESFVYNVKLSKQGDKLVSCGEDRSLRIWDINNNFNIKQVIKLPAVSIWCVDTLPNG 279

Query: 378 TIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQK 437
            I+    D ++R+++       + + +D    FT  L        + +++ + M +D  K
Sbjct: 280 DIVVGCSDNTVRIFTEDQTRVASQSEID---EFTKQLE-------STSINSQTMDFDESK 329

Query: 438 L 438
           L
Sbjct: 330 L 330

>AER081C [2586] [Homologous to ScYLR409C - SH] (785301..788372)
           [3072 bp, 1023 aa]
          Length = 1023

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 68/148 (45%), Gaps = 6/148 (4%)

Query: 261 VWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLR 320
           V+N+ SG   + +   + G+   L VD       K    G+ G +  ++   +  +GKL+
Sbjct: 574 VYNLQSGIKRKVYKMHK-GSVTGLAVDGM---NRKMVSCGLDGLVGFYDFTTNSFLGKLQ 629

Query: 321 GHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDT-I 379
                +T + Y+  ++L   A DD +++V            +GHS  IT+  +  D   I
Sbjct: 630 -LGAPITQLVYHRASELFAVALDDFSIQVIDSVTQRVVRQLWGHSNRITAFDFSPDGRWI 688

Query: 380 ISTSMDGSIRVWSLASNSTVASATVDGV 407
           +S S+D ++R W L + + +    ++ V
Sbjct: 689 VSASLDSTLRTWDLPTGTCIDGVRLESV 716

 Score = 33.5 bits (75), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 30/159 (18%), Positives = 67/159 (42%), Gaps = 14/159 (8%)

Query: 197 VTCLEWAPAGQSLLTGVESGELRLWSVE-GKLQNILSYHRAPIVCIKWNSDETHVLTCDA 255
           V  +     G   L G  +G + +++++ G  + +   H+  +  +  +     +++C  
Sbjct: 551 VKSVAMTQCGNFALIGSSNGGISVYNLQSGIKRKVYKMHKGSVTGLAVDGMNRKMVSCGL 610

Query: 256 DNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWI----DQDKFAIPGIQGSILVFNIG 311
           D +   ++  + + +             LG   T +      + FA+     SI V +  
Sbjct: 611 DGLVGFYDFTTNSFLGKLQ---------LGAPITQLVYHRASELFAVALDDFSIQVIDSV 661

Query: 312 ISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW 350
             + + +L GHS  +T   ++   + ++SAS D+TLR W
Sbjct: 662 TQRVVRQLWGHSNRITAFDFSPDGRWIVSASLDSTLRTW 700

>Sklu_2332.7 YER107C, Contig c2332 14211-15314 reverse complement
          Length = 367

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 49/98 (50%), Gaps = 14/98 (14%)

Query: 207 QSLLTGVES--GELRLWSVEGKL-QNILSY-HRAPIVCIKWNSDETHVLTCDADNMTIVW 262
           Q  L  V S   ++R+W V G + Q    Y H+AP++  +W++D T V +   DN+  ++
Sbjct: 47  QDFLFSVSSWDNKVRIWDVNGGMAQGRAQYEHQAPVLTTRWSNDGTKVASGGCDNVVKLF 106

Query: 263 NVLSG---------TAVQHFSFKEAG-TEESLGVDATW 290
           +V SG         +A++H  F + G T     V  +W
Sbjct: 107 DVQSGQAQQVGAHDSAIRHLRFIQCGPTNTECLVTGSW 144

>Kwal_27.10385
          Length = 536

 Score = 42.0 bits (97), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 60/136 (44%), Gaps = 23/136 (16%)

Query: 316 IGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVD 375
           +  L  H + +  I +N  N +L +A DD  L +W+             + SI+    VD
Sbjct: 64  LSSLTQHEQAVNVIRFNSRNDVLATAGDDGQLLLWK------------RNDSISKEFGVD 111

Query: 376 DDTIISTSMDGSIRVWS-LASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYD 434
           ++         S  VW  L S+ST  S+ +     +  A SPD     TG++D  + +++
Sbjct: 112 EEEF--AEFKESWYVWKRLRSSSTAGSSEI-----YDLAWSPDDNYIVTGSMDNSLRIFE 164

Query: 435 IQK---LLQQLNHNGY 447
           +++   +    +HN Y
Sbjct: 165 VEEGTCVANAADHNHY 180

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 37/177 (20%), Positives = 73/177 (41%), Gaps = 34/177 (19%)

Query: 207 QSLLTGVESGELRLWSV------EGKLQNI-----LSYHRAPIVCIKWNSDETHVLTCDA 255
           + L+T     ++R+W +      E K+  I     L+ H   +  I++NS    + T   
Sbjct: 32  RRLVTAGGDNKIRVWQLNFEEQNENKVDTIDFLSSLTQHEQAVNVIRFNSRNDVLATAGD 91

Query: 256 DNMTIVW---NVLS---GTAVQHFS-FKE-------------AGTEESLGVDATWIDQDK 295
           D   ++W   + +S   G   + F+ FKE             AG+ E    D  W   D 
Sbjct: 92  DGQLLLWKRNDSISKEFGVDEEEFAEFKESWYVWKRLRSSSTAGSSEIY--DLAWSPDDN 149

Query: 296 FAIPG-IQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWR 351
           + + G +  S+ +F +     +     H+  +  + ++  N+ + S S D ++ V+R
Sbjct: 150 YIVTGSMDNSLRIFEVEEGTCVANAADHNHYVQGVVWDPQNEFIFSQSADRSVHVYR 206

>KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP 52 KD protein, start
           by similarity
          Length = 459

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 81/214 (37%), Gaps = 32/214 (14%)

Query: 203 APAGQSLLTGVESGELRLWSVEGKLQNIL---SYHRAPIVCIKWNSDETHVLTCDADNMT 259
           +P G  +  G  SG L L  V+  L  I    S     I  + W+ D  ++  C  D   
Sbjct: 188 SPGGDLMACGSWSGNLSL--VDNSLSKIYCNRSLSGTKISGLDWSVDSKNIFVCTHDGRI 245

Query: 260 IVWNVLSGTAVQHFSFKEAGTEE-----------SLGVDATWIDQDKFAIPGIQGSILVF 308
           ++++    T V+     +A   +           S   D TWI  D       Q  IL+ 
Sbjct: 246 VIYDSGDETTVKILYKNDARFAQVRCHPCNSFIGSTSFDKTWILIDTVK----QAPILI- 300

Query: 309 NIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSI 368
                       GHS  + +++++    L+ +A  D    +W   +        GHS+ I
Sbjct: 301 ----------QEGHSAEVFSLSFHNDGSLVSTAGLDAIALIWDIRSGKNIMSLQGHSKPI 350

Query: 369 TSAHWVDDD-TIISTSMDGSIRVWSLASNSTVAS 401
            S  W  +   + S S DG+I+VW +     V +
Sbjct: 351 YSVDWSQNGYQLASGSGDGTIKVWDIRKKGNVET 384

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 84/182 (46%), Gaps = 6/182 (3%)

Query: 257 NMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPI 316
           N+++V N LS     + +   +GT+ S G+D + +D     +    G I++++ G    +
Sbjct: 202 NLSLVDNSLSKI---YCNRSLSGTKIS-GLDWS-VDSKNIFVCTHDGRIVIYDSGDETTV 256

Query: 317 GKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDD 376
             L  +      +  +  N  + S S D T  +       P  +  GHS  + S  + +D
Sbjct: 257 KILYKNDARFAQVRCHPCNSFIGSTSFDKTWILIDTVKQAPILIQEGHSAEVFSLSFHND 316

Query: 377 DTIISTS-MDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDI 435
            +++ST+ +D    +W + S   + S      P ++   S +  + A+G+ DG + V+DI
Sbjct: 317 GSLVSTAGLDAIALIWDIRSGKNIMSLQGHSKPIYSVDWSQNGYQLASGSGDGTIKVWDI 376

Query: 436 QK 437
           +K
Sbjct: 377 RK 378

>Kwal_56.24478
          Length = 1296

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 62/140 (44%), Gaps = 12/140 (8%)

Query: 145 YVSQWNPKHEGVFAYGERDSRAAVVTYSVADGLWNISETVVLADANTGQQNEVTCLEWAP 204
           Y   WN     VFA       A++        + ++S T  +    TGQ+N+++ +EW P
Sbjct: 158 YSLAWNQNQGHVFASAGSSGFASIWDLKAKKEVIHLSHTSSI----TGQKNQLSIVEWHP 213

Query: 205 AGQSLL---TGVES-GELRLWSVEG---KLQNILSYHRAPIVCIKW-NSDETHVLTCDAD 256
              + +   +G +S   + +W +      LQ +   H   ++ + W   DET +L+   D
Sbjct: 214 NNSTRIATASGSDSDPSILVWDLRNANVPLQTLSQGHTKGVLSLDWCKQDETLLLSSGRD 273

Query: 257 NMTIVWNVLSGTAVQHFSFK 276
           N  ++WN  SG  +  F  +
Sbjct: 274 NSCVLWNPESGQNLTQFPTR 293

>ABL043W [549] [Homologous to ScYMR092C (AIP1) - SH]
           complement(314672..316492) [1821 bp, 606 aa]
          Length = 606

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 69/143 (48%), Gaps = 11/143 (7%)

Query: 249 HVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIP-GIQGSILV 307
            ++T  AD +  +W+V +   ++ +   E GTE +       + +D   I   + G++ V
Sbjct: 264 RIVTASADGVVRLWDVEANRLLKRW---ELGTEVAQQQVGVVVTRDSNIISVSLDGTLNV 320

Query: 308 FNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQS 367
           F+I   KPI  + GH K +T +  N     L++AS D  +  W       + V   HS S
Sbjct: 321 FSIESDKPIKTIEGHKKGITALKTNP----LVTASYDGRVLEWSAE--GTAAVAAMHSNS 374

Query: 368 ITSAHWVDDDTIISTSMDGSIRV 390
           +TS + V   T  + S DG+++V
Sbjct: 375 VTSINNVGGRT-CTVSWDGTLKV 396

 Score = 30.0 bits (66), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 46/100 (46%), Gaps = 7/100 (7%)

Query: 338 LLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNS 397
           ++S S D TL V+   +  P     GH + IT+   +  + +++ S DG +  WS    +
Sbjct: 309 IISVSLDGTLNVFSIESDKPIKTIEGHKKGITA---LKTNPLVTASYDGRVLEWSAEGTA 365

Query: 398 TVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQK 437
            VA+   + V +         G+  T + DG + V + +K
Sbjct: 366 AVAAMHSNSVTSINNV----GGRTCTVSWDGTLKVDNEEK 401

>Sklu_2420.2 YPL151C, Contig c2420 3924-5249
          Length = 441

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 69/161 (42%), Gaps = 9/161 (5%)

Query: 291 IDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW 350
           ID + FA      +I ++++   K    L GH  T+  I  ++ +  + SAS+D  ++ W
Sbjct: 140 IDNEWFATGSNDTTIKIWDLATGKLKLTLSGHIMTVKDICISKRHPYMFSASEDKLVKCW 199

Query: 351 RGGNLNPSHVFYGHSQSITSAHWVDD----DTIISTSMDGSIRVWSLASNSTVASATVDG 406
              +L  + V   +   ++  H VD     + I +   D  +R+W + +   V +     
Sbjct: 200 ---DLEKNRVIRDYHGHLSGVHTVDIHPTLNLIATAGRDSVVRLWDIRTKLPVMTMAGHK 256

Query: 407 VPNFTGALSPDQGKFATGTLDGEVMVYDIQ--KLLQQLNHN 445
            P       P   +  + + D  V ++DI   K L+ L H+
Sbjct: 257 SPINRVKCLPVDPQVVSCSADATVRLWDITAGKTLKVLTHH 297

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 48/95 (50%), Gaps = 2/95 (2%)

Query: 178 WNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNI-LSYHRA 236
           W++ +  V+ D + G  + V  ++  P    + T      +RLW +  KL  + ++ H++
Sbjct: 199 WDLEKNRVIRDYH-GHLSGVHTVDIHPTLNLIATAGRDSVVRLWDIRTKLPVMTMAGHKS 257

Query: 237 PIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQ 271
           PI  +K    +  V++C AD    +W++ +G  ++
Sbjct: 258 PINRVKCLPVDPQVVSCSADATVRLWDITAGKTLK 292

>KLLA0F22000g complement(2044973..2047354) similar to sp|P42935
           Saccharomyces cerevisiae YGR200c ELP2 90 kDa subunit of
           elongator and elongating RNA polymerase II holoenzyme
           singleton, start by similarity
          Length = 793

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 75/184 (40%), Gaps = 29/184 (15%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVL 251
           G   EVTC+ +      +++  E  E+R+W+       +   H   + CI+      H +
Sbjct: 54  GHTAEVTCVRFVKGTDMMVSASEDFEVRVWN----FPKLREGHMDEVECIQVIKHHKHTI 109

Query: 252 T------------CDADNMTIVWNVLSGTAV--QHFSFKEAGTEESLGVDATWIDQDKFA 297
           T            C AD    VW+ +    V  + FS ++      L +      Q   A
Sbjct: 110 TVFAVLKNLLVVGC-ADGSISVWSFIEDQYVLQEEFSVQKGVFPLCLSMHEIEKTQFILA 168

Query: 298 IPGIQGSILVFNI-----GISKP--IGKLRGHSKTLTTIAYNEH---NKLLLSASDDNTL 347
           I G   ++ ++++     G+SK     KL GH   + ++ + E    + LL S S D  +
Sbjct: 169 IGGTNVNVFIYSLVSNSEGVSKLEFATKLEGHEDWIKSLVFRETVPGDYLLASGSQDRYI 228

Query: 348 RVWR 351
           R+WR
Sbjct: 229 RLWR 232

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 42/89 (47%), Gaps = 9/89 (10%)

Query: 319 LRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSH--------VFYGHSQSITS 370
           L+GH+  +T + + +   +++SAS+D  +RVW    L   H        V   H  +IT 
Sbjct: 52  LKGHTAEVTCVRFVKGTDMMVSASEDFEVRVWNFPKLREGHMDEVECIQVIKHHKHTIT- 110

Query: 371 AHWVDDDTIISTSMDGSIRVWSLASNSTV 399
              V  + ++    DGSI VWS   +  V
Sbjct: 111 VFAVLKNLLVVGCADGSISVWSFIEDQYV 139

 Score = 37.4 bits (85), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 44/101 (43%), Gaps = 8/101 (7%)

Query: 319 LRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYG-----HSQSITSAHW 373
           L  H+ T+T + +++ N+ LLS S D    +W     N S V        HS+ I  A W
Sbjct: 603 LPFHNLTITKLRFSKDNRYLLSVSRDRLWSLWERNFDNNSFVLRSFKEKPHSRIIWDADW 662

Query: 374 V---DDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFT 411
           V        I+ S D +++ W L+      S  ++    F+
Sbjct: 663 VPLAKGLAFITASRDKTLKFWRLSKEDEATSVELENSIRFS 703

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/78 (21%), Positives = 39/78 (50%), Gaps = 7/78 (8%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGE-----LRLWSVEG--KLQNILSYHRAPIVCIKWN 244
           G   E++C++ +P  + + T  +S       +RL+  E   +L  +L +H   I  ++++
Sbjct: 557 GHGYEISCIDVSPDRKLIATACKSNNAQHAVIRLFDAENWNQLPQVLPFHNLTITKLRFS 616

Query: 245 SDETHVLTCDADNMTIVW 262
            D  ++L+   D +  +W
Sbjct: 617 KDNRYLLSVSRDRLWSLW 634

>CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces
           cerevisiae YDR267c, start by similarity
          Length = 337

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 66/307 (21%), Positives = 112/307 (36%), Gaps = 80/307 (26%)

Query: 155 GVFAYGERDSRAAVVTYSVADGLWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVE 214
           G+ A G  D    V+       L N  E ++    +T  +  V  + W P    L  G  
Sbjct: 26  GLLATGSTDRAIKVLQ------LKNGKENLLDVLDDTVHKKAVRSVAWRPHSDLLAAGSF 79

Query: 215 SGELRLWS-----------VEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWN 263
              + +W+           +E +L  I+  H   +  I W+ D   + TC  D    +W 
Sbjct: 80  DSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWE 139

Query: 264 VLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHS 323
                        EAG E                                + I  L+ HS
Sbjct: 140 T-----------DEAGEE-------------------------------YECISVLQEHS 157

Query: 324 KTLTTIAYNEHNKLLLSASDDNTLRVWR--GGNLNPSHVFYGHSQSITSAHWVDDDTII- 380
           + +  + ++  + LL S+S D+T+R+W+    +   + V  GH  +I  + +  ++  I 
Sbjct: 158 QDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIR 217

Query: 381 --STSMDGSIRVWSLASNST------VASATVDGVPN------FTGALSPDQGKFATGTL 426
             S S D ++RVW    +        V  +T   +PN      +  A SP  G+ A+   
Sbjct: 218 LCSGSDDSTVRVWKYIGDDEDDQQEWVCEST---LPNAHRSQIYGVAWSP-SGRIASVGA 273

Query: 427 DGEVMVY 433
           DG + VY
Sbjct: 274 DGVLAVY 280

>YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the
           trimeric G protein that mediates signal transduction by
           pheromones, member of the WD (WD-40) repeat family [1272
           bp, 423 aa]
          Length = 423

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 39/85 (45%), Gaps = 1/85 (1%)

Query: 354 NLNPSHVFYGHSQSITSAHWV-DDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTG 412
           NL P+ V  GH+  I+   W  D   I+S S DG + +W  AS     +  +D     + 
Sbjct: 81  NLKPNIVLKGHNNKISDFRWSRDSKRILSASQDGFMLIWDSASGLKQNAIPLDSQWVLSC 140

Query: 413 ALSPDQGKFATGTLDGEVMVYDIQK 437
           A+SP     A+  L+    +Y + K
Sbjct: 141 AISPSSTLVASAGLNNNCTIYRVSK 165

 Score = 36.6 bits (83), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 40/226 (17%), Positives = 84/226 (37%), Gaps = 31/226 (13%)

Query: 230 ILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDAT 289
           +L  H   I   +W+ D   +L+   D   ++W+  SG             + ++ +D+ 
Sbjct: 87  VLKGHNNKISDFRWSRDSKRILSASQDGFMLIWDSASGL-----------KQNAIPLDSQ 135

Query: 290 WI-------DQDKFAIPGIQGSILVFNIGISKPIGK-----LRGHSKTLTTIAYNEHNKL 337
           W+            A  G+  +  ++ +     + +      +GH+  ++ I + + N  
Sbjct: 136 WVLSCAISPSSTLVASAGLNNNCTIYRVSKENRVAQNVASIFKGHTCYISDIEFTD-NAH 194

Query: 338 LLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDD-------DTIISTSMDGSIRV 390
           +L+AS D T  +W          +  H   + +    ++       +T  S   DG   +
Sbjct: 195 ILTASGDMTCALWDIPKAKRVREYSDHLGDVLALAIPEEPNSENSSNTFASCGSDGYTYI 254

Query: 391 WSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQ 436
           W   S S V S  V+           D      G+ +G + +YD++
Sbjct: 255 WDSRSPSAVQSFYVNDSDINALRFFKDGMSIVAGSDNGAINMYDLR 300

 Score = 29.6 bits (65), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 39/231 (16%), Positives = 87/231 (37%), Gaps = 12/231 (5%)

Query: 179 NISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLW-SVEGKLQNILSYHRAP 237
           N+   +VL     G  N+++   W+   + +L+  + G + +W S  G  QN +      
Sbjct: 81  NLKPNIVL----KGHNNKISDFRWSRDSKRILSASQDGFMLIWDSASGLKQNAIPLDSQW 136

Query: 238 IVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFA 297
           ++    +   T V +   +N   ++ V     V                D  + D     
Sbjct: 137 VLSCAISPSSTLVASAGLNNNCTIYRVSKENRVAQNVASIFKGHTCYISDIEFTDNAHIL 196

Query: 298 IPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEH------NKLLLSASDDNTLRVWR 351
                 +  +++I  +K + +   H   +  +A  E       +    S   D    +W 
Sbjct: 197 TASGDMTCALWDIPKAKRVREYSDHLGDVLALAIPEEPNSENSSNTFASCGSDGYTYIWD 256

Query: 352 GGNLNPSHVFYGHSQSITSAHWVDDD-TIISTSMDGSIRVWSLASNSTVAS 401
             + +    FY +   I +  +  D  +I++ S +G+I ++ L S+ ++A+
Sbjct: 257 SRSPSAVQSFYVNDSDINALRFFKDGMSIVAGSDNGAINMYDLRSDCSIAT 307

 Score = 29.3 bits (64), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 26/129 (20%), Positives = 56/129 (43%), Gaps = 5/129 (3%)

Query: 314 KPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHW 373
           KP   L+GH+  ++   ++  +K +LSAS D  + +W   +    +     SQ + S   
Sbjct: 83  KPNIVLKGHNNKISDFRWSRDSKRILSASQDGFMLIWDSASGLKQNAIPLDSQWVLSCAI 142

Query: 374 VDDDTIISTS-MDGSIRVWSLASNSTVASATVDGVPNFTGALS----PDQGKFATGTLDG 428
               T+++++ ++ +  ++ ++  + VA          T  +S     D     T + D 
Sbjct: 143 SPSSTLVASAGLNNNCTIYRVSKENRVAQNVASIFKGHTCYISDIEFTDNAHILTASGDM 202

Query: 429 EVMVYDIQK 437
              ++DI K
Sbjct: 203 TCALWDIPK 211

>Sklu_2423.1 YLR409C, Contig c2423 869-3703
          Length = 944

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 77/170 (45%), Gaps = 9/170 (5%)

Query: 261 VWNVLSGTAVQHFSF-KEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKL 319
           V+N+ SG   + +   K+A T    GV    +++ K    G+ G I  ++   S  +GKL
Sbjct: 492 VYNLQSGLQRKKYRLHKKAVT----GVAIDGMNR-KMVSCGLDGLIGFYDFTKSAFLGKL 546

Query: 320 RGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDT- 378
           +  +  +T++ Y+  + L   A DD ++ V            +GHS  +T+  +  D   
Sbjct: 547 QLDA-PVTSMVYHRSSDLFAVALDDLSIVVIDAVTQKVVRQLWGHSNRVTAFDFSPDGRW 605

Query: 379 IISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDG 428
           I+S S+D +IR W L +   +    +D V       SP+    AT  + G
Sbjct: 606 IVSASLDSTIRTWDLPTGGCIDGVRLDSVAT-NLKFSPNGDLLATTHVTG 654

>CAGL0B03575g complement(357525..358784) similar to sp|P39984
           Saccharomyces cerevisiae YEL056w HAT2, hypothetical
           start
          Length = 419

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/218 (21%), Positives = 92/218 (42%), Gaps = 37/218 (16%)

Query: 208 SLLTGVESGELRLWSVEGKLQNI---LSY---HRAPIVCIKWNSDETHVLTCDADNMTI- 260
           SLL+G +   + LW +    +NI   +++   H   I  +KW+S E H+    +++ T+ 
Sbjct: 194 SLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMK 253

Query: 261 VWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNI-GISKPIGKL 319
           +++  S   + + + K+     +          + FA  G    + +++I  +S P+  +
Sbjct: 254 LFDKRSSQIIHNINTKKPYNTLAFSP----FSSNLFAAAGTDNLVYLYDIRDVSNPLYAM 309

Query: 320 RGHSKTLTTIAYNEHNK-LLLSASDDNTLRVWRGGNL-----------NPSHVFY---GH 364
            GH   +T I ++ +N  +L S+  D    VW    +            P  V     GH
Sbjct: 310 TGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGH 369

Query: 365 SQSIT------SAHWVDDDTIISTSMDGSIRVWSLASN 396
             SI       + +W+    + S   D  +++W  +SN
Sbjct: 370 KTSINDIAVNPNINWL----VASAEEDNIVQIWKCSSN 403

>Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement
          Length = 711

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 75/167 (44%), Gaps = 26/167 (15%)

Query: 315 PIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWV 374
           P+  L GH   + +++    N  ++S+S D T +VW  G  +  +   GHS S+  A ++
Sbjct: 91  PVYMLIGHKGNVCSLS--SKNNFVISSSWDKTAKVWHNG--SAIYDLVGHSASVWDAKFL 146

Query: 375 -DDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGA---------LSPDQGKFATG 424
            + D  ++ S D +I++W    N  + +        F+G          +SPD   FA+ 
Sbjct: 147 PEKDFFLTASADCTIKLWH--GNKLIKT--------FSGIHKDVIRHLDISPDGETFASC 196

Query: 425 TLDGEVMVYDIQ-KLLQQLN-HNGYHGTARSAEVARIPVVGDHRSAR 469
           + DG V + D+   +L+    H  +  + +      +   G+ RS R
Sbjct: 197 SNDGTVKINDMDGNILKTFTGHESFVYSVKFLPNGDLVSCGEDRSVR 243

 Score = 33.1 bits (74), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%)

Query: 363 GHSQSITSAHWVDDDTIISTSMDGSIRVWS 392
           GH Q + S   ++D  + S S DG++RVWS
Sbjct: 10  GHEQDVKSVVAINDSQVASCSRDGTVRVWS 39

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 25/117 (21%), Positives = 39/117 (33%), Gaps = 40/117 (34%)

Query: 316 IGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNL-------------------- 355
           I  L GHS ++    +       L+AS D T+++W G  L                    
Sbjct: 130 IYDLVGHSASVWDAKFLPEKDFFLTASADCTIKLWHGNKLIKTFSGIHKDVIRHLDISPD 189

Query: 356 --------------------NPSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWS 392
                               N    F GH   + S  ++ +  ++S   D S+RVWS
Sbjct: 190 GETFASCSNDGTVKINDMDGNILKTFTGHESFVYSVKFLPNGDLVSCGEDRSVRVWS 246

>AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH]
           (409496..411169) [1674 bp, 557 aa]
          Length = 557

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/191 (22%), Positives = 81/191 (42%), Gaps = 17/191 (8%)

Query: 220 LWSVE-GKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEA 278
           LW+ E G++  +  +    I  + W++D+ H+     D  T +W+V + + V+       
Sbjct: 247 LWNGETGEVSLLTEFETETITSVVWSNDDCHISIGKDDGNTEIWDVETMSHVRTM----- 301

Query: 279 GTEESLGV---DATWIDQDKFAIPGIQGSILVFNIGISKPI-GKLRGHSKTLTTIAYNEH 334
               SLGV      W+D     I    G I V ++ +   I      H+  +  I + + 
Sbjct: 302 --RSSLGVRICSQDWLDT-VVCIGAKSGEIQVNDVRVKDHIVSTWEKHTSEVCGIKFRQD 358

Query: 335 NKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDD-DTIIST---SMDGSIRV 390
              L S  +DNT+ +W      P  V   H+ ++ +  W  D   +++T   S+D  I  
Sbjct: 359 GLQLASGGNDNTVMIWDTRQDEPLWVKRNHNAAVKAITWHPDVVNLLATGGGSLDRHIHF 418

Query: 391 WSLASNSTVAS 401
           W+  + + + S
Sbjct: 419 WNTTTGARIGS 429

>CAGL0L02761g complement(320826..322085) similar to sp|P18851
           Saccharomyces cerevisiae YOR212w STE4, hypothetical
           start
          Length = 419

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/224 (18%), Positives = 85/224 (37%), Gaps = 29/224 (12%)

Query: 230 ILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDAT 289
           IL  H   I   +W+ D   +L+   D   IVW+ L+G               ++ +D+ 
Sbjct: 80  ILKGHTNKIADFRWSRDSKLILSASQDGFMIVWDSLTGLK-----------RSAIPLDSQ 128

Query: 290 WIDQDKF-------AIPGIQGSILVFNIGISKPIGK-----LRGHSKTLTTIAYNEHNKL 337
           W+            A  G+  +  ++ +     + +      +GH+  ++ + +   +++
Sbjct: 129 WVLTCALSPSGALAASAGLNNNCTIYRMPRGSAVQQNVTSIFKGHTGYISGVEFVSESRV 188

Query: 338 LLSASDDNTLRVWRGGNLNPSHVFYGH-----SQSITSAHWVDDDTIISTSMDGSIRVWS 392
           + S S D T  +W          +  H     + SI   +   ++   S   DG   +W 
Sbjct: 189 VTS-SGDMTCALWDIPKAKRVREYSDHLGDVLAISIPVTNLSKNNMFASCGSDGYTFIWD 247

Query: 393 LASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQ 436
           + S S V   ++    +      PD    A G  DG + ++D++
Sbjct: 248 VRSPSAVQQFSIGSCDSNCLKFFPDGNSVAVGNDDGTISLFDLR 291

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 37/85 (43%), Gaps = 1/85 (1%)

Query: 354 NLNPSHVFYGHSQSITSAHWV-DDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTG 412
           NL P  +  GH+  I    W  D   I+S S DG + VW   +    ++  +D     T 
Sbjct: 74  NLKPVGILKGHTNKIADFRWSRDSKLILSASQDGFMIVWDSLTGLKRSAIPLDSQWVLTC 133

Query: 413 ALSPDQGKFATGTLDGEVMVYDIQK 437
           ALSP     A+  L+    +Y + +
Sbjct: 134 ALSPSGALAASAGLNNNCTIYRMPR 158

 Score = 37.0 bits (84), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 24/37 (64%)

Query: 314 KPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW 350
           KP+G L+GH+  +    ++  +KL+LSAS D  + VW
Sbjct: 76  KPVGILKGHTNKIADFRWSRDSKLILSASQDGFMIVW 112

>YLR409C (UTP21) [3786] chr12 complement(934411..937230) Member of
           the Utp21-specific WD40 associated domain containing
           family, contains seven WD domains (WD-40 repeat), which
           may mediate protein-protein interactions, has high
           similarity to uncharacterized C. albicans Orf6.6423p
           [2820 bp, 939 aa]
          Length = 939

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 59/135 (43%), Gaps = 3/135 (2%)

Query: 295 KFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGN 354
           K    G+ G +  ++   S  +GKL+  +  +T + Y+  + L   A DD ++ V     
Sbjct: 516 KMVSCGLDGIVGFYDFNKSTLLGKLKLDAP-ITAMVYHRSSDLFALALDDLSIVVIDAVT 574

Query: 355 LNPSHVFYGHSQSITSAHWVDDDT-IISTSMDGSIRVWSLASNSTVASATVDGVPNFTGA 413
                  +GHS  IT+  +  +   I+S S+D +IR W L +   +    VD V      
Sbjct: 575 QRVVRQLWGHSNRITAFDFSPEGRWIVSASLDSTIRTWDLPTGGCIDGIIVDNVAT-NVK 633

Query: 414 LSPDQGKFATGTLDG 428
            SP+    AT  + G
Sbjct: 634 FSPNGDLLATTHVTG 648

 Score = 37.7 bits (86), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 33/161 (20%), Positives = 68/161 (42%), Gaps = 18/161 (11%)

Query: 197 VTCLEWAPAGQSLLTGVESGELRLWSVE-GKLQNILSYHRAPIVCIKWNSDETHVLTCDA 255
           V  +  +  G     G  +G + +++++ G L+     H+  +  I  +     +++C  
Sbjct: 463 VKSVAMSQCGNFGFIGSSNGSITIYNMQSGILRKKYKLHKRAVTGISLDGMNRKMVSCGL 522

Query: 256 DNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWI------DQDKFAIPGIQGSILVFN 309
           D +           V  + F ++     L +DA           D FA+     SI+V +
Sbjct: 523 DGI-----------VGFYDFNKSTLLGKLKLDAPITAMVYHRSSDLFALALDDLSIVVID 571

Query: 310 IGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW 350
               + + +L GHS  +T   ++   + ++SAS D+T+R W
Sbjct: 572 AVTQRVVRQLWGHSNRITAFDFSPEGRWIVSASLDSTIRTW 612

>Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement
          Length = 314

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 87/172 (50%), Gaps = 15/172 (8%)

Query: 273 FSFKEA--GTEESLGV-DATWIDQDKFAIPGIQG-SILVFNI--GISKPIGKLRGHSKTL 326
           FSF+ +   +E+S+G+  +  +  D   I   QG S L++N+  G+S  I     H +++
Sbjct: 2   FSFQTSIPTSEKSVGICTSAKVSPDGKFIAVSQGTSYLLYNVSDGLSAFIP--TSHVESM 59

Query: 327 TTIAYNEHNKLLLSASDDNTLRV--WRGGNLNPSHVFYGHSQSITSAHWVDD-DTIISTS 383
           + I ++  ++ + +ASDD T+ +     G L   H   GH+  + S  +    + + S S
Sbjct: 60  SDICWSPDSQCIATASDDFTIEINHITYGRL---HRLVGHTAPVLSLVYTSKGNLLCSAS 116

Query: 384 MDGSIRVWSLASNSTVASATVDGVPNFTGALS-PDQGKFATGTLDGEVMVYD 434
           MD SI++W + + + + + +    P  +  +   D    ++G+ DG + ++D
Sbjct: 117 MDESIKIWDVLTGTLLKTISAHSEPVVSIDMPVCDPSILSSGSYDGLIRIFD 168

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/189 (20%), Positives = 79/189 (41%), Gaps = 21/189 (11%)

Query: 171 YSVADGLWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVE-GKLQN 229
           Y+V+DGL         A   T     ++ + W+P  Q + T  +   + +  +  G+L  
Sbjct: 41  YNVSDGL--------SAFIPTSHVESMSDICWSPDSQCIATASDDFTIEINHITYGRLHR 92

Query: 230 ILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDAT 289
           ++  H AP++ + + S    + +   D    +W+VL+GT ++  S   A +E  + +D  
Sbjct: 93  LVG-HTAPVLSLVYTSKGNLLCSASMDESIKIWDVLTGTLLKTIS---AHSEPVVSIDMP 148

Query: 290 WIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSK--------TLTTIAYNEHNKLLLSA 341
             D    +     G I +F+      +  L              ++ + ++ + K LL  
Sbjct: 149 VCDPSILSSGSYDGLIRIFDTTTGHCLKTLTYDKDWKSENGVVPISQVKFSVNGKYLLVK 208

Query: 342 SDDNTLRVW 350
           S D  L++W
Sbjct: 209 SLDGVLKIW 217

>Kwal_56.23895
          Length = 367

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/176 (21%), Positives = 73/176 (41%), Gaps = 30/176 (17%)

Query: 246 DETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSI 305
           D   +++C  ++   ++++        +SF      E+L  D         A  G+   I
Sbjct: 187 DPNVIMSCAGNSYVTMFDLRQPPGANQYSFLAHNGMETLTCDFNKYRSHIVATGGVDNMI 246

Query: 306 LVFNIGISKP----------IGKLRGHSKTLTTIAYN-EHNKLLLSASDDNTLRVW---- 350
            V+++ + +           + ++ GH   +  ++++  H+ +LLS S D T RVW    
Sbjct: 247 KVWDLRMVRKAASNSRQPMSVNEICGHDLAIRKVSWSPHHSNMLLSTSYDMTCRVWQDLS 306

Query: 351 --------RGGNLNPSH----VFYGHSQSITSAHWV---DDDTIISTSMDGSIRVW 391
                   +  +++P+     VF  H++ +  A W        I STS DG + VW
Sbjct: 307 DDGRRPTGKTNSVDPARGCRFVFPHHTEFVFGADWSLWGKPGYIASTSWDGDVCVW 362

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 46/82 (56%), Gaps = 4/82 (4%)

Query: 326 LTTIAYNE-HNKLLLSASDDNTLRVWRGGNLN-PSHVFYGHSQSITSAHW--VDDDTIIS 381
           L  +A+NE H   +L A  D +LR++     + P  +F+ H + + S +W  ++    +S
Sbjct: 63  LFDVAWNELHENQVLVAQGDGSLRLFDTQLTDYPIAIFHEHEKEVFSCNWNLINKQLFVS 122

Query: 382 TSMDGSIRVWSLASNSTVASAT 403
           +S DG+++VWS     ++A+ T
Sbjct: 123 SSWDGTVKVWSPTRPKSLATLT 144

>KLLA0F07403g 697593..698636 similar to sp|P40217 Saccharomyces
           cerevisiae YMR146c TIF34 translation initiation factor
           eIF3, p39 subunit singleton, start by similarity
          Length = 347

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 60/141 (42%), Gaps = 17/141 (12%)

Query: 314 KPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHW 373
           +PI  L+GH + LT + +N    L+ + S D+   +W   N         HS +I S   
Sbjct: 2   RPI-VLKGHERPLTQVKFNRDGDLVFACSKDSVASIWYAINGERLGTLDDHSGTIWSID- 59

Query: 374 VDDDTI--ISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLD---- 427
           VD+ T   ++   D   ++W +A+   V S +    P      SPD  K     LD    
Sbjct: 60  VDESTTYALTGGADFCFKIWKVATGVAVHSVSTRS-PVLRVEFSPDGSKLLI-VLDAVMG 117

Query: 428 --GEVMVYDIQKLLQQLNHNG 446
             G ++VY + +     N NG
Sbjct: 118 HIGSIVVYSLIR-----NENG 133

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 11/38 (28%), Positives = 20/38 (52%)

Query: 230 ILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSG 267
           +L  H  P+  +K+N D   V  C  D++  +W  ++G
Sbjct: 5   VLKGHERPLTQVKFNRDGDLVFACSKDSVASIWYAING 42

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 33/174 (18%), Positives = 70/174 (40%), Gaps = 24/174 (13%)

Query: 193 QQNEVTCLEWAPAGQSLLTGVESGELRLWSVE-GKLQNILSYHRAPIVCIKWNSDETHVL 251
           Q  +V    W+  G+ ++ G E G++  +  E G+       H   I  I+++ D T+ +
Sbjct: 151 QATKVFVASWSYNGKYIIAGHEDGQISAYYGENGEFVQAKKIHEKSIKDIQFSPDRTYFI 210

Query: 252 TCDADNMTIVWNVLSGTAVQHFS------------FKE----AGTEESLGVDATWIDQDK 295
           T   D++  + +V +   ++ +              KE     G +++  V  T   + K
Sbjct: 211 TSSRDSVASLVDVDTFEVLKTYKADCPLNSASITPLKEFVILGGGQDAKDVTTTSAREGK 270

Query: 296 FAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRV 349
           F          +++      IG+++GH   L  +A +       S  +D  +R+
Sbjct: 271 F-------EARIYHKVFQDEIGRVKGHFGPLNYVAVSPTGTSYASGGEDGYIRL 317

>Kwal_14.1710
          Length = 574

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 58/140 (41%), Gaps = 6/140 (4%)

Query: 238 IVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFA 297
           I  + W+ D+ H+     +  T +W+V S   + H     +G    +G   +W++    A
Sbjct: 281 ITSVTWSDDDCHISIGKVEGNTEIWDVDS---MSHVRTMRSGLGVRIG-SQSWLET-LIA 335

Query: 298 IPGIQGSILVFNIGISKPI-GKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLN 356
                G I + ++ I   I      H   +  IAY      L S S+DNT+ +W      
Sbjct: 336 TGSKSGEIHINDVRIKNHIVSTWEEHKGEVCGIAYRPDGLQLASGSNDNTVAIWDTRTSL 395

Query: 357 PSHVFYGHSQSITSAHWVDD 376
           P H+   H+ ++ +  W  D
Sbjct: 396 PQHIKRQHTAAVKALAWSPD 415

>Sklu_2317.3 YDR142C, Contig c2317 5804-6910
          Length = 368

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 68/139 (48%), Gaps = 27/139 (19%)

Query: 266 SGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKT 325
           SG  VQ+  F +     + G +        F + G  G + + +I    P G++   +  
Sbjct: 10  SGYGVQYSPFYDNKLAVATGSN--------FGLVG-NGKLFILDI---DPHGRMVESNSF 57

Query: 326 LTT-----IAYNE-HNKLLLSASDDNTLRVWRGGNLN----PSHVFYGHSQSITSAHW-- 373
           LT      +A+NE H   +L+A  D +LR++   ++N    P  +F  H + + S +W  
Sbjct: 58  LTQDGLFDVAWNEGHANQVLAAQGDGSLRLF---DINLPQYPISIFQEHQKEVFSCNWNL 114

Query: 374 VDDDTIISTSMDGSIRVWS 392
           V+  T +S+S DG++++WS
Sbjct: 115 VNKQTFVSSSWDGTVKIWS 133

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/230 (20%), Positives = 103/230 (44%), Gaps = 33/230 (14%)

Query: 193 QQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVLT 252
           +Q  +T L   P  +S L   ++G + L + +    +I+S ++  I   +++  + +++ 
Sbjct: 136 RQESLTTLVPIPMERSPLVEAKAGGIPLSNQQN--HSIISKNKDCIYQAQFSPHDPNLIM 193

Query: 253 CDADNMTI-VWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIG 311
           C A N  + ++++   T     +F   G  E+L  D         A  G+   + ++++ 
Sbjct: 194 CCAGNSYVTLFDLRQPTNTNQQNFMSHGGLETLTCDFNKYRPHIVATGGVDKLVKIWDLR 253

Query: 312 I----SKP------IGKLRGHSKTLTTIAYNEHN-KLLLSASDDNTLRVW---------- 350
           +    S P      I ++ GH   +  ++++ H+  L+LS S D T RVW          
Sbjct: 254 MVRKFSNPLQQPMSINEIPGHELAIRKVSWSPHHSNLVLSTSYDMTCRVWDDLSDSNGRP 313

Query: 351 --RGGNLNPSH----VFYGHSQSITSAHWV---DDDTIISTSMDGSIRVW 391
             +  +++P+     +F  H++ +  A W        + ST+ DG++ +W
Sbjct: 314 TGKTNSIDPTKGCRFIFPHHTEFVFGADWSLWGQPGYVASTAWDGNVCIW 363

>ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH]
           complement(140589..143003) [2415 bp, 804 aa]
          Length = 804

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 45/85 (52%), Gaps = 2/85 (2%)

Query: 319 LRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGG-NLNPSHVFYGHSQSITSAHWVDDD 377
           L+ H+  +T++ +    KLL+SAS D T+ VWRG      +    G   S+TS   V   
Sbjct: 75  LKAHNAEVTSVKFIGAEKLLVSASADATINVWRGDERWELAQTLEGPKSSVTSLA-VAAG 133

Query: 378 TIISTSMDGSIRVWSLASNSTVASA 402
            I++   DG++ VWS   ++ V S+
Sbjct: 134 LIVAGFADGTLSVWSEHDDAFVLSS 158

 Score = 33.5 bits (75), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 38/78 (48%), Gaps = 7/78 (8%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGE-----LRLWSVEGKLQ--NILSYHRAPIVCIKWN 244
           G   E++C++ +P G+ L +  +S       +R++S    LQ      +H   I  ++++
Sbjct: 569 GHGYEISCVDVSPDGKLLASACKSNNTSHAVVRIFSTHTWLQLPPCPEFHNLTITRLRFS 628

Query: 245 SDETHVLTCDADNMTIVW 262
            D  H+L+   D M  VW
Sbjct: 629 KDNRHLLSVSRDRMWAVW 646

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 7/79 (8%)

Query: 322 HSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYG----HSQSITSAHWVDDD 377
           H+ T+T + +++ N+ LLS S D    VW   + +   + Y     HS+ I    W+   
Sbjct: 618 HNLTITRLRFSKDNRHLLSVSRDRMWAVWYRNDDDTFTLKYSDQKPHSRIIWDGDWLPAS 677

Query: 378 T---IISTSMDGSIRVWSL 393
                ++ S D ++++W L
Sbjct: 678 CGTAFVTASRDKTVKIWRL 696

>CAGL0K11638g complement(1123343..1125121) weakly similar to
           sp|Q03177 Saccharomyces cerevisiae YMR102c, hypothetical
           start
          Length = 592

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 47/107 (43%), Gaps = 4/107 (3%)

Query: 335 NKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWV--DDDTIISTSMDGSIRVWS 392
           N  LL +S D+ + +W   + N   + + H   +TSA ++  DD   IS  +D  +R WS
Sbjct: 163 NHFLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRFWS 222

Query: 393 LASNSTVASATVDGVPNFTGALSPDQGKF-ATGTLDGEVMVYDIQKL 438
           +  N    S   +   N    +SP    F   GT  G + V+    L
Sbjct: 223 VTDNRVEYSFNCEEPINVV-TVSPGMSHFTVVGTFGGYIYVFSTMGL 268

>Kwal_27.10785
          Length = 367

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 48/86 (55%), Gaps = 5/86 (5%)

Query: 190 NTGQQNEVTCLEWAPAGQSLLTGVES--GELRLWSVEG-KLQNILSY-HRAPIVCIKWNS 245
           N   ++ ++ + ++P  Q  L  V S   ++R+W V G + Q    Y H+AP++  +W++
Sbjct: 31  NNPAEDSISDIAFSPQ-QDFLFSVSSWDKKVRVWDVNGGQAQCRAEYQHQAPVLATRWST 89

Query: 246 DETHVLTCDADNMTIVWNVLSGTAVQ 271
           D T + +   DN  +V++V SG + Q
Sbjct: 90  DGTKIASGGCDNAVMVFDVSSGQSQQ 115

>AGL301C [4011] [Homologous to ScYER107C (GLE2) - SH]
           (137221..138306) [1086 bp, 361 aa]
          Length = 361

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 218 LRLWSVE-GKLQNILSY-HRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQ 271
           +R+W V+ G  Q    Y H+AP++  +W+SD T V +   DN+  +++V SG A Q
Sbjct: 58  VRIWDVQNGMTQGRAQYEHQAPVLTTRWSSDGTKVASGGCDNILKLYDVASGQAQQ 113

>Sklu_2364.2 YGL004C, Contig c2364 1650-2885 reverse complement
          Length = 411

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 54/110 (49%), Gaps = 2/110 (1%)

Query: 295 KFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGN 354
           KFAI    GSI + +  +   +  L GH   +T + +   +++LLS+S D  L++W   +
Sbjct: 114 KFAIGDTMGSITLHDSSLKTKLS-LDGHDAEITDLKFFPSSQVLLSSSLDMRLKIWSALD 172

Query: 355 LNPSHVFYGHSQSITSAHWVDD-DTIISTSMDGSIRVWSLASNSTVASAT 403
            +      GH   IT    ++    I+S S DG++++W   S   + + T
Sbjct: 173 GSNPRTIMGHKSIITGTEIIERGRNILSCSKDGTVKLWECGSGKNIYTFT 222

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 42/87 (48%), Gaps = 1/87 (1%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWS-VEGKLQNILSYHRAPIVCIKWNSDETHV 250
           G   E+T L++ P+ Q LL+      L++WS ++G     +  H++ I   +      ++
Sbjct: 139 GHDAEITDLKFFPSSQVLLSSSLDMRLKIWSALDGSNPRTIMGHKSIITGTEIIERGRNI 198

Query: 251 LTCDADNMTIVWNVLSGTAVQHFSFKE 277
           L+C  D    +W   SG  +  F+ +E
Sbjct: 199 LSCSKDGTVKLWECGSGKNIYTFTRRE 225

>YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative
           spliceosomal protein with similarity to S. pombe prp5p,
           has four WD (WD-40) repeats [1356 bp, 451 aa]
          Length = 451

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/159 (21%), Positives = 67/159 (42%), Gaps = 5/159 (3%)

Query: 291 IDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW 350
           +D + F       ++ V+++   K    L GH  T+  +A ++ +  L S S+D T++ W
Sbjct: 150 VDNEWFITGSNDTTMKVWDLATGKLKTTLAGHVMTVRDVAVSDRHPYLFSVSEDKTVKCW 209

Query: 351 RGGNLNPSHVFYGHSQSI--TSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVDGVP 408
                     +YGH   +   S H    D I +   D  I++W + +   V +      P
Sbjct: 210 DLEKNQIIRDYYGHLSGVRTVSIH-PTLDLIATAGRDSVIKLWDMRTRIPVITLVGHKGP 268

Query: 409 NFTGALSPDQGKFATGTLDGEVMVYDI--QKLLQQLNHN 445
                 +P   +  + + D  V ++D+   K ++ L H+
Sbjct: 269 INQVQCTPVDPQVVSSSTDATVRLWDVVAGKTMKVLTHH 307

>AGL190W [4122] [Homologous to ScYDR142C (PEX7) - SH]
           complement(341382..342494) [1113 bp, 370 aa]
          Length = 370

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 66/135 (48%), Gaps = 15/135 (11%)

Query: 266 SGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGI--QGSILVFNIGISKPIGKLRGHS 323
           SG AVQ+  F +     + G +   +   +  I  +  QG+++  N  ++K         
Sbjct: 10  SGYAVQYSPFFDNKLAVASGSNFGLVGNGRLFIMDLTAQGTMVESNSFLTK--------- 60

Query: 324 KTLTTIAYNE-HNKLLLSASDDNTLRVWR-GGNLNPSHVFYGHSQSITSAHW--VDDDTI 379
             L  +A+NE H   +L+A  D +LR++       P  +F  H + + S +W  +  DT 
Sbjct: 61  DGLFDVAWNELHENQVLAAQGDGSLRLFDITLQQYPIALFQEHQREVFSCNWNLLHKDTF 120

Query: 380 ISTSMDGSIRVWSLA 394
           +S+S DG+++VW+ A
Sbjct: 121 VSSSWDGTVKVWTPA 135

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 38/178 (21%), Positives = 70/178 (39%), Gaps = 32/178 (17%)

Query: 246 DETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSI 305
           D   V++C  ++   ++++    A     F      E+L  D         A  G+   +
Sbjct: 188 DPNLVMSCSGNSYVSLFDLRQPAASNQQRFIAHSGLEALSCDFNKYRPHVIATGGVDKMV 247

Query: 306 LVFNIGISK-----------PIGKLRGHSKTLTTIAYN-EHNKLLLSASDDNTLRVW--- 350
            V+++ + +            I +++GHS  +  + ++  H+ +LLS S D T R W   
Sbjct: 248 KVWDLRMVRQTLTTSRTAPVSINEMQGHSLAVRKVVWSPHHSNILLSTSYDMTCRAWHDL 307

Query: 351 ----------RGGNLNP----SHVFYGHSQSITSAHWV---DDDTIISTSMDGSIRVW 391
                     R  N +P    S+VF  HS+ +  A W        + +T  DG +  W
Sbjct: 308 ADGPGGQHSGRTNNSDPQRGCSYVFSKHSEFVFGADWSLWGQPGYVATTGWDGQVCAW 365

>Kwal_27.10573
          Length = 1015

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/92 (20%), Positives = 50/92 (54%), Gaps = 11/92 (11%)

Query: 196 EVTCLEWAPAGQSLLTGVESGELRLWSVEG------KLQNI-----LSYHRAPIVCIKWN 244
           +++C+E  P+   +L G++SG   ++ ++       +++N+        H +P+V I+WN
Sbjct: 125 KISCIETDPSLDWMLIGLQSGATVIYDIDKDCLSPLRIENLQKTYMPKAHLSPVVSIQWN 184

Query: 245 SDETHVLTCDADNMTIVWNVLSGTAVQHFSFK 276
             +  V+    + +T+V++++  +  QH  ++
Sbjct: 185 PRDYGVILISYNLLTVVYSLVENSVKQHLVYE 216

>CAGL0G03399g complement(325879..326988) highly similar to sp|P40066
           Saccharomyces cerevisiae YER107c GLE2, start by
           similarity
          Length = 369

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 67/154 (43%), Gaps = 18/154 (11%)

Query: 157 FAYGERDSRAAVVTYSVADGLWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVES- 215
            ++ +R+S A   T +V     ++   +V+   N    + ++ + ++P     L  V S 
Sbjct: 1   MSFFQRNSAAGNTTSTVMATEKDLQNEIVI---NNPADDSISDIAFSPQ-HDFLFSVSSW 56

Query: 216 -GELRLWSVE-GKLQNILSY-HRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGT---- 268
            G++R+W  + G  Q    Y H  P++C +W+ D   + +   DN   +++V SG     
Sbjct: 57  DGKVRIWDAQNGVPQGKAQYEHNGPVLCTRWSLDGARIASGGCDNTVKLYDVASGQSQQI 116

Query: 269 -----AVQHFSFKEAG-TEESLGVDATWIDQDKF 296
                AV+   F + G T     V  +W    KF
Sbjct: 117 GSHNDAVKSLRFVQCGPTNTECLVTGSWDKTIKF 150

>Kwal_26.7570
          Length = 218

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 3/80 (3%)

Query: 315 PIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWV 374
           P+   RGHS  +         +  LSAS D T+R+W          F GH   + S   +
Sbjct: 57  PVRSFRGHSHIVQDCTVTPDGEYALSASWDKTVRLWELATGKCIQRFVGHKSDVLSVT-I 115

Query: 375 DDDT--IISTSMDGSIRVWS 392
           D     I+S S D +++VW+
Sbjct: 116 DRRASQIVSASRDKTVKVWN 135

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 44/97 (45%), Gaps = 10/97 (10%)

Query: 304 SILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHV-FY 362
           ++ ++ +   K I +  GH   + ++  +     ++SAS D T++VW    L    V   
Sbjct: 88  TVRLWELATGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVW--NTLGECMVTLL 145

Query: 363 GHSQSITSAHWVDDD-------TIISTSMDGSIRVWS 392
           GH+  ++      ++       T+IS  MD  ++V S
Sbjct: 146 GHNDWVSQVRVAPNESPEDETVTVISAGMDKVVKVCS 182

>ADR108C [1849] [Homologous to NOHBY] (899200..900099) [900 bp, 299
           aa]
          Length = 299

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 48/117 (41%), Gaps = 8/117 (6%)

Query: 234 HRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQ 293
           H  P++      D   V+TC  D    VW+ L G A       E G   S      W+  
Sbjct: 11  HEGPVLACDSAPDGRTVVTCGLDQRIGVWD-LDGEAPY---ILETGDVASC---VRWLGG 63

Query: 294 DKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW 350
            K AI    G + ++++   + + KL  H++ +  +A  + N   +S  DD  L  W
Sbjct: 64  QKLAIGCADGHVCIYDLTTGERLRKLAHHTRVVNQLAGGQ-NGNFVSVGDDGRLNWW 119

>Sklu_1880.3 YDR364C, Contig c1880 4293-5708
          Length = 471

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 67/319 (21%), Positives = 122/319 (38%), Gaps = 54/319 (16%)

Query: 192 GQQNEVTCLEWAP-AGQSLLTGVESGELRLWSVEGKLQNILSY--HRAPIVCIKWNSDET 248
           G  N  T L++ P  G   L+G     + +W +  +   +  Y  HR  +  I +NSD T
Sbjct: 176 GHVNGTTKLKFLPETGHLFLSGGNDNVINIWDMYHERTLLRDYRGHRKAVRDINFNSDGT 235

Query: 249 HVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATW--IDQDKFAIPGIQGSIL 306
             L+   D    VW+  +G       +       S+   AT+   + +++ +      I 
Sbjct: 236 EFLSVSFDQTLKVWDTETGKVKSRLKW------HSVPNCATYHPTNNNEYIVGLSNSEIR 289

Query: 307 VFNIGISKPIGKLRGHSKTLTTI---AYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYG 363
            ++  +S   G ++ ++  L++I    Y       +S+S+D T+R+W      P      
Sbjct: 290 HYDSRVSNKEGLIQTYNHHLSSIISLKYFPDGSKFISSSEDKTVRIWENQVNIPIKQISD 349

Query: 364 HSQSITSAHWVDDDT--IISTSMDGSIRVWSLASNSTVASATVDGVPNFTGAL------- 414
            SQ       +  +     + SMD +I  +S+          V     F G L       
Sbjct: 350 TSQYSMPYLEIHPEQHYFSAQSMDNAIYSFSMKPKYKKNLKKV-----FRGHLCAGFGIN 404

Query: 415 ---SPDQGKFATGTLDGEVMVYDIQKLLQQLNHNGYHGTARSAEVARIPVVGDHRSAREG 471
              SPD     +G   G V+V+D +             T R+ +   +P         +G
Sbjct: 405 FGFSPDGQYIVSGDSRGSVVVWDWK-------------TTRTLKRFEVP---------DG 442

Query: 472 NYVTQISW-SQESTQLSVS 489
             VT ++W  QE++++  S
Sbjct: 443 KPVTTLAWHPQETSKMLCS 461

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 59/140 (42%), Gaps = 8/140 (5%)

Query: 314 KPIGKLRGHSKTLTTIAY-NEHNKLLLSASDDNTLRVWRGGNLNPS-HVFYGHSQSITSA 371
           K I   +GH    T + +  E   L LS  +DN + +W   +       + GH +++   
Sbjct: 169 KIIYTFKGHVNGTTKLKFLPETGHLFLSGGNDNVINIWDMYHERTLLRDYRGHRKAVRDI 228

Query: 372 HWVDDDT-IISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEV 430
           ++  D T  +S S D +++VW   +    +      VPN       +  ++  G  + E+
Sbjct: 229 NFNSDGTEFLSVSFDQTLKVWDTETGKVKSRLKWHSVPNCATYHPTNNNEYIVGLSNSEI 288

Query: 431 MVYD-----IQKLLQQLNHN 445
             YD      + L+Q  NH+
Sbjct: 289 RHYDSRVSNKEGLIQTYNHH 308

>KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1
           Kluyveromyces lactis heterotrimeric G protein beta
           subunit, start by similarity
          Length = 436

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 48/220 (21%), Positives = 81/220 (36%), Gaps = 62/220 (28%)

Query: 231 LSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATW 290
           L  H   I  +KW+ D   VL+   D   I+W+  +G                       
Sbjct: 82  LKGHNNKISDVKWSQDSASVLSSSQDGFIIIWDPFTGLK--------------------- 120

Query: 291 IDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW 350
               K AIP +                     S+ + + A +    L+ SA  DN   V+
Sbjct: 121 ----KSAIPLL---------------------SQWVLSSAISPSGNLVASAGLDNHCSVY 155

Query: 351 RGGNLNPSH-----VFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVAS---- 401
           R    N        +F GH+  I++  ++D+ TI++ S D +  +W +  +  V      
Sbjct: 156 RVSRDNRIQQNVISIFKGHTCYISATEFLDERTILTASGDMTCAMWDIPKSKRVTEFIDH 215

Query: 402 ----ATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQK 437
                T+D  P  TG    +   F TG  DG   ++D+++
Sbjct: 216 LGDVLTMDLPPANTGRYGHN---FITGGSDGYAYLWDVRQ 252

 Score = 37.0 bits (84), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 38/85 (44%), Gaps = 1/85 (1%)

Query: 354 NLNPSHVFYGHSQSITSAHWVDDD-TIISTSMDGSIRVWSLASNSTVASATVDGVPNFTG 412
           NL P     GH+  I+   W  D  +++S+S DG I +W   +    ++  +      + 
Sbjct: 75  NLQPVRTLKGHNNKISDVKWSQDSASVLSSSQDGFIIIWDPFTGLKKSAIPLLSQWVLSS 134

Query: 413 ALSPDQGKFATGTLDGEVMVYDIQK 437
           A+SP     A+  LD    VY + +
Sbjct: 135 AISPSGNLVASAGLDNHCSVYRVSR 159

 Score = 28.9 bits (63), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 41/82 (50%), Gaps = 3/82 (3%)

Query: 271 QHFSFKEAGTEES--LGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTT 328
           Q  +FKE+  E+   + +D +   +  +A     G   V++I   + IGK+ GH   +  
Sbjct: 351 QSLNFKESCIEDQGVISIDFSSSGRLMYACYADYG-CAVWDIIKGEMIGKVDGHRNRINA 409

Query: 329 IAYNEHNKLLLSASDDNTLRVW 350
           +  +     ++S+S D TL+VW
Sbjct: 410 VKTSPDGMAVVSSSWDMTLKVW 431

>YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein
           required for the second catalytic step of mRNA splicing,
           member of WD (WD-40) repeat family [1368 bp, 455 aa]
          Length = 455

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/165 (18%), Positives = 68/165 (41%), Gaps = 10/165 (6%)

Query: 192 GQQNEVTCLEWAP-AGQSLLTGVESGELRLWSVEGKLQNILSY--HRAPIVCIKWNSDET 248
           G     T L++ P  G  +L+G     +++W      + +  +  H  PI  +++  D  
Sbjct: 160 GHPEGTTALKFLPKTGHLILSGGNDHTIKIWDFYHDYECLRDFQGHNKPIKALRFTEDCQ 219

Query: 249 HVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVF 308
             L+   D    +W+  +G             +    V++   +  +F +      IL +
Sbjct: 220 SFLSSSFDRSVKIWDTETGKVKTRLHLNSTPAD----VESRPTNPHEFIVGLSNSKILHY 275

Query: 309 NIGISKPIGKLRGHSKTLTTI---AYNEHNKLLLSASDDNTLRVW 350
           +  +S+  G ++ +   L++I    Y       +S+S+D T+R+W
Sbjct: 276 DDRVSENQGLVQTYDHHLSSILALKYFPDGSKFISSSEDKTVRIW 320

>YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein
           essential for replication of M double-stranded RNA
           (dsRNA) virus, member of the WD (WD-40) repeat family
           [1407 bp, 468 aa]
          Length = 468

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 51/107 (47%), Gaps = 16/107 (14%)

Query: 305 ILVFNIGISKPIGKLRGHSKTLTTIAYN---------------EHNKLLLSASDDNTLRV 349
           I ++++   K +G L  H  ++T + ++               +++K LLSAS+D+ + V
Sbjct: 128 IRIYDLQKRKELGTLLSHQGSITALQFSHPASSSEDAAVSKGSKNSKWLLSASEDHKIMV 187

Query: 350 WRGGNLNPSHVFYGHSQSITSAHWVDDDTI-ISTSMDGSIRVWSLAS 395
           WR  +        GH+  +        + I IS S D SIR+W+L +
Sbjct: 188 WRVKDWETVGTLKGHTARVNDVDIHPTNRIAISVSDDHSIRLWNLMT 234

>YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Protein
           containing seven WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to WD40 protein Ciao1 (human CIAO1), which
           binds and inhibits Wilms tumor suppressor protein (human
           WT1) transactivation activity [993 bp, 330 aa]
          Length = 330

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 50/253 (19%), Positives = 92/253 (36%), Gaps = 65/253 (25%)

Query: 154 EGVFAYGERDSRAAVVTYSVADGLWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGV 213
           +G+ A G  D +  +V+    D       T++     T  +  +  + W P    L  G 
Sbjct: 24  QGILATGSTDRKIKLVSVKYDDF------TLIDVLDETAHKKAIRSVAWRPHTSLLAAGS 77

Query: 214 ESGELRLW--------SVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVL 265
               + +W        + E  L  I+  H   +  + W++D  ++ TC  D    +W   
Sbjct: 78  FDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWET- 136

Query: 266 SGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKT 325
                      E+G E                                + I  L+ HS+ 
Sbjct: 137 ----------DESGEE-------------------------------YECISVLQEHSQD 155

Query: 326 LTTIAYNEHNKLLLSASDDNTLRVWR--GGNLNPSHVFYGHSQSITSAHWVDDDT----- 378
           +  + ++    LL S+S D+T+R+W+    +     V  GH  ++ S+ +  D T     
Sbjct: 156 VKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDF--DKTEGVFR 213

Query: 379 IISTSMDGSIRVW 391
           + S S D ++RVW
Sbjct: 214 LCSGSDDSTVRVW 226

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/124 (20%), Positives = 52/124 (41%), Gaps = 9/124 (7%)

Query: 319 LRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWR----GGNLNPSHVFYGHSQSITSAHWV 374
           + GH   +  +A++     L + S D ++ +W     G       V   HSQ +    W 
Sbjct: 103 IEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWH 162

Query: 375 DDDTII-STSMDGSIRVWSLASNSTVASATVDGVPN--FTGALSPDQGKF--ATGTLDGE 429
             + ++ S+S D ++R+W    +     A ++G     ++      +G F   +G+ D  
Sbjct: 163 PSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDST 222

Query: 430 VMVY 433
           V V+
Sbjct: 223 VRVW 226

>Scas_700.27*
          Length = 433

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/133 (21%), Positives = 58/133 (43%), Gaps = 8/133 (6%)

Query: 177 LWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWS-VEGKLQNILSYHR 235
           LW+I   V +     G +N +  +   P    +++      +RLW  V GK   ++++H+
Sbjct: 232 LWDIRARVAVMTL-IGHKNPINKVHCLPVDPQIVSCSTDATIRLWDIVAGKSMKVITHHK 290

Query: 236 APIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDK 295
             +  I ++  E  + +C A+++   W +  G  + +F+    G   +L      I+QD 
Sbjct: 291 KSVRNIAFHPTEFSMSSCSANDIR-SWKLPEGGLLTNFNSDGLGIINTLS-----INQDD 344

Query: 296 FAIPGIQGSILVF 308
               G    +L F
Sbjct: 345 VLFAGSDNGMLSF 357

 Score = 33.1 bits (74), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 31/68 (45%), Gaps = 1/68 (1%)

Query: 337 LLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVD-DDTIISTSMDGSIRVWSLAS 395
           L+ +A  D+ +R+W            GH   I   H +  D  I+S S D +IR+W + +
Sbjct: 220 LIATAGRDSVVRLWDIRARVAVMTLIGHKNPINKVHCLPVDPQIVSCSTDATIRLWDIVA 279

Query: 396 NSTVASAT 403
             ++   T
Sbjct: 280 GKSMKVIT 287

 Score = 29.6 bits (65), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 30/140 (21%), Positives = 58/140 (41%), Gaps = 2/140 (1%)

Query: 296 FAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNL 355
            A  G    + +++I     +  L GH   +  +     +  ++S S D T+R+W     
Sbjct: 221 IATAGRDSVVRLWDIRARVAVMTLIGHKNPINKVHCLPVDPQIVSCSTDATIRLWDIVAG 280

Query: 356 NPSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNF-TGAL 414
               V   H +S+ +  +   +  +S+     IR W L     + +   DG+    T ++
Sbjct: 281 KSMKVITHHKKSVRNIAFHPTEFSMSSCSANDIRSWKLPEGGLLTNFNSDGLGIINTLSI 340

Query: 415 SPDQGKFATGTLDGEVMVYD 434
           + D   FA G+ +G +  YD
Sbjct: 341 NQDDVLFA-GSDNGMLSFYD 359

>Scas_719.52
          Length = 628

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 30/140 (21%), Positives = 65/140 (46%), Gaps = 24/140 (17%)

Query: 319 LRGHSKTLTTIAYNEHNK-LLLSASDDNTLRVWR----------------GGNLNPSHVF 361
            RGH+  +    ++  N  ++ S+SDD+ + +W+                  N+ P    
Sbjct: 77  FRGHTAQVLDTDFDPFNDHIIASSSDDSKIGIWKIPEDYSFQHYLDPDGEPKNIKPVKFL 136

Query: 362 YGHSQSITSA--HWVDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQG 419
            GHS+ +     H V ++ + S+S+D ++++W++ +   V +      P+   ++S   G
Sbjct: 137 SGHSRKVGHVLFHPVAENVLASSSLDYTVKLWNIETGEAVITLK---HPDMVTSMSFSYG 193

Query: 420 --KFATGTLDGEVMVYDIQK 437
               AT   D ++ V+DI++
Sbjct: 194 GNHLATVCRDKKLRVWDIRE 213

>CAGL0F07337g complement(714870..716735) similar to sp|P26309
           Saccharomyces cerevisiae YGL116w CDC20 cell division
           control protein, hypothetical start
          Length = 621

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 54/112 (48%), Gaps = 4/112 (3%)

Query: 326 LTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDTIIST-SM 384
           L  I +++ N L ++ +D  +L +W G N   + +       ITS HW DDD  IS    
Sbjct: 256 LNLIDWSKKNILAIALND--SLYLWNGNNGEATLLKEYEECQITSVHWSDDDCHISIGKS 313

Query: 385 DGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQ 436
           DG+  +W + + ST+       +    G+ S  +   ATG   GE+ + D++
Sbjct: 314 DGNTEIWDVET-STLVRTMRSKLNVRIGSQSWLETLLATGFRSGEIQINDVR 364

 Score = 37.7 bits (86), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 38/182 (20%), Positives = 76/182 (41%), Gaps = 15/182 (8%)

Query: 197 VTCLEWAPAGQSLLTGVESGELRLWS-VEGKLQNILSYHRAPIVCIKWNSDETHVLTCDA 255
           +  ++W+   +++L    +  L LW+   G+   +  Y    I  + W+ D+ H+    +
Sbjct: 256 LNLIDWS--KKNILAIALNDSLYLWNGNNGEATLLKEYEECQITSVHWSDDDCHISIGKS 313

Query: 256 DNMTIVWNVLSGTAVQHFSFK---EAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGI 312
           D  T +W+V + T V+    K     G++       +W++    A     G I + ++ I
Sbjct: 314 DGNTEIWDVETSTLVRTMRSKLNVRIGSQ-------SWLET-LLATGFRSGEIQINDVRI 365

Query: 313 SKPI-GKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSA 371
              I      H+  +  ++Y      L S  +DNT+ +W      P  V   HS ++ + 
Sbjct: 366 KDHIVNTWDEHTGEVCGLSYKADGLQLASGGNDNTMMIWDTRTSMPQFVKKDHSAAVKAL 425

Query: 372 HW 373
            W
Sbjct: 426 AW 427

>Kwal_27.12667
          Length = 721

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 38/173 (21%), Positives = 68/173 (39%), Gaps = 42/173 (24%)

Query: 304 SILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW------------- 350
           S+ ++N+     IG L GH  +++ +   E +  L++   D  L++W             
Sbjct: 428 SVKIWNLSKKTQIGALPGHLASVSCMQM-EDSHSLITGGRDALLKLWDIEKAEELYNDGA 486

Query: 351 -RGGNLNPSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVDGV-- 407
             G      H F  H   IT+ H+ + ++++S S D +IR W L +   + +  ++    
Sbjct: 487 TEGEEELCVHTFDAHVDEITALHF-EGNSLVSGSQDRTIRQWDLTTGKCLQTIDINFANR 545

Query: 408 ------------------------PNFTGALSPDQGKFATGTLDGEVMVYDIQ 436
                                   P   GAL       ATGT DG V ++D++
Sbjct: 546 GTSGGFSKISSNNPRSSILLTHNDPPVIGALQCYDAAMATGTKDGLVRLWDLR 598

 Score = 36.6 bits (83), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 59/257 (22%), Positives = 106/257 (41%), Gaps = 57/257 (22%)

Query: 177 LWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEG--KLQNILSYH 234
           +WN+S+   +  A  G    V+C++   +  SL+TG     L+LW +E   +L N  +  
Sbjct: 431 IWNLSKKTQIG-ALPGHLASVSCMQMEDS-HSLITGGRDALLKLWDIEKAEELYNDGATE 488

Query: 235 RAPIVCIKWNSDETHV------------LTCDADNMTIV-WNVLSGTAVQHFSFKEAGTE 281
               +C+  ++ + HV            L   + + TI  W++ +G  +Q      A   
Sbjct: 489 GEEELCV--HTFDAHVDEITALHFEGNSLVSGSQDRTIRQWDLTTGKCLQTIDINFANRG 546

Query: 282 ESLGVDATWIDQDKFAIPGIQGSILVFNIGISKP--IGKLRGHSKTLTTIAYNEHNKLLL 339
            S G         K +    + SIL+ +   + P  IG L+ +   + T           
Sbjct: 547 TSGGFS-------KISSNNPRSSILLTH---NDPPVIGALQCYDAAMAT----------- 585

Query: 340 SASDDNTLRVW--RGGNLNPSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSL---- 393
             + D  +R+W  R G +       GH+ ++T   + D   +++ S+D SIR+W L    
Sbjct: 586 -GTKDGLVRLWDLRSGQV--IRTLEGHTDAVTGLQF-DSVNLVTGSLDRSIRIWDLRTGL 641

Query: 394 -----ASNSTVASATVD 405
                A NS ++S   D
Sbjct: 642 LADAFAYNSPISSLQFD 658

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 51/244 (20%), Positives = 93/244 (38%), Gaps = 12/244 (4%)

Query: 195 NEVTCLEW-APAGQSLLTGVESGELRLWSVEGKLQ-NILSYHRAPIVCIKWNSDETHVLT 252
           + +TCL++  P G     G     +++W++  K Q   L  H A + C++   D   ++T
Sbjct: 405 DSITCLDFDLPFGTMCTAGKLDHSVKIWNLSKKTQIGALPGHLASVSCMQM-EDSHSLIT 463

Query: 253 CDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGI 312
              D +  +W++     + +    E   EE L V       D+      +G+ LV     
Sbjct: 464 GGRDALLKLWDIEKAEELYNDGATEG--EEELCVHTFDAHVDEITALHFEGNSLVSGSQD 521

Query: 313 SKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAH 372
                      K L TI  N  N+                 N   S +   +   +  A 
Sbjct: 522 RTIRQWDLTTGKCLQTIDINFANR-----GTSGGFSKISSNNPRSSILLTHNDPPVIGAL 576

Query: 373 WVDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMV 432
              D  + + + DG +R+W L S   +   T++G  +    L  D     TG+LD  + +
Sbjct: 577 QCYDAAMATGTKDGLVRLWDLRSGQVIR--TLEGHTDAVTGLQFDSVNLVTGSLDRSIRI 634

Query: 433 YDIQ 436
           +D++
Sbjct: 635 WDLR 638

>Scas_717.68
          Length = 908

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 56/115 (48%), Gaps = 14/115 (12%)

Query: 335 NKLLLSASDDNTLRVW---RGGNLNPSHVFYGHSQSITSA--HWVDDDTIISTSMDGSIR 389
           N  L+++S D T+++W   R  +L      + H   +T    H  DD   IS  +D  +R
Sbjct: 339 NNFLITSSMDRTVKLWHLERQTSLKT----FQHQDFVTCVRFHPTDDRFFISGCLDHKVR 394

Query: 390 VWSLASNS-TVASATVDGVPNFTGALSPDQGKFA-TGTLDGEVMVYDIQKLLQQL 442
           +WS+  N  T      D + + T  LSP  GK+   GT +G V V  + K L+Q+
Sbjct: 395 LWSILENEITFEFDCQDLITSLT--LSPGDGKYTIVGTFNGYVHVL-LTKGLEQV 446

 Score = 33.5 bits (75), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 39/83 (46%), Gaps = 2/83 (2%)

Query: 355 LNPS--HVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTG 412
            NPS   +F  H+  +    W  ++ +I++SMD ++++W L   +++ +           
Sbjct: 316 FNPSCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVR 375

Query: 413 ALSPDQGKFATGTLDGEVMVYDI 435
               D   F +G LD +V ++ I
Sbjct: 376 FHPTDDRFFISGCLDHKVRLWSI 398

>Scas_510.5
          Length = 362

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 56/106 (52%), Gaps = 8/106 (7%)

Query: 170 TYSVADGLWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVES--GELRLWSVEGKL 227
           T S A    +++  +VL   N   ++ ++ + ++P  Q  +  V S  G++R+W V+G +
Sbjct: 13  TSSTAATEADLANDIVL---NNPAEDSISDIAFSPQ-QDFIFSVSSWDGKVRIWDVQGGV 68

Query: 228 QNILSY--HRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQ 271
               S   H  P++  +W++D + V +   DN+  +++V SG + Q
Sbjct: 69  AQGRSQYEHAGPVLSTRWSNDGSKVASGGCDNIVKLFDVASGQSQQ 114

>Scas_657.13
          Length = 411

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 72/181 (39%), Gaps = 22/181 (12%)

Query: 288 ATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKL---------- 337
           A ++ Q+   +  I GS  VF    SK       HS  ++T  Y++ N            
Sbjct: 132 ARYMPQNSNLVATINGSGKVFLYDRSK-----DKHSGLVSTFEYHKENGYGLSFNCNDAG 186

Query: 338 -LLSASDDNTLRVWRGGNLNPSHVFY---GHSQSITSAHWVDDDTII--STSMDGSIRVW 391
            LLS SDD T+ +W   N N S ++     HS  +    W + D  +  S S D ++++ 
Sbjct: 187 KLLSGSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLH 246

Query: 392 SLASNSTVASATVDGVPNFTGALSP-DQGKFATGTLDGEVMVYDIQKLLQQLNHNGYHGT 450
                 T  S      P  T A S   Q  FA    D  V ++D + + + L+    H  
Sbjct: 247 DQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDG 306

Query: 451 A 451
           A
Sbjct: 307 A 307

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 71/155 (45%), Gaps = 22/155 (14%)

Query: 209 LLTGVESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVLT-CDADN--MTIVWNVL 265
           LL+G + G + LW       N+ + + +PI    W+S  + ++  C   N  + +  +V 
Sbjct: 188 LLSGSDDGTIALW-------NVNNSNSSPIYV--WSSVHSDIVNDCKWSNFDLNVFGSVS 238

Query: 266 SGTAVQHFSFKEAGTEES-LGVDATWI-------DQDKFAIPGIQGSILVFNI-GISKPI 316
             + +Q    +E  T  S   VDA +         Q  FA  G    + +F+   IS+P+
Sbjct: 239 EDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPL 298

Query: 317 GKLRGHSKTLTTIAYN-EHNKLLLSASDDNTLRVW 350
             + GH   +T + ++ + + +L+++ +D    +W
Sbjct: 299 HSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIW 333

>Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement
          Length = 426

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 37/85 (43%), Gaps = 1/85 (1%)

Query: 354 NLNPSHVFYGHSQSITSAHWV-DDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTG 412
           NL  S    GH+  I+   W  D  +I+S S DG + +W   S     +  +D       
Sbjct: 77  NLKSSMTLKGHNNKISDFRWSRDSKSILSASQDGFMLIWDPMSGLKKNAIPLDSQWVLAC 136

Query: 413 ALSPDQGKFATGTLDGEVMVYDIQK 437
           A+SP +   A+G L     +Y I +
Sbjct: 137 AISPSRNLVASGGLSNNCTIYRISQ 161

 Score = 37.7 bits (86), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 43/224 (19%), Positives = 91/224 (40%), Gaps = 30/224 (13%)

Query: 231 LSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATW 290
           L  H   I   +W+ D   +L+   D   ++W+ +SG             + ++ +D+ W
Sbjct: 84  LKGHNNKISDFRWSRDSKSILSASQDGFMLIWDPMSGLK-----------KNAIPLDSQW 132

Query: 291 I-------DQDKFAIPGIQGSILVFNIG-----ISKPIGKLRGHSKTLTTIAYNEHNKLL 338
           +        ++  A  G+  +  ++ I        K +   +GH+  ++ + +  +N+ +
Sbjct: 133 VLACAISPSRNLVASGGLSNNCTIYRISQENRTQQKIVSIFKGHTCYVSDLEF-INNESI 191

Query: 339 LSASDDNTLRVWRGGNLNPSHVFYGH-----SQSITSAHWVDDDTIIST-SMDGSIRVWS 392
           L+AS D T  +W          +  H     + S+  A     D++ ++   DG + +W 
Sbjct: 192 LTASGDMTCALWDIPKSKRVSEYSDHLGDVLTLSVPPAGTTSYDSMFASGGSDGYVYLWD 251

Query: 393 LASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQ 436
             S S+V +  V      T     D     TG+ DG   ++D++
Sbjct: 252 TRSPSSVQNFFVSDSDISTVRFFSDGNSIITGSDDGIARLFDLR 295

 Score = 29.3 bits (64), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 34/220 (15%), Positives = 87/220 (39%), Gaps = 7/220 (3%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWS-VEGKLQNILSYHRAPIVCIKWNSDETHV 250
           G  N+++   W+   +S+L+  + G + +W  + G  +N +      ++    +     V
Sbjct: 86  GHNNKISDFRWSRDSKSILSASQDGFMLIWDPMSGLKKNAIPLDSQWVLACAISPSRNLV 145

Query: 251 LTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNI 310
            +    N   ++ +      Q               D  +I+ +         +  +++I
Sbjct: 146 ASGGLSNNCTIYRISQENRTQQKIVSIFKGHTCYVSDLEFINNESILTASGDMTCALWDI 205

Query: 311 GISKPIGKLRGHSKTLTTIAY-----NEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHS 365
             SK + +   H   + T++        ++ +  S   D  + +W   + +    F+   
Sbjct: 206 PKSKRVSEYSDHLGDVLTLSVPPAGTTSYDSMFASGGSDGYVYLWDTRSPSSVQNFFVSD 265

Query: 366 QSITSAHWVDD-DTIISTSMDGSIRVWSLASNSTVASATV 404
             I++  +  D ++II+ S DG  R++ L S+  ++S ++
Sbjct: 266 SDISTVRFFSDGNSIITGSDDGIARLFDLRSDCELSSYSL 305

>KLLA0D00814g complement(76687..77913) similar to sp|P39984
           Saccharomyces cerevisiae YEL056w HAT2 subunit of the
           major yeast histone acetyltransferase, start by
           similarity
          Length = 408

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 34/158 (21%), Positives = 70/158 (44%), Gaps = 12/158 (7%)

Query: 205 AGQSLLTGVESGELRLWSVEGKLQN----ILSYHRAPIVCIKWNSDETHVL-TCDADNMT 259
           +GQ LL+  + G + LW V              H   +   KW+  ++ +  T   DN  
Sbjct: 182 SGQ-LLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTL 240

Query: 260 IVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIG-ISKPIGK 318
           I+ +  S  A+Q  S   A    +    +    ++  A  G   ++ ++++  + KP+  
Sbjct: 241 IIHDTNSDRAIQKLSVSSAFNTLAFSKRS----ENLLAAAGTDSNVYLYDLRRLQKPLHS 296

Query: 319 LRGHSKTLTTIAYNEH-NKLLLSASDDNTLRVWRGGNL 355
           + GH  ++T++ ++ H + LL S+  D  + +W   N+
Sbjct: 297 MAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNI 334

>KLLA0F21406g complement(1996260..1998377) similar to sp|P47025
           Saccharomyces cerevisiae YJL112w MDV1, start by
           similarity
          Length = 705

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 69/169 (40%), Gaps = 40/169 (23%)

Query: 304 SILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW------------- 350
           S+ V+++   K I  L GH  +++ +  ++++  L++   D  L++W             
Sbjct: 421 SVKVWDLSKKKQIATLHGHLASISCMQIDQYS-TLITGGRDAVLKLWDIDKAMADEASNS 479

Query: 351 RGGNLNPSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVD----- 405
              N    + F  H   IT+  + D D ++S S D ++R W L  NS   + T+D     
Sbjct: 480 SEDNDACLYTFDSHVDEITAISF-DGDNLVSGSQDRTVRQWDL--NSGKCTQTIDISFAT 536

Query: 406 ------------------GVPNFTGALSPDQGKFATGTLDGEVMVYDIQ 436
                               P   GAL       ATGT DG V ++D++
Sbjct: 537 GPMRSQRNIPLRNSVLLTKEPPAIGALQCFDAALATGTKDGIVRLWDLR 585

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 103/229 (44%), Gaps = 40/229 (17%)

Query: 177 LWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNILSY--- 233
           +W++S+   +A  + G    ++C++      +L+TG     L+LW ++  + +  S    
Sbjct: 424 VWDLSKKKQIATLH-GHLASISCMQIDQYS-TLITGGRDAVLKLWDIDKAMADEASNSSE 481

Query: 234 -HRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGT---AVQHFSFKEAGTEESLGVD-A 288
            + A +     + DE   ++ D DN+      +SG+    V+ +        +++ +  A
Sbjct: 482 DNDACLYTFDSHVDEITAISFDGDNL------VSGSQDRTVRQWDLNSGKCTQTIDISFA 535

Query: 289 TWIDQDKFAIPGIQGSILVFNIGISKP--IGKLRGHSKTLTTIAYNEHNKLLLSASDDNT 346
           T   + +  IP ++ S+L+      +P  IG L+     L T             + D  
Sbjct: 536 TGPMRSQRNIP-LRNSVLL----TKEPPAIGALQCFDAALAT------------GTKDGI 578

Query: 347 LRVW--RGGNLNPSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSL 393
           +R+W  R G +    +  GH+ +ITS  + D   +++ +MD SIR+W L
Sbjct: 579 VRLWDLRSGKV--VRMLEGHTDAITSLQF-DSVNLVTGAMDRSIRIWDL 624

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 52/266 (19%), Positives = 102/266 (38%), Gaps = 64/266 (24%)

Query: 196 EVTCLEW-APAGQSLLTGVESGELRLWSVEGKLQ-NILSYHRAPIVCIKWNSDETHVLTC 253
           ++TCL++  P G     G     +++W +  K Q   L  H A I C++ +   T ++T 
Sbjct: 399 DITCLDFDMPFGTMCSAGSLDHSVKVWDLSKKKQIATLHGHLASISCMQIDQYST-LITG 457

Query: 254 DADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGIS 313
             D +  +W++                ++++  +A+   +D  A       +  F+    
Sbjct: 458 GRDAVLKLWDI----------------DKAMADEASNSSEDNDAC------LYTFD---- 491

Query: 314 KPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW----------------------- 350
                   H   +T I+++  N  L+S S D T+R W                       
Sbjct: 492 -------SHVDEITAISFDGDN--LVSGSQDRTVRQWDLNSGKCTQTIDISFATGPMRSQ 542

Query: 351 RGGNLNPSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNF 410
           R   L  S +      +I +    D   + + + DG +R+W L S   V    ++G  + 
Sbjct: 543 RNIPLRNSVLLTKEPPAIGALQCFDA-ALATGTKDGIVRLWDLRSGKVV--RMLEGHTDA 599

Query: 411 TGALSPDQGKFATGTLDGEVMVYDIQ 436
             +L  D     TG +D  + ++D++
Sbjct: 600 ITSLQFDSVNLVTGAMDRSIRIWDLR 625

 Score = 29.6 bits (65), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 63/148 (42%), Gaps = 14/148 (9%)

Query: 320 RGHSKTLTTIAYNEHNKLLLSA-SDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDT 378
           + H + +T + ++     + SA S D++++VW           +GH  SI+        T
Sbjct: 394 KAHDEDITCLDFDMPFGTMCSAGSLDHSVKVWDLSKKKQIATLHGHLASISCMQIDQYST 453

Query: 379 IISTSMDGSIRVWSL-------ASNST----VASATVDGVPNFTGALSPDQGKFATGTLD 427
           +I+   D  +++W +       ASNS+        T D   +   A+S D     +G+ D
Sbjct: 454 LITGGRDAVLKLWDIDKAMADEASNSSEDNDACLYTFDSHVDEITAISFDGDNLVSGSQD 513

Query: 428 GEVMVYDIQ--KLLQQLNHNGYHGTARS 453
             V  +D+   K  Q ++ +   G  RS
Sbjct: 514 RTVRQWDLNSGKCTQTIDISFATGPMRS 541

>YER107C (GLE2) [1539] chr5 complement(373444..374541) Nuclear pore
           protein required for poly(A)+ RNA export, has WD (WD-40)
           repeats, functions in the nuclear export of the small
           ribosomal subunit [1098 bp, 365 aa]
          Length = 365

 Score = 38.1 bits (87), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/85 (21%), Positives = 45/85 (52%), Gaps = 3/85 (3%)

Query: 190 NTGQQNEVTCLEWAPAGQSLLTGVE-SGELRLWSVEGKLQNILSYHRA--PIVCIKWNSD 246
           N+  ++ ++ + ++P    + +     G++R+W V+  +    + H +  P++C +W++D
Sbjct: 32  NSPAEDSISDIAFSPQQDFMFSASSWDGKVRIWDVQNGVPQGRAQHESSSPVLCTRWSND 91

Query: 247 ETHVLTCDADNMTIVWNVLSGTAVQ 271
            T V +   DN   ++++ SG   Q
Sbjct: 92  GTKVASGGCDNALKLYDIASGQTQQ 116

 Score = 30.0 bits (66), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 14/67 (20%), Positives = 28/67 (41%)

Query: 177 LWNISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNILSYHRA 236
           +W++   V    A     + V C  W+  G  + +G     L+L+ +       +  H A
Sbjct: 63  IWDVQNGVPQGRAQHESSSPVLCTRWSNDGTKVASGGCDNALKLYDIASGQTQQIGMHSA 122

Query: 237 PIVCIKW 243
           PI  +++
Sbjct: 123 PIKVLRF 129

>ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH]
           complement(387122..388393) [1272 bp, 423 aa]
          Length = 423

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 31/147 (21%), Positives = 72/147 (48%), Gaps = 8/147 (5%)

Query: 209 LLTGVESGELRLWSVEG--KLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLS 266
           LL+G +   + LW +E   K ++IL+ H   +  +KW+  E++V    +++ T+    + 
Sbjct: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQ---VH 258

Query: 267 GTAVQHFSFKEAGTEESLG-VDATWIDQDKFAIPGIQGSILVFNI-GISKPIGKLRGHSK 324
              V+    K+  T      +  +   ++  A  G+   I ++++  +S P+  + GH  
Sbjct: 259 DKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQD 318

Query: 325 TLTTIAYNEH-NKLLLSASDDNTLRVW 350
           ++TT+ ++ H + ++ S+  D    +W
Sbjct: 319 SVTTVEFSPHTDGIICSSGSDRRAIIW 345

 Score = 32.3 bits (72), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 46/84 (54%), Gaps = 5/84 (5%)

Query: 314 KPIGKLRGHSKTLTTIAYNEHNKLLLSASD-DNTLRVWRGGNLN-PSHVFYGHSQSITSA 371
           +P+ KL   S    T+++++H++ LL+A+  D+ + ++   +++ P HV  GH  S+T+ 
Sbjct: 265 EPVKKLPTASP-FNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTV 323

Query: 372 HWVD--DDTIISTSMDGSIRVWSL 393
            +    D  I S+  D    +W L
Sbjct: 324 EFSPHTDGIICSSGSDRRAIIWDL 347

>YDR142C (PEX7) [987] chr4 complement(740467..741594) Peroxisomal
           biogenesis protein (peroxin) that serves as import
           receptor for proteins containing peroxisomal targeting
           signal 2 (PTS2), member of WD (WD-40) repeat family
           [1128 bp, 375 aa]
          Length = 375

 Score = 38.1 bits (87), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 43/83 (51%), Gaps = 4/83 (4%)

Query: 325 TLTTIAYNE-HNKLLLSASDDNTLRVWRGGNLN-PSHVFYGHSQSITSAHW--VDDDTII 380
            L  +A+NE H   +L A  D TLR++       P  +F  H + + S +W  V+    +
Sbjct: 62  CLFDLAWNESHENQVLVAQGDGTLRLFDTTFKEFPIAIFKEHEREVFSCNWNLVNRQNFL 121

Query: 381 STSMDGSIRVWSLASNSTVASAT 403
           S+S DGSI++WS     ++ + T
Sbjct: 122 SSSWDGSIKIWSPLRKQSLMTLT 144

>ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH]
           complement(529784..531187) [1404 bp, 467 aa]
          Length = 467

 Score = 38.1 bits (87), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 59/123 (47%), Gaps = 10/123 (8%)

Query: 322 HSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNL-----NPSHVFYGHSQSITSAHWVDD 376
           HS+ + + A   +  L+ SA  DN   ++R         N   +F GH+  I+   ++DD
Sbjct: 168 HSQWVLSCAICPNGNLVASAGLDNNCTIYRVSRKDRIQQNIVSIFKGHTCYISEIEFLDD 227

Query: 377 DTIISTSMDGSIRVWSLASNSTVASAT--VDGVPNFTGALSPDQGK---FATGTLDGEVM 431
           ++I++ S D +  +W +  +  +      +  V + + A +  +G    FA+G  DG + 
Sbjct: 228 NSILTASGDMTCALWDITKSKRINEFADHLGDVLSLSAAPTETEGNGNVFASGGSDGYLY 287

Query: 432 VYD 434
           ++D
Sbjct: 288 IWD 290

 Score = 29.6 bits (65), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 35/220 (15%), Positives = 83/220 (37%), Gaps = 7/220 (3%)

Query: 192 GQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQ-NILSYHRAPIVCIKWNSDETHV 250
           G  N+V+   W+   +++L+  + G + LW     L+ N +  H   ++      +   V
Sbjct: 125 GHNNKVSSFRWSSDSRTILSASQDGFMLLWDAATGLKSNAIPLHSQWVLSCAICPNGNLV 184

Query: 251 LTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNI 310
            +   DN   ++ V     +Q               +  ++D +         +  +++I
Sbjct: 185 ASAGLDNNCTIYRVSRKDRIQQNIVSIFKGHTCYISEIEFLDDNSILTASGDMTCALWDI 244

Query: 311 GISKPIGKLRGHSKTLTTIAYNE-----HNKLLLSASDDNTLRVWRGGNLNPSHVFYGHS 365
             SK I +   H   + +++        +  +  S   D  L +W          F+   
Sbjct: 245 TKSKRINEFADHLGDVLSLSAAPTETEGNGNVFASGGSDGYLYIWDKRVPTSVQSFFVSD 304

Query: 366 QSITSAHWVDD-DTIISTSMDGSIRVWSLASNSTVASATV 404
             ++   +  + +TI + S DG   ++ L S+  +A+ ++
Sbjct: 305 SDVSKVKFFRNGNTIATGSDDGCTNLYDLRSDCRIANYSL 344

>KLLA0A08866g 776960..778231 weakly similar to sp|P53196
           Saccharomyces cerevisiae YGL004c singleton, hypothetical
           start
          Length = 423

 Score = 38.1 bits (87), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 39/80 (48%), Gaps = 1/80 (1%)

Query: 321 GHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDD-DTI 379
            H+  +T   +  +    LS+S D  L++W          F GH++S+     VD     
Sbjct: 156 AHASHITKTQFFPNGHGFLSSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAMVDRGRNF 215

Query: 380 ISTSMDGSIRVWSLASNSTV 399
           +S S DGS+++W  ++++ V
Sbjct: 216 VSASSDGSLKLWECSTSACV 235

>Scas_605.18
          Length = 424

 Score = 38.1 bits (87), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 38/85 (44%), Gaps = 1/85 (1%)

Query: 354 NLNPSHVFYGHSQSITSAHWV-DDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTG 412
           NL  +    GH+  I+   W  D  +I+S S DG + +W  AS     +  +D     + 
Sbjct: 80  NLQSTLTLKGHNNKISDFRWSRDSKSILSASQDGFMLIWDTASGLKRNAIPLDSQWVLSC 139

Query: 413 ALSPDQGKFATGTLDGEVMVYDIQK 437
           ALSP     A+  L+    +Y + K
Sbjct: 140 ALSPSGNLAASAGLNNNCTIYRVSK 164

 Score = 29.6 bits (65), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 31/163 (19%), Positives = 61/163 (37%), Gaps = 41/163 (25%)

Query: 231 LSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATW 290
           L  H   I   +W+ D   +L+   D   ++W+  SG               ++ +D+ W
Sbjct: 87  LKGHNNKISDFRWSRDSKSILSASQDGFMLIWDTASGLK-----------RNAIPLDSQW 135

Query: 291 IDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW 350
                           V +  +S P G L   +          +N  +   S +N ++  
Sbjct: 136 ----------------VLSCALS-PSGNLAASAGL-------NNNCTIYRVSKENRVQ-- 169

Query: 351 RGGNLNPSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSL 393
                N   +F GH+  I+   ++D+  II++S D +  +W +
Sbjct: 170 ----QNVVSIFKGHTCYISDIEFLDNSHIITSSGDMTCALWDI 208

>Scas_571.4
          Length = 601

 Score = 38.1 bits (87), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 33/151 (21%), Positives = 65/151 (43%), Gaps = 25/151 (16%)

Query: 319 LRGHSKTLTTIAYNEHNKL-LLSASDDNTLRVW----------------RGGNLNPSHVF 361
            RGH   +    ++  N   + SASDD  + +W                +  ++ PS + 
Sbjct: 85  FRGHKGQVLDTDFDPFNDFKIASASDDGKIGIWNIPMNYSMRTYRDSENKPMDIRPSKIL 144

Query: 362 YGHSQSITSA--HWVDDDTIISTSMDGSIRVWSLASNSTVASAT-VDGVPNFTGALSPDQ 418
            GH++ +     H    + + S+S+D ++++W++     + +    D V     A  PD 
Sbjct: 145 SGHTRKVGHVLFHPRIRNVLASSSLDFTVKIWNIKKGKVIGTLQHSDMVTAM--AFDPDG 202

Query: 419 GKFATGTLDGEVMVYDI---QKLLQQLNHNG 446
              AT T + ++ ++DI   Q + Q  +H G
Sbjct: 203 AYLATITRNKKLTIWDIASKQIVSQTKSHQG 233

>Kwal_47.17465
          Length = 800

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 31/145 (21%), Positives = 54/145 (37%), Gaps = 26/145 (17%)

Query: 314 KPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVF------------ 361
           +P+  +  H+ ++T + ++     L S SDD  L +W         +F            
Sbjct: 13  RPLASMSRHTGSVTVVRFSPDGNFLASGSDDRILLIWEKDEDQKQPIFGAENDKEHWNVR 72

Query: 362 ---YGHSQSITSAHWVDDDTIIST-SMDGSIRVWSLASNSTVA-----SATVDGVPNFTG 412
                H   I    W  D +I+ T  +D S+ VW+ ++   +       + V GV     
Sbjct: 73  RRLVAHDNDIQDICWAPDSSILVTVGLDRSVIVWNGSTFEKIKRFDVHQSLVKGV----- 127

Query: 413 ALSPDQGKFATGTLDGEVMVYDIQK 437
              P    FAT + D  V ++   K
Sbjct: 128 IFDPANKYFATASDDRTVRIFRYHK 152

 Score = 34.3 bits (77), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 335 NKLLLSASDDNTLRVWRGGNLNPSHVFYG-HSQSITSAHW-VDDDTIISTSMDGSI 388
           + ++ +A  D TL VW  G   P  V Y   S+SIT   W  + D +  TS+DGSI
Sbjct: 288 DSVIATAGQDKTLVVWSTGKARPIFVAYDIASKSITDMVWNPNGDLLFLTSLDGSI 343

 Score = 34.3 bits (77), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 29/52 (55%)

Query: 300 GIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWR 351
           G+  S++V+N    + I +   H   +  + ++  NK   +ASDD T+R++R
Sbjct: 98  GLDRSVIVWNGSTFEKIKRFDVHQSLVKGVIFDPANKYFATASDDRTVRIFR 149

>KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces
           cerevisiae YKL213c DOA1 involved in ubiquitin-dependent
           proteolysis, start by similarity
          Length = 706

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 75/162 (46%), Gaps = 15/162 (9%)

Query: 314 KPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHW 373
           +P+  L GH   + +++ +  +  L+S+S D T +VW  G +       GHS S+  A  
Sbjct: 91  EPVYTLVGHEGNICSLSGDFES--LVSSSWDKTAKVWTNGIVKWE--LKGHSASVWDAKL 146

Query: 374 VDDDTIISTSMDGSIRVWSLASNSTVASAT----VDGVPNFTGALSPDQGKFATGTLDGE 429
           ++D ++++ S D ++++W    N T+A        D V N    +  D   F + + DG 
Sbjct: 147 LNDGSVLTASADTTVKLW---KNGTLAKTFDKLHSDVVRNI--CILDDGKHFVSCSNDGT 201

Query: 430 VMVYDIQK--LLQQLNHNGYHGTARSAEVARIPVVGDHRSAR 469
           + + +++   L + + H  +    +      I   G+ R+ R
Sbjct: 202 LKLSNLEGGILHEFIGHESFVYAVKQLPSGDIVSCGEDRTVR 243

 Score = 37.0 bits (84), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 49/107 (45%), Gaps = 14/107 (13%)

Query: 312 ISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRV--WRGGNLNPSHVFYGHSQSIT 369
           ++K   KL  HS  +  I   +  K  +S S+D TL++    GG L   H F GH   + 
Sbjct: 169 LAKTFDKL--HSDVVRNICILDDGKHFVSCSNDGTLKLSNLEGGIL---HEFIGHESFVY 223

Query: 370 SAHWVDDDTIISTSMDGSIRVWSLASN-------STVASATVDGVPN 409
           +   +    I+S   D ++R+W++            ++  TVD +PN
Sbjct: 224 AVKQLPSGDIVSCGEDRTVRIWNMDGTIKQVITLPAISIWTVDVLPN 270

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 35/77 (45%)

Query: 363 GHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFA 422
           GH+Q + S   +    + S S DG++R+W+L ++     +       F  +L+ D  +  
Sbjct: 10  GHTQDVRSVVSLSTTQVASASRDGTVRIWNLDADGNWEGSIAFSSEKFVNSLTYDAKQCV 69

Query: 423 TGTLDGEVMVYDIQKLL 439
                 E ++Y +  LL
Sbjct: 70  LFCGGQEKIIYGVSPLL 86

>KLLA0E20779g complement(1841092..1842207) similar to sp|P40066
           Saccharomyces cerevisiae YER107c GLE2 required for
           nuclear pore complex structure and function, start by
           similarity
          Length = 371

 Score = 37.7 bits (86), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 53/97 (54%), Gaps = 8/97 (8%)

Query: 179 NISETVVLADANTGQQNEVTCLEWAPAGQSLLTGVES--GELRLWSVE-GKLQNILSY-H 234
           +++  +VL   N   ++ ++ + ++P    + + V S   ++R+W V+ G  Q    Y H
Sbjct: 23  DLANDIVL---NNAAEDSISDIAFSPQSDFMFS-VSSWDSKVRIWDVQSGSPQGRAQYDH 78

Query: 235 RAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQ 271
           +AP++  +W+ D T V +   DN+  V++V +G A Q
Sbjct: 79  QAPVLTTRWSIDGTKVASGGCDNVLKVFDVTTGQAQQ 115

 Score = 30.4 bits (67), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 1/55 (1%)

Query: 382 TSMDGSIRVWSLASNSTVASATVD-GVPNFTGALSPDQGKFATGTLDGEVMVYDI 435
           +S D  +R+W + S S    A  D   P  T   S D  K A+G  D  + V+D+
Sbjct: 54  SSWDSKVRIWDVQSGSPQGRAQYDHQAPVLTTRWSIDGTKVASGGCDNVLKVFDV 108

>Scas_719.30
          Length = 940

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 51/109 (46%), Gaps = 2/109 (1%)

Query: 300 GIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSH 359
           G+ G +  ++   S  +GKL+  +  +T + Y+  + L     DD ++ +          
Sbjct: 522 GLDGIVGFYDFNKSTFLGKLQLDAP-ITKMVYHRSSDLFALILDDLSIVLIDAVTQRVVR 580

Query: 360 VFYGHSQSITSAHWVDDDT-IISTSMDGSIRVWSLASNSTVASATVDGV 407
            F+GHS  IT+  +  D   I+S S+D +IR W L +   +    ++ V
Sbjct: 581 QFWGHSNRITALDFSPDGRWIVSASLDSTIRTWDLPTGGCIDGIKLESV 629

 Score = 32.7 bits (73), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 31/161 (19%), Positives = 68/161 (42%), Gaps = 18/161 (11%)

Query: 197 VTCLEWAPAGQSLLTGVESGELRLWSVE-GKLQNILSYHRAPIVCIKWNSDETHVLTCDA 255
           V  +  +  G     G  +G + +++++ G L+     H+  +  I  +     +++C  
Sbjct: 464 VKSVALSQCGNFGFVGSSNGGISVFNMQSGILRKKYRLHKKTVTGIALDGMNRKMVSCGL 523

Query: 256 DNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQ------DKFAIPGIQGSILVFN 309
           D +           V  + F ++     L +DA           D FA+     SI++ +
Sbjct: 524 DGI-----------VGFYDFNKSTFLGKLQLDAPITKMVYHRSSDLFALILDDLSIVLID 572

Query: 310 IGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW 350
               + + +  GHS  +T + ++   + ++SAS D+T+R W
Sbjct: 573 AVTQRVVRQFWGHSNRITALDFSPDGRWIVSASLDSTIRTW 613

>Kwal_47.17827
          Length = 523

 Score = 37.7 bits (86), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 52/112 (46%), Gaps = 13/112 (11%)

Query: 296 FAIPGIQGSILVFNIGISK--PIGKLRGHSKTLTTIAYNEHNKLLLSASDDN-TLRVW-- 350
           FA  G  G I +++    K  P   ++  S  +  I++NE    LL++ DDN T  VW  
Sbjct: 349 FATCGCDGYIRIWDTRSKKHKPAISVKASSTDVNVISWNEKIGYLLASGDDNGTWGVWDL 408

Query: 351 ------RGGNLNPSHVFYGHSQSITSAHW--VDDDTIISTSMDGSIRVWSLA 394
                    +++P   +  H  +ITS  +  +DD  I   S D ++ +W L+
Sbjct: 409 RQFSPNNAASVSPVAQYSFHKGAITSIAFNPLDDSIIAVASEDNTVTLWDLS 460

>Kwal_26.8628
          Length = 422

 Score = 37.4 bits (85), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 44/216 (20%), Positives = 79/216 (36%), Gaps = 56/216 (25%)

Query: 231 LSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATW 290
           L+ H   I    W+SD   +L+   D   IVW+   G       FK    + ++ +D+ W
Sbjct: 82  LNGHNNKISDFAWSSDSRSILSASQDGFMIVWDASLG-------FK----KNAIPLDSQW 130

Query: 291 IDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW 350
           +                                    T A N    L+ SA   N+  ++
Sbjct: 131 V-----------------------------------LTCAINSSGNLVASAGLTNSCTIY 155

Query: 351 RGGNLNPSH-----VFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVD 405
           R    N        +F GH+  ++   + ++++II+ S D +  +W +     +A  +  
Sbjct: 156 RISQENRVQQQIVSMFKGHTCYVSQVEFFENNSIITASGDMTCALWDIPKAKRIAEFSDH 215

Query: 406 GVPNFTGALSPDQGK-----FATGTLDGEVMVYDIQ 436
                  AL P   +     FA+G  DG V ++D +
Sbjct: 216 LGDVLALALPPPHAQTSSPIFASGGSDGYVYIWDTR 251

>Kwal_55.21450
          Length = 503

 Score = 37.4 bits (85), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 47/104 (45%), Gaps = 6/104 (5%)

Query: 337 LLLSASDDNTLRVW---RGGNLNPSHVFYGHSQSITSAHWVDDDT-IISTSMDGSIRVWS 392
           L LSA +DN +++W   R   L     + GHS+++    +  + +  +S S D  I++W 
Sbjct: 225 LCLSAGNDNQVKIWDLYRDREL--LRDYRGHSKAVRGISFNSEGSEFLSVSFDQQIKIWD 282

Query: 393 LASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQ 436
             +       +   +PN       +  +F  G  + E+  YD++
Sbjct: 283 TETGKVRHQYSYSCIPNCAEFRPSNSNEFIVGLSNSEIRHYDLR 326

 Score = 33.5 bits (75), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 34/166 (20%), Positives = 61/166 (36%), Gaps = 51/166 (30%)

Query: 320 RGHSKTLTTIAYNEHNKLLLSASDDNTLRVW----------------------------- 350
           RGHSK +  I++N      LS S D  +++W                             
Sbjct: 251 RGHSKAVRGISFNSEGSEFLSVSFDQQIKIWDTETGKVRHQYSYSCIPNCAEFRPSNSNE 310

Query: 351 ----------RGGNLNPSH------VFYGHSQSITS-AHWVDDDTIISTSMDGSIRVWSL 393
                     R  +L  SH      V+  H  SI +  ++ D    +S+S D S+R+W  
Sbjct: 311 FIVGLSNSEIRHYDLRTSHKNGLVQVYDHHLSSIIALKYFPDGSKFVSSSEDKSMRIWEN 370

Query: 394 ASN---STVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQ 436
             N     ++  +   +P     + P+Q  FA  ++D  +  + ++
Sbjct: 371 QINIPIKQISDTSQYSMPYI--GIHPEQNYFAAQSMDNAIYAFSMK 414

 Score = 32.7 bits (73), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 48/270 (17%), Positives = 99/270 (36%), Gaps = 45/270 (16%)

Query: 192 GQQNEVTCLEWAP-AGQSLLTGVESGELRLWSVEGKLQNILSY--HRAPIVCIKWNSDET 248
           G +N    +   P +G   L+     ++++W +    + +  Y  H   +  I +NS+ +
Sbjct: 208 GHKNGTNSILLLPKSGHLCLSAGNDNQVKIWDLYRDRELLRDYRGHSKAVRGISFNSEGS 267

Query: 249 HVLTCDADNMTIVWNVLSGTAVQHFS---------FKEAGTEESL-GVDATWIDQDKFAI 298
             L+   D    +W+  +G     +S         F+ + + E + G+  + I       
Sbjct: 268 EFLSVSFDQQIKIWDTETGKVRHQYSYSCIPNCAEFRPSNSNEFIVGLSNSEIRHYDLRT 327

Query: 299 PGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPS 358
               G + V++            H  ++  + Y       +S+S+D ++R+W      P 
Sbjct: 328 SHKNGLVQVYD-----------HHLSSIIALKYFPDGSKFVSSSEDKSMRIWENQINIPI 376

Query: 359 HVFYGHSQSITSAHWV----DDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTG-- 412
                 SQ   S  ++    + +   + SMD +I  +S+               +F+G  
Sbjct: 377 KQISDTSQ--YSMPYIGIHPEQNYFAAQSMDNAIYAFSMKPKYKRHPKK-----HFSGHK 429

Query: 413 --------ALSPDQGKFATGTLDGEVMVYD 434
                     SPD    A+G   G V ++D
Sbjct: 430 CAGFGIGFGFSPDGQYIASGDTRGRVYIWD 459

>Kwal_26.8975
          Length = 445

 Score = 37.4 bits (85), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 65/322 (20%), Positives = 123/322 (38%), Gaps = 46/322 (14%)

Query: 141 FPPGYVSQWNPKHEGVFAYGERDSRAAVVTYSVADGLWNISETVVLADANTGQQNEVTCL 200
            PP Y+  +N   + V A      +    +Y      WN+S  V       G    V  +
Sbjct: 91  LPPSYLKSFN-NEDWVSALDVGGDKIVSGSYDGIVRTWNLSGKV--EKQYAGHSGAVRAV 147

Query: 201 EWAPAGQSLLTGVESGELRLWSV-----------------EGKLQNILSYHRAPIVCIKW 243
           ++  + + L++G     LRLW                   EGK   IL  H+AP+V +  
Sbjct: 148 KYISSTR-LVSGANDRTLRLWKTKNDELKNNLAAEEDDVEEGKTLAILEAHKAPVVTVDV 206

Query: 244 NSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQG 303
           + D   +++   DN    W      +  H         ++LG + +   + +  +    G
Sbjct: 207 SGD--RIISGSYDNSIGFW------STNHKEMTAVDPMDALGSNVSSAAKKRRRLALKDG 258

Query: 304 SILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLL-LSASDDNTLRVWRGGNLNPSHVFY 362
           S+         P+  L  H+  +  + ++  +K +  S S D+T++ W   +L  +    
Sbjct: 259 SVRR-----RSPLALLESHTAPVEEVLFDFADKTVGYSVSQDHTIKTW---DLVTARCVD 310

Query: 363 GHSQSITSAHWVDDDTIISTSMDGSIRVWSL-----ASNSTVASATVDGVPNFTGAL--S 415
             S S +         +   +   S R  +L      S++ +    ++G  NF  AL   
Sbjct: 311 TKSTSYSLLSLAQLPQLNLLACGSSARHITLHDPRVGSSTKITQQQLNGHKNFVVALDTC 370

Query: 416 PD-QGKFATGTLDGEVMVYDIQ 436
           P+ +    +G+ DG V V+D++
Sbjct: 371 PEMEYMLCSGSHDGTVKVWDVR 392

>YCL039W (GID7) [504] chr3 (52645..54882) Protein of unknown
           function, member of the WD (WD-40) repeat family [2238
           bp, 745 aa]
          Length = 745

 Score = 37.7 bits (86), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 45/101 (44%), Gaps = 15/101 (14%)

Query: 309 NIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQ-- 366
           NI I K  G+ + H    +  AY   NKL++S S+D  + +W     N   V  GHS   
Sbjct: 647 NILIQKYFGQKQQHFIIRSCFAYG--NKLVMSGSEDGKIYIWDRIRGNLVSVLSGHSTVM 704

Query: 367 -----------SITSAHWVDDDTIISTSMDGSIRVWSLASN 396
                      ++ +++  D +   S   DG I++W ++ N
Sbjct: 705 SNSTKPMGKNCNVVASNPADKEMFASGGDDGKIKIWKISRN 745

 Score = 33.5 bits (75), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 69/165 (41%), Gaps = 23/165 (13%)

Query: 291 IDQDKFAIPGIQGSILVFNI-GISKPIGKLRG--HSKTLTTIAYNEHNKLLLSASDDNTL 347
           +D   F IP I    +  N+  IS P+       H + ++     E   L+L +  DN L
Sbjct: 585 VDPKNFLIPRIARLDVGKNMTCISLPLNTTHQGFHRQQIS-----ESQHLVLVSLQDNEL 639

Query: 348 RVWRGGNLNPSHVFYGHSQS---ITSAHWVDDDTIISTSMDGSIRVWS---------LAS 395
           ++W          ++G  Q    I S     +  ++S S DG I +W          L+ 
Sbjct: 640 QMWDYKENILIQKYFGQKQQHFIIRSCFAYGNKLVMSGSEDGKIYIWDRIRGNLVSVLSG 699

Query: 396 NSTVASATVDGV---PNFTGALSPDQGKFATGTLDGEVMVYDIQK 437
           +STV S +   +    N   +   D+  FA+G  DG++ ++ I +
Sbjct: 700 HSTVMSNSTKPMGKNCNVVASNPADKEMFASGGDDGKIKIWKISR 744

>KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777.1
           Kluyveromyces lactis CRN1 homologue, start by similarity
          Length = 707

 Score = 37.4 bits (85), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 47/215 (21%), Positives = 86/215 (40%), Gaps = 43/215 (20%)

Query: 231 LSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAG----------- 279
           L Y    I    W+S+   ++ C+   +++ WN   G A      KE G           
Sbjct: 35  LQYENLRITSNAWDSN---LIKCNGKYISVNWNSSGGGAFAVIPVKEVGKIPDQVPLFRG 91

Query: 280 -TEESLGVDATWIDQDKFAIPGIQGSILVFNI----GIS------------KPIGKLRGH 322
            T + L  D +  +    A     G I ++ I    G+             KP+  L GH
Sbjct: 92  HTAQVLDTDFSPFNDHIVASGSDDGKIGIWEIPEDYGLHEYVDEEGNPKDLKPVRMLSGH 151

Query: 323 SKTLTTIAYNE-HNKLLLSASDDNTLRVWRGGNLNPSHVFY--GHSQSITSAHW-VDDDT 378
           S+ +  + ++     +L S+S D T+++W   +++   V +   H   +TS  +  D   
Sbjct: 152 SRKVGHLLFHPLAENILASSSLDYTVKIW---DISQEEVKFTLKHPDMVTSMSFSYDGKH 208

Query: 379 IISTSMDGSIRVWSLASNSTVASATVDGVPNFTGA 413
           +++ S D  +RVW + +   V+       P  +GA
Sbjct: 209 LVTVSRDKKLRVWDVRAEKIVSEG-----PAHSGA 238

>AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH]
           (526057..527832) [1776 bp, 591 aa]
          Length = 591

 Score = 37.4 bits (85), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 75/209 (35%), Gaps = 40/209 (19%)

Query: 227 LQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGV 286
            QN    H   I+ +  + D  +V+T   D   IVW+  S   V+    K+    E LG+
Sbjct: 247 FQNTTEGHYDEILTVAASPDGKYVVTGGRDKKLIVWSTESLAPVKVIPTKDR-RGEVLGL 305

Query: 287 DATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNT 346
            A   + D+         I  F I     +  L GH   +  I+     + +   S D T
Sbjct: 306 -AFRRNTDQLYAACADYKIRTFAINQFSQLEVLYGHQDIVADISALNMERCVTVGSRDRT 364

Query: 347 LRVW----------RGGNLNPSH--------------------------VFYGHSQSITS 370
             +W          RGG+ +P                            VFYG   SI  
Sbjct: 365 CMLWKIADETRLTFRGGD-DPEKLLRRWQKANSEQENKDADDNTPAEPPVFYGEG-SIDC 422

Query: 371 AHWVDDDTIISTSMDGSIRVWSLASNSTV 399
              +DD   IS S +G+I +WSL+    +
Sbjct: 423 ITMLDDSHFISGSDNGNISLWSLSKKKPL 451

>CAGL0L09647g 1032740..1034029 highly similar to sp|P35184
           Saccharomyces cerevisiae YIR012w SQT1, start by
           similarity
          Length = 429

 Score = 37.0 bits (84), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 53/129 (41%), Gaps = 21/129 (16%)

Query: 322 HSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNP--SHVFYGHSQSITSAHWVDDDT- 378
           H+ ++  +A++    L+ S   DN + +W   +  P  +    GH++S+ +AH+  D   
Sbjct: 63  HTDSVFVVAHHPSLPLVASGGADNVIHLWTSHSQPPKFAGTLSGHTESVIAAHFTPDGKF 122

Query: 379 IISTSMDGSIRV---------WSLASNSTVASATV--DGVPNFTGALSPDQGKFATGTLD 427
           ++S  M G + V         W L S        +     P  +GA       FA G  D
Sbjct: 123 LVSADMTGKLLVHASVKGGAQWKLVSELQEVEEIIWLKVHPKVSGA-------FALGATD 175

Query: 428 GEVMVYDIQ 436
           G V  Y I 
Sbjct: 176 GSVWCYQIN 184

>YDL195W (SEC31) [678] chr4 (107209..111030) Component (p150) of the
           COPII coat of secretory pathway vesicles involved in
           endoplasmic reticulum to Golgi transport, associated
           with Sec13p, member of WD (WD-40) repeat family [3822
           bp, 1273 aa]
          Length = 1273

 Score = 37.4 bits (85), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 78/165 (47%), Gaps = 26/165 (15%)

Query: 209 LLTGVESGELRLWSVEGKLQNILSYHR-AP---------IVCIKWNSDETHVL-TCDADN 257
           L +G  +GE+ +W +    ++  +Y    P         ++ + WN    HV  +  + N
Sbjct: 124 LASGGNNGEIFIWDMNKCTESPSNYTPLTPGQSMSSVDEVISLAWNQSLAHVFASAGSSN 183

Query: 258 MTIVWNVLSGTAVQHFSF--KEAGTEESLGVDATWIDQDKFAIPGIQGS-----ILVFNI 310
              +W++ +   V H S+    +G ++ L V   W  ++   +    GS     IL++++
Sbjct: 184 FASIWDLKAKKEVIHLSYTSPNSGIKQQLSV-VEWHPKNSTRVATATGSDNDPSILIWDL 242

Query: 311 -GISKPIGKL-RGHSKTLTTIAY---NEHNKLLLSASDDNTLRVW 350
              + P+  L +GH K + ++ +   +EH  LLLS+  DNT+ +W
Sbjct: 243 RNANTPLQTLNQGHQKGILSLDWCHQDEH--LLLSSGRDNTVLLW 285

 Score = 32.7 bits (73), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 30/136 (22%), Positives = 60/136 (44%), Gaps = 12/136 (8%)

Query: 149 WNPKHEGVFAYGERDSRAAVVTYSVADGLWNISETVVLADANTGQQNEVTCLEWAPAGQS 208
           WN     VFA     + A++        + ++S T      N+G + +++ +EW P   +
Sbjct: 168 WNQSLAHVFASAGSSNFASIWDLKAKKEVIHLSYT----SPNSGIKQQLSVVEWHPKNST 223

Query: 209 LL---TGVES-GELRLWSVEG---KLQNILSYHRAPIVCIKW-NSDETHVLTCDADNMTI 260
            +   TG ++   + +W +      LQ +   H+  I+ + W + DE  +L+   DN  +
Sbjct: 224 RVATATGSDNDPSILIWDLRNANTPLQTLNQGHQKGILSLDWCHQDEHLLLSSGRDNTVL 283

Query: 261 VWNVLSGTAVQHFSFK 276
           +WN  S   +  F  +
Sbjct: 284 LWNPESAEQLSQFPAR 299

>Kwal_56.23685
          Length = 1102

 Score = 37.4 bits (85), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 44/85 (51%), Gaps = 7/85 (8%)

Query: 327 TTIAYNEHNKLLLSASDDNTLRVW--RGGNLNPSHVFYGHSQSITSAHW--VDDDTIIST 382
           + + +N  N  +++++  N + +W  R G   P HV  GH  S+ S  +   D+  I+S+
Sbjct: 162 SQVKWNYKNSNVMASAHSNDVYIWDLRKG-CTPLHVLQGHVNSVNSIDFSKFDETEIMSS 220

Query: 383 SMDGSIRVW--SLASNSTVASATVD 405
           S DG+++ W  SL+      + T D
Sbjct: 221 SNDGTVKFWDYSLSDKEPQRTVTTD 245

>KLLA0E03982g 371642..372760 similar to sp|P39108 Saccharomyces
           cerevisiae YDR142c PAS7 peroxisomal import protein -
           peroxin singleton, start by similarity
          Length = 372

 Score = 37.0 bits (84), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 65/152 (42%), Gaps = 31/152 (20%)

Query: 271 QHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKP----------IGKLR 320
           QH  F   G  E+L  D         A  G+   I V+++ + +           I +++
Sbjct: 219 QH-QFLGHGGFEALTCDFNKYRPHIIATGGVDKMIKVWDLRMCRKMLSQGHQPININEIQ 277

Query: 321 GHSKTLTTIAYN-EHNKLLLSASDDNTLRVW------------RGGNLNPSH----VFYG 363
           GH   +  + ++  H+ +LLS S D T RVW            +  +++P+H    +F  
Sbjct: 278 GHELAVRKVTWSPHHSNMLLSTSYDMTCRVWTDLSDDGHGLTGKTNSIDPAHGCRFIFME 337

Query: 364 HSQSITSAHWVDDDT---IISTSMDGSIRVWS 392
           HS+ +  A W    T   + ST  DG + +W+
Sbjct: 338 HSEFVFGADWSLWGTPGFVASTGWDGQVCIWN 369

 Score = 35.4 bits (80), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 62/129 (48%), Gaps = 17/129 (13%)

Query: 296 FAIPGIQGSILVFNIGISKPIGKLRGHSKTLTT-----IAYNE-HNKLLLSASDDNTLRV 349
           F + G  G +++ +I    P G+L   +  LT      +A+NE H    L A  D +LR+
Sbjct: 32  FGLVG-NGKLIILDI---MPNGQLVESNSFLTQDGLFDLAWNESHENQCLVAQGDGSLRL 87

Query: 350 WRGGNLN-PSHVFYGHSQSITSAHW--VDDDTIISTSMDGSIRVWSLASNSTVASATVDG 406
           +     + P  ++  H + + S +W  +     +S+S DG +++WSL    ++ + +   
Sbjct: 88  FDIKLKDYPIAIYKEHQREVFSCNWNMIQKQMFVSSSWDGKVKLWSLMRPQSLMTMS--- 144

Query: 407 VPNFTGALS 415
            PN T A S
Sbjct: 145 -PNDTNAAS 152

>AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH]
           complement(850726..850730,850789..852685) [1902 bp, 633
           aa]
          Length = 633

 Score = 37.4 bits (85), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 55/132 (41%), Gaps = 9/132 (6%)

Query: 147 SQWNPKHEGVFAYGERDSRAAV----VTYS---VADGLWNISETVVLADANTGQQNEVTC 199
           + ++P  E +   G  D R  V     TYS     D   N+ E V      TG Q +V  
Sbjct: 87  TDFDPFDERMLVSGSDDGRIGVWEIPATYSFHNAQDEDGNV-EHVAPVKFLTGHQRKVGH 145

Query: 200 LEWAPAGQSLLTGVE-SGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNM 258
           + + P  Q +L        +RLW+VE     I+  H   +  + ++   T++ T   D M
Sbjct: 146 VLYHPTAQGVLASSSLDHTVRLWNVEQGTNPIVLTHPDMVTSMSFSYGGTYLATVCRDKM 205

Query: 259 TIVWNVLSGTAV 270
             VW++  G  V
Sbjct: 206 LRVWDIRKGEVV 217

 Score = 32.3 bits (72), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 66/155 (42%), Gaps = 27/155 (17%)

Query: 316 IGKLRGHSKTLTTIAYNEHN-KLLLSASDDNTLRVW-------------RGGNLN---PS 358
           I   RGH+  +    ++  + ++L+S SDD  + VW               GN+    P 
Sbjct: 74  IPLFRGHTAQVLDTDFDPFDERMLVSGSDDGRIGVWEIPATYSFHNAQDEDGNVEHVAPV 133

Query: 359 HVFYGHSQSITSA--HWVDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSP 416
               GH + +     H      + S+S+D ++R+W++   +     T    P+   ++S 
Sbjct: 134 KFLTGHQRKVGHVLYHPTAQGVLASSSLDHTVRLWNVEQGTNPIVLT---HPDMVTSMSF 190

Query: 417 DQGK--FATGTLDGEVMVYDIQK---LLQQLNHNG 446
             G    AT   D  + V+DI+K   + + + H+G
Sbjct: 191 SYGGTYLATVCRDKMLRVWDIRKGEVVSEGMGHSG 225

>Scas_715.35
          Length = 1034

 Score = 37.4 bits (85), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 56/151 (37%), Gaps = 39/151 (25%)

Query: 132 IKTLQCVQTFPPGYVS-----QWNPKHEGVFAYGERDSRAAVVTYSVADGLWNISETVVL 186
           I+ LQ  + FP   +S     QWNP          RD    +++Y        ++ T  L
Sbjct: 189 IENLQKSKFFPKDRLSPVVSIQWNP----------RDVGTILISYE------QVTVTYSL 232

Query: 187 ADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVEGKLQNILSYHRAPIVCIKWNSD 246
            DA   QQ       +AP G                     +N+    R  ++   ++ +
Sbjct: 233 IDAEIKQQFIYDLPPFAPGGDPS------------------KNVDQLRRPTVIQSLYHPN 274

Query: 247 ETHVLTCDADNMTIVWNVLSGTAVQHFSFKE 277
             H+LT  ADN  + W+  +G  +Q  S  E
Sbjct: 275 SLHILTVHADNSLVFWDANTGQLIQARSLLE 305

 Score = 37.0 bits (84), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 24/135 (17%), Positives = 65/135 (48%), Gaps = 23/135 (17%)

Query: 164 SRAAVVTYSVADGLWNIS----ETVVLADANTGQ-------QNEVTCLEWAPAGQSLLTG 212
           ++A +V  S   G++ ++    +T+++    + +        ++VTC+E  P+   +L G
Sbjct: 109 TKAPIVRMSFVKGIYLVAVDAKDTILVMSIYSKKVLTTVFSPSKVTCMETDPSLDWVLFG 168

Query: 213 VESGELRLWSVE------GKLQNILSY------HRAPIVCIKWNSDETHVLTCDADNMTI 260
           ++SG + ++ ++       K++N+           +P+V I+WN  +   +    + +T+
Sbjct: 169 LQSGSVIIYDIDRNQMSTTKIENLQKSKFFPKDRLSPVVSIQWNPRDVGTILISYEQVTV 228

Query: 261 VWNVLSGTAVQHFSF 275
            ++++     Q F +
Sbjct: 229 TYSLIDAEIKQQFIY 243

>YMR092C (AIP1) [4050] chr13 complement(451631..453478) Actin
           interacting protein, contains eight WD (WD-40) repeats
           [1848 bp, 615 aa]
          Length = 615

 Score = 37.0 bits (84), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 51/110 (46%), Gaps = 6/110 (5%)

Query: 289 TWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYN---EHNKLLLSASDDN 345
           +W+D  KFA  G   +I V+++  SK + K     + L           N  ++S S D 
Sbjct: 260 SWLDSQKFATVGADATIRVWDVTTSKCVQKWTLDKQQLGNQQVGVVATGNGRIISLSLDG 319

Query: 346 TLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLAS 395
           TL  +  G+        GH++ IT+   +  + +IS S DG I  WS +S
Sbjct: 320 TLNFYELGHDEVLKTISGHNKGITA---LTVNPLISGSYDGRIMEWSSSS 366

 Score = 30.0 bits (66), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 33/71 (46%), Gaps = 3/71 (4%)

Query: 368 ITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVDGVP---NFTGALSPDQGKFATG 424
           I +  W+D     +   D +IRVW + ++  V   T+D         G ++   G+  + 
Sbjct: 256 IFALSWLDSQKFATVGADATIRVWDVTTSKCVQKWTLDKQQLGNQQVGVVATGNGRIISL 315

Query: 425 TLDGEVMVYDI 435
           +LDG +  Y++
Sbjct: 316 SLDGTLNFYEL 326

>KLLA0F13772g 1276532..1278094 highly similar to sp|Q04305
           Saccharomyces cerevisiae YMR093w singleton, start by
           similarity
          Length = 520

 Score = 37.0 bits (84), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 51/99 (51%), Gaps = 5/99 (5%)

Query: 325 TLTTIAYNEHNKLLLSASDDNTLRVWRGGN-LNPSHVFYGHSQSITSAHWVDD--DTIIS 381
           T  T  +++ NK L++A+DD  +R+W   +   P+    G S  + S  +V +    + +
Sbjct: 127 THVTKFHDQDNKTLVTANDDRVVRLWDVSHAYEPTLQLTGASDYVRSVCFVPNAPHMVAT 186

Query: 382 TSMDGSIRVWSLASNSTVASATVD-GVP-NFTGALSPDQ 418
            S DG +R++ + + S     T+D G+P     A+SP Q
Sbjct: 187 GSYDGVVRLYDIRTKSDKPQTTLDHGLPVEDITAISPTQ 225

 Score = 32.7 bits (73), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 55/114 (48%), Gaps = 11/114 (9%)

Query: 331 YNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYG-----HSQSITSAHWVDDDTIISTSMD 385
           + +  KLL++      + V+   + NP  +        H   +T  H  D+ T+++ + D
Sbjct: 89  FRQDGKLLVAGDATGLVSVY--DSYNPRTLLLSIQASSHPTHVTKFHDQDNKTLVTANDD 146

Query: 386 GSIRVWSLASNSTVASATVDGVPNFTGALS--PDQGKF-ATGTLDGEVMVYDIQ 436
             +R+W + S++   +  + G  ++  ++   P+     ATG+ DG V +YDI+
Sbjct: 147 RVVRLWDV-SHAYEPTLQLTGASDYVRSVCFVPNAPHMVATGSYDGVVRLYDIR 199

>CAGL0H00781g complement(77292..78833) similar to tr|Q12523
           Saccharomyces cerevisiae YPL247c, hypothetical start
          Length = 513

 Score = 37.0 bits (84), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 47/92 (51%), Gaps = 6/92 (6%)

Query: 351 RGGNLNPSHVFYGHSQSITSAHW--VDDDTIISTSMDGSIRVWSLASNSTVASATV--DG 406
           +  ++NPS    G    ITS HW  VD + +IS+S+D +  VW L S++ V +  +  D 
Sbjct: 223 KTSDVNPS--VLGEFPPITSFHWNPVDTNILISSSIDTTCIVWDLQSSNYVKTQLIAHDS 280

Query: 407 VPNFTGALSPDQGKFATGTLDGEVMVYDIQKL 438
                  L+     FA+   DG V V+D++ L
Sbjct: 281 EVFDVRFLTQSTQLFASCGGDGSVRVFDLRCL 312

>Scas_660.7*
          Length = 603

 Score = 37.0 bits (84), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 69/158 (43%), Gaps = 24/158 (15%)

Query: 238 IVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAG-----TEESLGVDATWID 292
           I  + W  DE   +T  AD    VW+V S   VQ +    +       ++ +GV A+   
Sbjct: 242 IFALSW-IDENKFVTASADATIRVWDVNSSKCVQKWVVTSSSDDNVLRDQQVGVVAS--Q 298

Query: 293 QDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW-- 350
           + +     + G++ +F +     I  ++GHSK +T +A N     L++ S D  +  W  
Sbjct: 299 EGRIVSLSLDGTLNIFQLEQDNIITSIKGHSKGITALAVNP----LITGSYDGKIMDWSN 354

Query: 351 -------RGGNLNPS-HVFYGHSQSITSAHWVDDDTII 380
                  +  NL  S  V  G +  I+S  W  DDT++
Sbjct: 355 KPEVAHTKHNNLIVSIDVQTGKADQISSVSW--DDTLM 390

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 42/77 (54%), Gaps = 7/77 (9%)

Query: 368 ITSAHWVDDDTIISTSMDGSIRVWSLASNST-----VASATVDGV--PNFTGALSPDQGK 420
           I +  W+D++  ++ S D +IRVW + S+       V S++ D V      G ++  +G+
Sbjct: 242 IFALSWIDENKFVTASADATIRVWDVNSSKCVQKWVVTSSSDDNVLRDQQVGVVASQEGR 301

Query: 421 FATGTLDGEVMVYDIQK 437
             + +LDG + ++ +++
Sbjct: 302 IVSLSLDGTLNIFQLEQ 318

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 35/157 (22%), Positives = 67/157 (42%), Gaps = 38/157 (24%)

Query: 289 TWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLR 348
           +WID++KF       +I V+++  SK + K                  ++ S+SDDN LR
Sbjct: 246 SWIDENKFVTASADATIRVWDVNSSKCVQKW-----------------VVTSSSDDNVLR 288

Query: 349 VWRGGNLNPSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVDGVP 408
             + G +                    +  I+S S+DG++ ++ L  ++ + S  + G  
Sbjct: 289 DQQVGVVASQ-----------------EGRIVSLSLDGTLNIFQLEQDNIITS--IKGHS 329

Query: 409 NFTGALSPDQGKFATGTLDGEVMVYDIQKLLQQLNHN 445
               AL+ +     TG+ DG++M +  +  +    HN
Sbjct: 330 KGITALAVN--PLITGSYDGKIMDWSNKPEVAHTKHN 364

>KLLA0E19613g complement(1733708..1735426) similar to sp|P21304
           Saccharomyces cerevisiae YLR196w PWP1 singleton, start
           by similarity
          Length = 572

 Score = 37.0 bits (84), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 46/101 (45%), Gaps = 20/101 (19%)

Query: 256 DNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNI---GI 312
           ++M+  WNV SG  ++   F                D++ F      G++  F+I     
Sbjct: 369 NDMSKYWNVSSGEEIECVRFA---------------DENIFICGTDNGNVYSFDIRNGAE 413

Query: 313 SKPIGKLRGHSKTLTTIAYNEH--NKLLLSASDDNTLRVWR 351
           SKP+  L+ H   ++++  N H  N LL SA  +  +++W+
Sbjct: 414 SKPVWTLKAHDAGVSSVEINRHIPNMLLTSAMGEKPVKLWK 454

>KLLA0F19734g 1826828..1830229 similar to sgd|S0002535 Saccharomyces
           cerevisiae YDR128w, start by similarity
          Length = 1133

 Score = 37.0 bits (84), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 38/180 (21%), Positives = 71/180 (39%), Gaps = 28/180 (15%)

Query: 241 IKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPG 300
           +KWN   ++VL     N+  VW+V  GT+    S  E  +     +D    ++ +    G
Sbjct: 164 VKWNHKNSNVLATSHSNIVYVWDVRKGTSP--LSVLEGHSGSVNSIDFNPFNETEIMSSG 221

Query: 301 IQGSI-----------LVFNIGISKPIGKLR----GHSKTLTTIAYNEHNKLLLSASDDN 345
             G++           L   I    P+ + R    G    +  +    ++  L ++  D+
Sbjct: 222 NDGTVKFWDYNKVEDELQMTITTEFPVWRGRYLPFGDGYCIMPMIGGNNSVYLANSFHDS 281

Query: 346 TLRVWRGGNLNPSHVFYGHSQSITSAHW---------VDDD--TIISTSMDGSIRVWSLA 394
                R   L P++VF GH+  +T   W         +DD    +++ S D  +R+W + 
Sbjct: 282 GNSESRTTKLQPTYVFKGHTDRVTDFLWRSRHSQNTIIDDREFQLVTWSKDCDLRLWPVP 341

>ABL024W [568] [Homologous to ScYMR102C - SH; ScYKL121W - SH]
           complement(353684..355888) [2205 bp, 734 aa]
          Length = 734

 Score = 37.0 bits (84), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 48/113 (42%), Gaps = 6/113 (5%)

Query: 335 NKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSA--HWVDDDTIISTSMDGSIRVWS 392
           N  LL+AS D T+++W   N   S   + H   +T    H  DD    S  +D ++R WS
Sbjct: 225 NSFLLTASMDKTVKLWH-INRTTSLKTFVHPDFVTCVRFHPHDDRFFFSGCLDHTVRTWS 283

Query: 393 LASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDIQ--KLLQQLN 443
           +     VA A   G       +SPD      GT +G V V      KLL   +
Sbjct: 284 ILEGE-VAEAFNCGDLIMALDVSPDGNWLLIGTFNGYVHVLHTNGLKLLHSFH 335

 Score = 34.3 bits (77), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 38/83 (45%), Gaps = 6/83 (7%)

Query: 356 NPSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGAL- 414
           +P  VF  H Q I    W  +  +++ SMD ++++W +   +++ +      P+F   + 
Sbjct: 205 DPHRVFGEHLQDILDCDWSKNSFLLTASMDKTVKLWHINRTTSLKTFV---HPDFVTCVR 261

Query: 415 --SPDQGKFATGTLDGEVMVYDI 435
               D   F +G LD  V  + I
Sbjct: 262 FHPHDDRFFFSGCLDHTVRTWSI 284

>Sklu_2435.13 YPR137W, Contig c2435 18346-20073
          Length = 575

 Score = 36.6 bits (83), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 84/413 (20%), Positives = 153/413 (37%), Gaps = 53/413 (12%)

Query: 26  LAMQEETRVLEFDEKYKEHIPLGTLVKLVQKGI--LYTESEFLVQYNAQSEGADAEHYGK 83
           L  ++E   L+ D++++   P     +L ++ +  L  E+  ++Q +A S   D  H   
Sbjct: 47  LDGEDEEEKLDSDDEFEGENPADKRRRLAKQYLENLKAEANEVMQESAASGEMDLAHEID 106

Query: 84  DFNLVQALEVDKQ----RFPELVAQ--GRFAXXXXXXXXXXXXXXXXXXSDDSFIKTLQC 137
           ++N   A ++D+     R     A+  GR                      D  + ++ C
Sbjct: 107 EYNNFDARDLDRDIIASRLKHDFAEQNGRVFRFIADKLLVNEISTSFTRVGDKNLTSISC 166

Query: 138 VQ-TFPP-GYVSQWNPKHEGVFAYG-ERD------------SRAAVVTYSVADGLWNISE 182
            Q TF    +  Q N     +FAY   +D            +R   + Y+     +N   
Sbjct: 167 YQPTFNKFSHEEQQNKNTGKIFAYTVSKDLQLTKYDVTNFSARPKKLKYTKGGRRFNPET 226

Query: 183 TVVLADANTGQQNEVTCLEWAPAGQSLLTGVESGELRLWSVE--GKLQNILSYHRAPIV- 239
           T    +   G  +E+  +  +P G+ ++TG    +L +WS E    ++ I +  R   V 
Sbjct: 227 TNEYENTTEGHYDEILTVAASPDGKYVVTGGRDRKLIVWSTESLSPVKVIPTKDRRGEVL 286

Query: 240 --CIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFA 297
               + NSD+      D    T   N  S   V +         + L VD + +  ++  
Sbjct: 287 SLAFRKNSDQLFASCADYKVRTYAINQFSQLEVLY-------GHQDLVVDISALSMERCV 339

Query: 298 IPGIQG-SILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLN 356
             G +  + +++ I             +T  T    E  + LL        +    G + 
Sbjct: 340 TVGSRDRTAMLWKIA-----------DETRLTFRGGEDPERLLKRWLKQNSKELENGEIE 388

Query: 357 PSH-----VFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATV 404
           P+       FYG   SI     VDD   I+ S +G+I +WSL+    + +  V
Sbjct: 389 PAKEEDAPKFYGEG-SIDCVCMVDDSHFITGSDNGNISLWSLSKKKPIFTQRV 440

>YAR003W (SWD1) [68] chr1 (155009..156289) Component of SET1 and
           COMPASS complex, contains a WD (WD-40) repeat [1281 bp,
           426 aa]
          Length = 426

 Score = 36.6 bits (83), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 39/61 (63%), Gaps = 4/61 (6%)

Query: 294 DKFAIPGIQGSILVFNIGISKPI---GKLRG-HSKTLTTIAYNEHNKLLLSASDDNTLRV 349
           D  A+    G+++++++   +PI   G + G H + +T+IA++   +LLL++S D ++++
Sbjct: 39  DYLALGCANGALVIYDMDTFRPICVPGNMLGAHVRPITSIAWSPDGRLLLTSSRDWSIKL 98

Query: 350 W 350
           W
Sbjct: 99  W 99

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 34/71 (47%), Gaps = 5/71 (7%)

Query: 199 CLEWAPAGQSLLTGVESGELRLWSVEGKLQ-----NILSYHRAPIVCIKWNSDETHVLTC 253
           CL+++P G  L  G  +G L ++ ++         N+L  H  PI  I W+ D   +LT 
Sbjct: 31  CLQFSPCGDYLALGCANGALVIYDMDTFRPICVPGNMLGAHVRPITSIAWSPDGRLLLTS 90

Query: 254 DADNMTIVWNV 264
             D    +W++
Sbjct: 91  SRDWSIKLWDL 101

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.131    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,677,408
Number of extensions: 638803
Number of successful extensions: 4263
Number of sequences better than 10.0: 414
Number of HSP's gapped: 3349
Number of HSP's successfully gapped: 997
Length of query: 492
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 386
Effective length of database: 12,926,601
Effective search space: 4989667986
Effective search space used: 4989667986
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)