Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL321W69768436730.0
Kwal_27.1258369570514930.0
KLLA0E11319g72071514690.0
YBR102C (EXO84)75374314560.0
Scas_718.776475814070.0
CAGL0K12166g76476012591e-163
ACR258W4083124810.15
Kwal_55.21402516100731.1
KLLA0E06215g21364692.3
YLR361C578109684.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL321W
         (684 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL321W [1420] [Homologous to ScYBR102C (EXO84) - SH] complement...  1419   0.0  
Kwal_27.12583                                                         579   0.0  
KLLA0E11319g 996736..998898 similar to sp|P38261 Saccharomyces c...   570   0.0  
YBR102C (EXO84) [291] chr2 complement(445019..447280) Subunit of...   565   0.0  
Scas_718.7                                                            546   0.0  
CAGL0K12166g complement(1188432..1190726) similar to sp|P38261 S...   489   e-163
ACR258W [1305] [Homologous to ScYKR054C (DYN1) - SH] complement(...    36   0.15 
Kwal_55.21402                                                          33   1.1  
KLLA0E06215g 562140..562781 no similarity, hypothetical start          31   2.3  
YLR361C (YLR361C) [3742] chr12 complement(847387..849123) Member...    31   4.5  

>ADL321W [1420] [Homologous to ScYBR102C (EXO84) - SH]
           complement(130700..132793) [2094 bp, 697 aa]
          Length = 697

 Score = 1419 bits (3673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 684/684 (100%), Positives = 684/684 (100%)

Query: 1   MVDFSLRKARNNWSKLSSPGKTRQQGSPTKLKSNAYEDFVSPRDTLQLPEIGMKDRRKVG 60
           MVDFSLRKARNNWSKLSSPGKTRQQGSPTKLKSNAYEDFVSPRDTLQLPEIGMKDRRKVG
Sbjct: 1   MVDFSLRKARNNWSKLSSPGKTRQQGSPTKLKSNAYEDFVSPRDTLQLPEIGMKDRRKVG 60

Query: 61  TSMQRRLSVHNAKYIPPPIDYASAPALPTAVELPVRDNSLLSSELMKPNHRRPPVDIYGG 120
           TSMQRRLSVHNAKYIPPPIDYASAPALPTAVELPVRDNSLLSSELMKPNHRRPPVDIYGG
Sbjct: 61  TSMQRRLSVHNAKYIPPPIDYASAPALPTAVELPVRDNSLLSSELMKPNHRRPPVDIYGG 120

Query: 121 RSLREILSNPQFQAKRFVHEKLGDATALEIDHFASNLNHLSQEIEQEIKSNINKSYNELM 180
           RSLREILSNPQFQAKRFVHEKLGDATALEIDHFASNLNHLSQEIEQEIKSNINKSYNELM
Sbjct: 121 RSLREILSNPQFQAKRFVHEKLGDATALEIDHFASNLNHLSQEIEQEIKSNINKSYNELM 180

Query: 181 QVNKELAVASTELKDLRSKVQQLQVVMGQFTAMAEKRLLLEKEHFRQSNTSVMTTKSGST 240
           QVNKELAVASTELKDLRSKVQQLQVVMGQFTAMAEKRLLLEKEHFRQSNTSVMTTKSGST
Sbjct: 181 QVNKELAVASTELKDLRSKVQQLQVVMGQFTAMAEKRLLLEKEHFRQSNTSVMTTKSGST 240

Query: 241 GSGLLPPVKSGAAKKDRSTVITLEKIWTNELSSLFRSVEGAQKYIAPAPGRRILLESNDW 300
           GSGLLPPVKSGAAKKDRSTVITLEKIWTNELSSLFRSVEGAQKYIAPAPGRRILLESNDW
Sbjct: 241 GSGLLPPVKSGAAKKDRSTVITLEKIWTNELSSLFRSVEGAQKYIAPAPGRRILLESNDW 300

Query: 301 MEINIATLKPLHATRIFLLNDMILVAVCRSDKKGELVANQCCSLRELTVAEESNYTLSFH 360
           MEINIATLKPLHATRIFLLNDMILVAVCRSDKKGELVANQCCSLRELTVAEESNYTLSFH
Sbjct: 301 MEINIATLKPLHATRIFLLNDMILVAVCRSDKKGELVANQCCSLRELTVAEESNYTLSFH 360

Query: 361 FGNKHHSLYRSRTPTGYTALLNEIKSAKDELRDIYQAEEDNARKLRDFFTYLQSTQQSPS 420
           FGNKHHSLYRSRTPTGYTALLNEIKSAKDELRDIYQAEEDNARKLRDFFTYLQSTQQSPS
Sbjct: 361 FGNKHHSLYRSRTPTGYTALLNEIKSAKDELRDIYQAEEDNARKLRDFFTYLQSTQQSPS 420

Query: 421 RDISSPARGHSRQRSLGTLQNTPSRASTYQENLLQNISMSMHTRSRSGGVNQTAVKLNLV 480
           RDISSPARGHSRQRSLGTLQNTPSRASTYQENLLQNISMSMHTRSRSGGVNQTAVKLNLV
Sbjct: 421 RDISSPARGHSRQRSLGTLQNTPSRASTYQENLLQNISMSMHTRSRSGGVNQTAVKLNLV 480

Query: 481 YEELEELSVPVTRMNFGLAIKKLHSIENILKGITAEAEGEVMLLNLLRMKCNQTRTLITQ 540
           YEELEELSVPVTRMNFGLAIKKLHSIENILKGITAEAEGEVMLLNLLRMKCNQTRTLITQ
Sbjct: 481 YEELEELSVPVTRMNFGLAIKKLHSIENILKGITAEAEGEVMLLNLLRMKCNQTRTLITQ 540

Query: 541 KLTHVINTEYSDANKLESSTKSLILLGMPAEALQLFLHNRSNFIQDLVLQVGVHDNSNSY 600
           KLTHVINTEYSDANKLESSTKSLILLGMPAEALQLFLHNRSNFIQDLVLQVGVHDNSNSY
Sbjct: 541 KLTHVINTEYSDANKLESSTKSLILLGMPAEALQLFLHNRSNFIQDLVLQVGVHDNSNSY 600

Query: 601 ITQVAVIRCQTIKKVAIQFQKLFEGTTAKYSSVLVSWCNDEVDKHFFLMKKQLINDDQLT 660
           ITQVAVIRCQTIKKVAIQFQKLFEGTTAKYSSVLVSWCNDEVDKHFFLMKKQLINDDQLT
Sbjct: 601 ITQVAVIRCQTIKKVAIQFQKLFEGTTAKYSSVLVSWCNDEVDKHFFLMKKQLINDDQLT 660

Query: 661 PQAIKISRKQIDELKSVGMDFVYK 684
           PQAIKISRKQIDELKSVGMDFVYK
Sbjct: 661 PQAIKISRKQIDELKSVGMDFVYK 684

>Kwal_27.12583
          Length = 695

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/705 (44%), Positives = 452/705 (64%), Gaps = 44/705 (6%)

Query: 1   MVDFSLRKARNNWSKLSSPGKTRQQG-SP--TKLKSNAYEDFVSPRDTLQLPEIGMKDRR 57
           MVD SLRKARNNW ++SSP K + +  SP     KSN Y++   P +  QLP IG K+R 
Sbjct: 1   MVDLSLRKARNNWKQMSSPPKAKGRSRSPEDKNFKSNPYQNLKVPSNYSQLPTIGTKERN 60

Query: 58  KVGTSMQRRLSVHNAKYIPPPIDYASAPALPTAVELPVRDNSLLSSELMKPN-------H 110
           KVGTSMQRRLS HN KY+PP  D+ + P       LP     L SSEL+  N       H
Sbjct: 61  KVGTSMQRRLSFHNPKYVPPTSDHMAVP-------LP----QLGSSELLNVNSGDFATRH 109

Query: 111 RR-------PPVDIYGGRSLREILSNPQFQAKRFVHEKLGDATALEIDHFASNLNHLSQE 163
           R        P +D+YG +SLR+IL +P+F+ K F+ + LG+A+ALEID F S+LN LS E
Sbjct: 110 RSNSNFAKGPELDLYGNQSLRQILGDPKFKPKHFITQTLGNASALEIDRFTSDLNDLSLE 169

Query: 164 IEQEIKSNINKSYNELMQVNKELAVASTELKDLRSKVQQLQVVMGQFTAMAEKRLLLEKE 223
           +  EIK NI++SY ++ QVNK++  AS+ELK LRS + +L+ V+ +F  MAEKRL LE+ 
Sbjct: 170 VSDEIKDNISRSYAQVSQVNKDIDRASSELKLLRSSITELKEVISEFETMAEKRLQLERR 229

Query: 224 HFRQSNTSVMTTKSGSTGSGLLPPVKSGAAKKDRSTVITLEKIWTNELSSLFRSVEGAQK 283
                     +T++ S    LLPP K+  A+ DR++V+ LEK+W +EL+SLF++VEGAQK
Sbjct: 230 ---------PSTRARSEQPSLLPPAKASRAR-DRTSVMMLEKMWDSELASLFKAVEGAQK 279

Query: 284 YIAPAPGRRILLESNDWMEINIATLKPLHATRIFLLNDMILVAVCRSDKK-GELVANQCC 342
           +IAP PGR IL+E+ DW E+N ATLKPL +  IF+LNDM+L+A    D++  E VA  C 
Sbjct: 280 FIAPLPGRHILMETGDWYEVNAATLKPLRSIHIFVLNDMLLIAARNQDRRQHEYVACHCH 339

Query: 343 SLRELTVAEESNYTLSFHFGNKHHSLYRSRTPTGYTALLNEIKSAKDELRDIYQAEEDNA 402
           +LR+ ++  +    +   FGN+   L +++    Y  L++ ++ A+D+L  I QAEE+NA
Sbjct: 340 ALRDTSINPQRENRIELCFGNRSQCLVQAKNARNYDRLVSTVRGAQDDLNVISQAEEENA 399

Query: 403 RKLRDFFTYLQSTQQSPSRDIS-SPARGHSRQRSLGTLQNTP-SRASTYQENLLQNISMS 460
           R+LRD F+Y+Q+TQQ+P R+++ SP +GH R  SLG   NTP  R    +  LLQ I+ S
Sbjct: 400 RRLRDSFSYMQATQQTPGRELAISPTKGHGRNSSLGN--NTPHPRDDPKESYLLQTITAS 457

Query: 461 MHTRSRSGGVNQTAVKLNLVYEELEELSVPVTRMNFGLAIKKLHSIENILKGITAEAEGE 520
           M ++ +  G N          +E+EE  +   R N+  AIKKL S++  ++ +      E
Sbjct: 458 MQSQPQFAGSNVGLGDFGRFDDEVEEFDIEFARHNYKEAIKKLESLKKAVQVLEQHTPHE 517

Query: 521 -VMLLNLLRMKCNQTRTLITQKLTHVINTEYSDANKLESSTKSLILLGMPAEALQLFLHN 579
            +M+LNLL ++ +    ++  KLTH+  TE  D +KL    ++LI L    +AL LFL N
Sbjct: 518 NLMILNLLGLRVSHRSQILVAKLTHLTATEIFDFSKLADYVQNLISLNYAHDALVLFLQN 577

Query: 580 RSNFIQDLVLQVGVHDNSNSYITQVAVIRCQTIKKVAIQFQKLFEGTTAKYSSVLVSWCN 639
           RS +I +L+L++G   +   Y++Q+AVIR QT+KKV ++ Q+ F+ T   +SS LVSWC+
Sbjct: 578 RSKYINELILKIGTFHDPVHYLSQIAVIRFQTLKKVVLRVQEQFQNTGDNFSSTLVSWCD 637

Query: 640 DEVDKHFFLMKKQLINDDQLTPQAIKISRKQIDELKSVGMDFVYK 684
           +E DKHF L+ KQ +N + + P +IK SR+QIDELKSVG+DFVYK
Sbjct: 638 EEADKHFALINKQFLNLEMIPPSSIKSSRRQIDELKSVGLDFVYK 682

>KLLA0E11319g 996736..998898 similar to sp|P38261 Saccharomyces
           cerevisiae YBR102c EXO84 exocyst protein essential for
           secretion singleton, start by similarity
          Length = 720

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/715 (45%), Positives = 470/715 (65%), Gaps = 39/715 (5%)

Query: 1   MVDFSLRK-ARNNWSKLSSPGKTRQQG-SPTKLKSNAYEDF-VSPRDTLQLPEIGMKDRR 57
           MVDFSL+K   ++W + S   K    G S +  KS+ Y+D  VS     +LP++  K+R 
Sbjct: 1   MVDFSLKKHGVSSWGRGSLSRKESSAGDSSSTFKSSRYQDMKVSDP---ELPKVSAKERS 57

Query: 58  KVGTSMQRRLSVHNAK-YIPPPIDYASAPALPTAV---------------------ELPV 95
           K GT M+RRLSVH +  +    +D+ + PALP++                      +LP 
Sbjct: 58  KAGTMMKRRLSVHQSNNFGAVKMDFDNMPALPSSAADYSFASNVGNATQTSLITEDQLPD 117

Query: 96  RDNSLLSSELMKPNHRRPPVDIYGGRSLREILSNPQFQAKRFVHEKLGDATALEIDHFAS 155
           R+ SL S   +  N RRP  ++Y  +SLR+ILSNP F+AK+F+ EKLGDATA++ID F S
Sbjct: 118 RNTSLAS---LNTNTRRPDQELYSSKSLRQILSNPDFKAKKFITEKLGDATAVDIDQFTS 174

Query: 156 NLNHLSQEIEQEIKSNINKSYNELMQVNKELAVASTELKDLRSKVQQLQVVMGQFTAMAE 215
           NLN LS EI+ EIK NI+KS+ E++ VNK L  A+TELK LR+KVQ+++ +M QF  +AE
Sbjct: 175 NLNDLSLEIQDEIKFNIDKSFKEILIVNKGLETATTELKVLRTKVQEMKDIMNQFVTIAE 234

Query: 216 KRLLLEKEHFRQSNTSVMTTKSGSTGSGLLPPVKS--GAAKKDRSTVITLEKIWTNELSS 273
           K+L  E+     ++ +  ++ +  +   LLPP+K    A +KDR++V  LE++W  EL +
Sbjct: 235 KKLQAEQAANETADLNRTSSSASLSNHSLLPPLKPTPSATRKDRTSVYILERMWNEELMT 294

Query: 274 LFRSVEGAQKYIAPAPGRRILLESNDWMEINIATLKPLHATRIFLLNDMILVAVCRSDKK 333
           LF++V+GA KYI   PGR ILLES++W+EIN ATLKPL   R+F+LND++L+A  +  K+
Sbjct: 295 LFKNVDGAHKYITSTPGRHILLESDNWIEINPATLKPLQKVRLFILNDVVLIAAPKPSKQ 354

Query: 334 GELVANQCCSLRELTVAEESNYTLSFHFGNKHHSLYRSRTPTGYTALLNEIKSAKDELRD 393
            EL  ++   LR++TV  +S + LSF+F NK H+LYR R P  ++ +++ I+ AKD LR+
Sbjct: 355 TELTVSRFSPLRDVTVEVQSEHELSFNFSNKQHTLYRHRDPQVFSKVIDIIRQAKDALRE 414

Query: 394 IYQAEEDNARKLRDFFTYLQSTQQSPSRD-ISSPARGHSRQRSLGTLQNTPSRASTYQEN 452
           I QAEED  RK+R+ +T LQ  +++P+RD  +SP + H RQRS G    TPSR  +  +N
Sbjct: 415 ISQAEEDTTRKIRNSYTLLQQ-ERTPNRDATTSPVKVHGRQRSYGG-TGTPSRHRSDAQN 472

Query: 453 --LLQNISMSMHTRSRSGGVNQTAVKLNLVYEELEELSVPVTRMNFGLAIKKLHSIENIL 510
             LL NI+ S+H R  S    +   +L  + + LE+L + + R NF LAI KL+ I++ L
Sbjct: 473 DALLTNITRSIHVRMGSEETTEVTKRLKRLDDALEDLDLEIGRQNFDLAITKLNHIQSSL 532

Query: 511 KGITAEAE-GEVMLLNLLRMKCNQTRTLITQKLTHVINTEYSDANKLESSTKSLILLGMP 569
           K + + A   E +++ LL +KC+Q +T++  KLT+++  E SD  KL+S   +L+ L  P
Sbjct: 533 KSLYSSATFDESVMVELLSLKCSQRKTILYTKLTNLLACETSDMTKLKSYMLNLVALNEP 592

Query: 570 AEALQLFLHNRSNFIQDLVLQVGVHDNSNSYITQVAVIRCQTIKKVAIQFQKLFEGTTAK 629
            +AL++FL NRSNFI DL LQ+G+ DN  S+ITQVA+IR QT+KKV  Q+ ++ +     
Sbjct: 593 VDALEVFLQNRSNFINDLTLQIGIIDNVTSFITQVAIIRFQTLKKVTQQYLEVSKNLKRD 652

Query: 630 YSSVLVSWCNDEVDKHFFLMKKQLINDDQLTPQAIKISRKQIDELKSVGMDFVYK 684
           Y+S+LV WC++EVDKHF LM+++L N   L+ QAIKI+RKQIDELK VGMD+VYK
Sbjct: 653 YTSLLVCWCSEEVDKHFQLMERELSNSSTLSVQAIKITRKQIDELKPVGMDYVYK 707

>YBR102C (EXO84) [291] chr2 complement(445019..447280) Subunit of
           the exocyst complex, required for pre-spliceosome
           formation and intron-dependent mRNA splicing [2262 bp,
           753 aa]
          Length = 753

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/743 (42%), Positives = 453/743 (60%), Gaps = 62/743 (8%)

Query: 1   MVDFSLRKARNNWSKL----SSPGKTRQQGSPTK----LKSNAYEDFVSPRDTLQLPEIG 52
           MV+FSL+KARNNW  +    SSP K +   SP K     K N Y D   P  +  LP I 
Sbjct: 1   MVEFSLKKARNNWKHVKKSASSPAKQKTPPSPAKPKQKTKKNPYSDLKDPATSYTLPTIN 60

Query: 53  MKDRRKVGTSMQRRLSVHNAKYIPPPIDYASA-PALPTAV-------------------- 91
            ++R +V TSMQRRLS+HN  Y PP +DY+   P +P  +                    
Sbjct: 61  ARERSRVATSMQRRLSIHNTNYAPPTLDYSMPLPDMPNMIVPNDNVDSSHNNSSFTTENE 120

Query: 92  -----------ELPVRDNSLLSSELMKPNHR---RPPVDIYGGR-------SLREILSNP 130
                       L   D SL  S   K   R   R  V+  G         SLR++L+NP
Sbjct: 121 SVSSKGPSNSLNLSTADLSLNDSSYNKVPARSAMRNTVNPSGSNDPFNNSTSLRKMLANP 180

Query: 131 QFQAKRFVHEKLGDATALEIDHFASNLNHLSQEIEQEIKSNINKSYNELMQVNKELAVAS 190
            F AK FVH+KLG+A+A+ ID F SNL  LS ++++E+K NINKSYNE+M VN +L VA 
Sbjct: 181 HFNAKDFVHDKLGNASAITIDKFTSNLTDLSIQVQEEVKLNINKSYNEIMTVNNDLNVAM 240

Query: 191 TELKDLRSKVQQLQVVMGQFTAMAEKRLLLEKEHFRQSNTSVMTTKSGSTGSGLLPPVKS 250
            ELK +R+ +  L  V+ Q T +AEKRL L+ +  ++   +    +S S    LLPP+K+
Sbjct: 241 LELKRVRANINDLNEVLDQCTKIAEKRLQLQDQIDQERQGNFNNVESHSNSPALLPPLKA 300

Query: 251 GA----AKKDRSTVITLEKIWTNELSSLFRSVEGAQKYIAPAPGRRILLESNDWMEINIA 306
           G      ++DRS+V+ LEK W  EL  LF++VEGAQK+I    GR IL+ S +WME+N  
Sbjct: 301 GQNGNLMRRDRSSVLILEKFWDTELDQLFKNVEGAQKFINSTKGRHILMNSANWMELNTT 360

Query: 307 TLKPLHATRIFLLNDMILVAVCRSDKKGELVANQCCSLRELTVAEE--SNYTLSFHFGNK 364
           T KPL   +IF+LND++L+A    DK+ + + +QC  L+++TV +E  S   L F F N 
Sbjct: 361 TGKPLQMVQIFILNDLVLIADKSRDKQNDFIVSQCYPLKDVTVTQEEFSTKRLLFKFSNS 420

Query: 365 HHSLYRSRTPTGYTALLNEIKSAKDELRDIYQAEEDNARKLRDFFTYLQSTQQSPSRDIS 424
           + SLY  R     + LL+ I+ AKD+L DI+  EE+N++++R+ F YLQSTQQ+P R+ +
Sbjct: 421 NSSLYECRDADECSRLLDVIRKAKDDLCDIFHVEEENSKRIRESFRYLQSTQQTPGRENN 480

Query: 425 SPARGHSRQRSLGTLQNTPSRAST--YQENLLQNISMSMHTRSRSGGVNQTAVKLNLVYE 482
                + R+   G++  TP R  T    + LLQN+++SMH+R RS  ++ TA +L  + E
Sbjct: 481 RSPNKNKRRSMGGSI--TPGRNVTGAMDQYLLQNLTLSMHSRPRSRDMSSTAQRLKFLDE 538

Query: 483 ELEELSVPVTRMNFGLAIKKLHSIENILKGITAE-AEGEVMLLNLLRMKCNQTRTLITQK 541
            +EE+ + + R+ F  A++ L  IE+ L+ ++   ++ E+MLLNL+ +K  Q R  I+ K
Sbjct: 539 GVEEIDIELARLRFESAVETLLDIESQLEDLSERISDEELMLLNLISLKIEQRREAISSK 598

Query: 542 LTHVINTEYSDANKLESSTKSLILLGMPAEALQLFLHNRSNFIQDLVLQVGVHDNSNSYI 601
           L+  I    ++   L+S T+++I LG+P +AL LFL NRSNFIQDL+LQ+G  DN  +Y+
Sbjct: 599 LSQSI-LSSNEIVHLKSGTENMIKLGLPEQALDLFLQNRSNFIQDLILQIGSVDNPTNYL 657

Query: 602 TQVAVIRCQTIKKVAIQFQKLFEGTTAKYSSVLVSWCNDEVDKHFFLMKKQLINDDQLTP 661
           TQ+AVIR QTIKK    FQ +F+   AK SS+LV WC+DEVD HF L+ KQL+ND+ L+P
Sbjct: 658 TQLAVIRFQTIKKTVEDFQDIFKELGAKISSILVDWCSDEVDNHFKLIDKQLLNDEMLSP 717

Query: 662 QAIKISRKQIDELKSVGMDFVYK 684
            +IK SRKQID LK+VG+DFVYK
Sbjct: 718 GSIKSSRKQIDGLKAVGLDFVYK 740

>Scas_718.7
          Length = 764

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/758 (42%), Positives = 462/758 (60%), Gaps = 81/758 (10%)

Query: 1   MVDFSLRKARNNW--SKLSSPGKTRQQGSPTKLK-----------------------SNA 35
           MVDFSLRKARNNW  SKL+SP K +   SP+K                         +N 
Sbjct: 1   MVDFSLRKARNNWKSSKLTSPIKQKTPSSPSKTHHTPSPTPSSNDKPKKRTAKTNKGANP 60

Query: 36  YEDFVSPRDTLQLPEIGMKDRRKVGTSMQRRLSVHNAKYIPPPIDYASAPALPTAVELPV 95
           Y       D   LP +  K + KV TSMQRRLS+HN+ Y+PP +DY S P LP+  ++P 
Sbjct: 61  YSTMQMTSDYSSLPTMDSKSKNKVATSMQRRLSIHNSNYVPPKLDY-SMP-LPSMSQIPE 118

Query: 96  RDNSL-LSSELMKP-NHRRPP------VDIYGGRSLREILSNPQFQAKRFVHEKLGDATA 147
             N L  +S + KP N  RP         I   ++LR ILSNP F AK FVHE L +A A
Sbjct: 119 SPNKLDTTSHMQKPLNTGRPKEARSSLAKISQPKTLRSILSNPSFNAKNFVHENLSEANA 178

Query: 148 LEIDHFASNLNHLSQEIEQEIKSNINKSYNELMQVNKELAVASTELKDLRSKVQQLQVVM 207
           ++ID F SNL +L++ + +EIK NIN SY+E+M VNK+L VA  ELK LR  + QL  VM
Sbjct: 179 IDIDQFTSNLTNLAEYVSEEIKRNINDSYHEIMNVNKDLNVAMNELKQLRINIVQLSGVM 238

Query: 208 GQFTAMAEKRLLLE----KEHFRQSNTSVMTTKSGSTGSGLLPPVKS---GAAK-KDRST 259
            QF  +A++RL LE    +EH  +      T       S LLPP+KS   G  K +DRS+
Sbjct: 239 EQFETLAQRRLDLEYSSMQEHENEDEDLNATQSQRRGNSTLLPPMKSTTDGKGKYRDRSS 298

Query: 260 VITLEKIWTNELSSLFRSVEGAQKYIA----------PAPGRRILLESNDWMEINIATLK 309
           V+ LEK+W  EL++LF+++EG QK+I               R +LLESNDWME+N+ TLK
Sbjct: 299 VMILEKVWDEELTNLFKNIEGIQKFINNDEFKNNSKLKKNARHLLLESNDWMELNVNTLK 358

Query: 310 PLHATRIFLLNDMILVAVCRSD----KKGELVANQCCSLRELTVAEESNYT---LSFHFG 362
           P    +IF+LND+ILV   +      K+ E V +QC  L  +    +       L F FG
Sbjct: 359 PFQNVKIFILNDLILVVAGKHGRDLIKQNEFVVSQCVPLGNVVGVTKDKMIRNRLYFDFG 418

Query: 363 NKHHSLYRSRTPTGYTALLNEIKSAKDELRDIYQAEEDNARKLRDFFTYLQS-TQQSPS- 420
           N +H LY +RT      +++ ++ AKD+L DI+Q E++N+RK+R+ F YLQS  QQ+PS 
Sbjct: 419 NGNHCLYENRTEEECDKVMDRVRKAKDDLCDIFQTEQENSRKIRESFKYLQSQNQQTPSG 478

Query: 421 -RDIS-SPARGHSRQRSLGTLQNTPSRASTYQEN----------LLQNISMSMHTRSRSG 468
            +D++ SP +  S++RSLG    TP R ++   N           LQ +S SMH+R+RS 
Sbjct: 479 NKDMNKSPMK--SQRRSLGM---TPHRMNSLATNSNNVTSTEQFFLQTLSFSMHSRTRSH 533

Query: 469 GVNQTAVKLNLVYEELEELSVPVTRMNFGLAIKKLHSIENILKGITAEAEGE-VMLLNLL 527
            +N  + KL  + + +EE+ + +TR+ F +A+  L  IE+ L  I  +   E +ML  L+
Sbjct: 534 DMNSISRKLKKLDDSIEEVDIELTRLKFDIAVDTLLDIESQLTEIFDKINDEDLMLHKLI 593

Query: 528 RMKCNQTRTLITQKLTHVINTEYSDANKLESSTKSLILLGMPAEALQLFLHNRSNFIQDL 587
            +K +Q R LI  KL+  I    ++ ++L ++ K++I LG+P ++L LFL NRSN IQDL
Sbjct: 594 SLKVDQRRELIISKLSQNILFSNNEISQLMTNLKTMIKLGLPEQSLDLFLTNRSNLIQDL 653

Query: 588 VLQVGVHDNSNSYITQVAVIRCQTIKKVAIQFQKLFEG-TTAKYSSVLVSWCNDEVDKHF 646
           +LQ+G  DNS +Y+TQ+AVIR QT+K+  + F+++F+   ++K SS+LVSWCN+EVDK+F
Sbjct: 654 ILQIGSFDNSTNYLTQLAVIRFQTMKQTVLNFEQIFQKLCSSKISSILVSWCNEEVDKYF 713

Query: 647 FLMKKQLINDDQLTPQAIKISRKQIDELKSVGMDFVYK 684
            L+ +QL+ND+ L+ ++IK SRKQ+D+LKSVG+DFVYK
Sbjct: 714 RLVDQQLLNDENLSIESIKASRKQLDDLKSVGLDFVYK 751

>CAGL0K12166g complement(1188432..1190726) similar to sp|P38261
           Saccharomyces cerevisiae YBR102c EXO84 exocyst protein
           essential for secretion, start by similarity
          Length = 764

 Score =  489 bits (1259), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 286/760 (37%), Positives = 444/760 (58%), Gaps = 85/760 (11%)

Query: 1   MVDFSLRKARNNWSKLSSPGKTRQQGSPTKLK--------SNAYEDFVSPRDTLQLPEIG 52
           MVDFSLRK RN W   +S  K   Q S   LK        +N Y +   P +   LP + 
Sbjct: 1   MVDFSLRKTRNYWKGSNSSSK---QNSEVSLKNAEKKKPVTNPYANLTVP-NAANLPTLD 56

Query: 53  MKDRRKVGTSMQRRLSVHNAKYIPPPIDYA------------------------------ 82
            K+R K  +SMQRRLS+H A Y  P +DY+                              
Sbjct: 57  AKERNKAASSMQRRLSIHTANYTAPNLDYSMPLPSSNLIDQAMGDEQPTGKVPAINVDDE 116

Query: 83  -------SAPALPTAVELPVRDNSLLSSELMKP----------------------NHRRP 113
                  S  A PT  E   R  +L   EL +                       N   P
Sbjct: 117 YGQRNGHSRSATPTDNETSRRPETLRPPELNRKRLGGSGSSAPSGSSRMTMVAPLNPLSP 176

Query: 114 PVDIYGGRSLREILSNPQFQAKRFVHEKLGDATALEIDHFASNLNHLSQEIEQEIKSNIN 173
             +++   SLR+ILS+PQF AK+F+HE+L +A+A++ID F SNL  LS ++++E+K NI 
Sbjct: 177 YANLFHPASLRKILSDPQFSAKKFIHERLSEASAVDIDLFTSNLTELSTDVQEEVKRNIY 236

Query: 174 KSYNELMQVNKELAVASTELKDLRSKVQQLQVVMGQFTAMAEKRLLLEKEH---FRQSNT 230
           KSYNE++ VN +L  AS ELK LRS + +L  V  QF  +A+ R+ ++++      Q  +
Sbjct: 237 KSYNEIITVNNDLHEASAELKQLRSSISELTKVTDQFVTVAKSRIQMDEQQKMLHTQRPS 296

Query: 231 SVMTTKSGSTGSGLLPPVKSGAAKKDRSTVITLEKIWTNELSSLFRSVEGAQKYIAPAPG 290
           S   T+S S    +   +     K+DR++V+ LEK+W  +L++L+++VEGAQK++ PA  
Sbjct: 297 SPQKTQSSSLLPPVSSDINGTNPKRDRTSVMILEKMWDTQLATLYKNVEGAQKHLGPASN 356

Query: 291 RRILLESNDWMEINIATLKPLHATRIFLLNDMILVAVCRSDKKGELVANQCCSLRELTVA 350
           R +L+ES+DW E+NI+T KPL   ++++LND +LVA    +K+ EL+ +QCC +R++T++
Sbjct: 357 RHLLIESSDWTELNISTQKPLQTVQLYILNDAVLVAGKTKNKQHELIVSQCCPIRDVTIS 416

Query: 351 EESNY--TLSFHFGNKHHSLYRSRTPTGYTALLNEIKSAKDELRDIYQAEEDNARKLRDF 408
            +  Y   L F+FGN +  LY +R       +L+  + AKD+LRDI + E++N++++++ 
Sbjct: 417 TDREYRTKLMFNFGNSNTCLYETRDINECMRVLDAFRKAKDDLRDITENEKENSKRIKES 476

Query: 409 FTYLQSTQQSPSRDIS-SPARGHSRQRSLGTLQNTPSR--ASTYQENLLQNISMSMHTRS 465
             YLQ+TQQ+P R+ S SPA+    +RS+G   ++ SR  +++  + +LQN+S+S+H+RS
Sbjct: 477 LVYLQNTQQTPGREGSKSPAK----RRSMGLSPSSASRPLSASMDQFILQNLSISVHSRS 532

Query: 466 RSGGVNQTAVKLNLVYEELEELSVPVTRMNFGLAIKKLHSIENILKGI-TAEAEGEVMLL 524
           +S   +  + K  LV   +EE+ + + R+ F  A+  L   E+ L  +     E + ++L
Sbjct: 533 KSHDWSSLSHKFKLVDNLIEEVDIDLARLKFDSAVNTLLEAESQLATMKDPTKEEDAIIL 592

Query: 525 NLLRMKCNQTRTLITQKLTHVINTEYSDANKLESSTKSLILLGMPAEALQLFLHNRSNFI 584
           N+L +K +Q R  I  K+T   N   ++   L    K+LI LG+P   L L L N+SN I
Sbjct: 593 NVLTLKLDQRRDDILTKVTQR-NLFINEIAHLREGVKTLIRLGLPEAGLDLLLQNKSNLI 651

Query: 585 QDLVLQVGVHDNSNSYITQVAVIRCQTIKKVAIQFQKLFEGTTAKYSSVLVSWCNDEVDK 644
           Q+L+LQVG  ++ + Y+T++A++R Q IK+  I F++LF     K SS+LVSWC+ EV+K
Sbjct: 652 QELLLQVGSSEHPSLYLTELAIVRFQIIKRTVIVFRELFHRDHDKLSSILVSWCSHEVEK 711

Query: 645 HFFLMKKQLINDDQLTPQAIKISRKQIDELKSVGMDFVYK 684
           HF L+ KQL+N D+L+P AI+ SRKQID+LK+VG+DFVYK
Sbjct: 712 HFNLVSKQLLNGDKLSPDAIRYSRKQIDDLKTVGLDFVYK 751

>ACR258W [1305] [Homologous to ScYKR054C (DYN1) - SH]
            complement(809748..821999) [12252 bp, 4083 aa]
          Length = 4083

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 61/124 (49%), Gaps = 9/124 (7%)

Query: 163  EIEQEIKSNINKSYNELMQVNKELAVASTELKDLRSKVQQLQVVMGQFTAMAEKRLLLEK 222
            E+ +E++++I  S     ++ +E+ +  TE++ ++SKV++   +M   T   E R +   
Sbjct: 3246 EMIKELQTSIESSKVSYSKLIREVEITKTEMESVQSKVERSIKLMESLTGEKE-RWIKNT 3304

Query: 223  EHFRQSNTSVMTTKSGSTGSGLLPPV-KSGAAKKDRSTVITLEKIWTNELSSLFRSVEGA 281
            EHF+  N +++       G+  L  + +S     D+S  + L  IW+N L+      E  
Sbjct: 3305 EHFKDWNKNLI-------GNCFLSSLYESYCGPHDQSLRLKLFTIWSNTLAKFGIEYEPT 3357

Query: 282  QKYI 285
              +I
Sbjct: 3358 YSFI 3361

>Kwal_55.21402
          Length = 516

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 46/100 (46%), Gaps = 10/100 (10%)

Query: 444 SRASTYQENLLQNISMSMHTRSRSGGVNQTAVKLNLVYEELEELSVPVTRMNFGLAIKKL 503
           SR + YQ NL    S+   + +  GG   TAV+L L   +L    + +    +G   K +
Sbjct: 311 SRHTAYQSNLYSRSSLGKRSENSEGGSADTAVRLLLNKHKLPAKKIVLGMPAYGRGFKGV 370

Query: 504 ----HSIENIL----KGITAEAEGE--VMLLNLLRMKCNQ 533
               HS  N++    + ++  +EGE  + L N L +K  Q
Sbjct: 371 SVPHHSEHNVIGQSFQQVSGLSEGESGISLYNQLPLKGGQ 410

>KLLA0E06215g 562140..562781 no similarity, hypothetical start
          Length = 213

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 37/64 (57%), Gaps = 5/64 (7%)

Query: 146 TALEIDHFASNLNHLSQEIEQEIKSNINKSYNELMQVNKELAVASTELKDLRSKVQQLQV 205
           TAL+ID   SN     QE E+EI + I K  +E++Q   +L   + ELK L+   Q+L+ 
Sbjct: 58  TALKID--LSNTESNDQETEKEIMTKIAKVEDEILQCESKLVSLNQELKALQ---QKLRP 112

Query: 206 VMGQ 209
           V+ Q
Sbjct: 113 VINQ 116

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 35/75 (46%), Gaps = 4/75 (5%)

Query: 515 AEAEGEVMLLNLLRMKCNQTRTLITQKLTHVIN----TEYSDANKLESSTKSLILLGMPA 570
           A+ E E++      +  NQ    + QKL  VIN     E S+   L S++    LLG P 
Sbjct: 83  AKVEDEILQCESKLVSLNQELKALQQKLRPVINQNAVDERSENTSLLSASPEKSLLGSPN 142

Query: 571 EALQLFLHNRSNFIQ 585
              +LF  N SN ++
Sbjct: 143 STWKLFKENGSNLLK 157

>YLR361C (YLR361C) [3742] chr12 complement(847387..849123) Member of
           the calcineurin-like phosphoesterase family [1737 bp,
           578 aa]
          Length = 578

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 42/109 (38%), Gaps = 9/109 (8%)

Query: 150 IDHFASNLNHLSQEIEQEIKSNINKSYNELMQVNKELAVASTELKDLRSKVQQLQVVMGQ 209
           +D+F SNL  L+ E    I           M V+      S EL   RS +  + ++ G 
Sbjct: 136 VDYFGSNLEKLNVEAVTGISKYPKDKSLPFMDVSITFEPISIELLQKRSYISDINILFGV 195

Query: 210 FTAMAEKRLLLEKEH----FRQSNTSVMTTKSGSTGSGLLPPVKSGAAK 254
                     L+KE     +R S  + +T K   T      PV +GA +
Sbjct: 196 DCIQPIANWTLQKEFPLVKYRYSEPAYLTYKFVGTR-----PVDTGAQR 239

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.130    0.359 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 21,214,921
Number of extensions: 894673
Number of successful extensions: 3938
Number of sequences better than 10.0: 84
Number of HSP's gapped: 4055
Number of HSP's successfully gapped: 89
Length of query: 684
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 576
Effective length of database: 12,857,365
Effective search space: 7405842240
Effective search space used: 7405842240
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)