Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL320C68266936000.0
Kwal_27.1258069166911631e-150
ACL057W52077760.43
AEL278W476103740.83
YNL027W (CRZ1)67898684.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL320C
         (669 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL320C [1421] [Homologous to NOHBY] (132864..134912) [2049 bp, ...  1391   0.0  
Kwal_27.12580                                                         452   e-150
ACL057W [992] [Homologous to ScYER130C - SH] complement(264934.....    34   0.43 
AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH] complement(...    33   0.83 
YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-depende...    31   4.5  

>ADL320C [1421] [Homologous to NOHBY] (132864..134912) [2049 bp, 682
           aa]
          Length = 682

 Score = 1391 bits (3600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 669/669 (100%), Positives = 669/669 (100%)

Query: 1   MFKKISIDVDIHPLSDKVVLPHEVLANWAGLSTGDVFEQSKPLTLLLTARRQGATGAIGT 60
           MFKKISIDVDIHPLSDKVVLPHEVLANWAGLSTGDVFEQSKPLTLLLTARRQGATGAIGT
Sbjct: 1   MFKKISIDVDIHPLSDKVVLPHEVLANWAGLSTGDVFEQSKPLTLLLTARRQGATGAIGT 60

Query: 61  CVVGIREFSLDDKEAILLPWLVAQRLELGNDLSEVTIEYRVFSELPNGTSMQLEPLGVVF 120
           CVVGIREFSLDDKEAILLPWLVAQRLELGNDLSEVTIEYRVFSELPNGTSMQLEPLGVVF
Sbjct: 61  CVVGIREFSLDDKEAILLPWLVAQRLELGNDLSEVTIEYRVFSELPNGTSMQLEPLGVVF 120

Query: 121 WSRLLAEPGHGMDDSVDAPLPAWLQSDDEHVRAFLEARWNNTLTSVMAGDCLLVSTAENG 180
           WSRLLAEPGHGMDDSVDAPLPAWLQSDDEHVRAFLEARWNNTLTSVMAGDCLLVSTAENG
Sbjct: 121 WSRLLAEPGHGMDDSVDAPLPAWLQSDDEHVRAFLEARWNNTLTSVMAGDCLLVSTAENG 180

Query: 181 AAAEELYKFKVLRLEPAEVVCVVNTDLRLDVVRSVRAPTAAGSEVEHVREVVGQSGRTAT 240
           AAAEELYKFKVLRLEPAEVVCVVNTDLRLDVVRSVRAPTAAGSEVEHVREVVGQSGRTAT
Sbjct: 181 AAAEELYKFKVLRLEPAEVVCVVNTDLRLDVVRSVRAPTAAGSEVEHVREVVGQSGRTAT 240

Query: 241 VQLGDVVHVLPGTNEMYQIDTRGERAVVEILCNDEDESFHIVGGTSDLVTEEFYEITSVA 300
           VQLGDVVHVLPGTNEMYQIDTRGERAVVEILCNDEDESFHIVGGTSDLVTEEFYEITSVA
Sbjct: 241 VQLGDVVHVLPGTNEMYQIDTRGERAVVEILCNDEDESFHIVGGTSDLVTEEFYEITSVA 300

Query: 301 SAAKESHNGKNRGNCIPIDSSIRFLRSCFSSAPKGSTFSFTVRPAAEPSVACITSADEVC 360
           SAAKESHNGKNRGNCIPIDSSIRFLRSCFSSAPKGSTFSFTVRPAAEPSVACITSADEVC
Sbjct: 301 SAAKESHNGKNRGNCIPIDSSIRFLRSCFSSAPKGSTFSFTVRPAAEPSVACITSADEVC 360

Query: 361 CEYCGNCILKDTYMMHELHCQRRTKICDVCGKKYINTRVKPTAHWHCPKQDCGGVGDTEQ 420
           CEYCGNCILKDTYMMHELHCQRRTKICDVCGKKYINTRVKPTAHWHCPKQDCGGVGDTEQ
Sbjct: 361 CEYCGNCILKDTYMMHELHCQRRTKICDVCGKKYINTRVKPTAHWHCPKQDCGGVGDTEQ 420

Query: 421 SHITHDRYCHEEQLCEGCQHSFANAIELGRHKALDCPMSFHYCRFCQLKVLHGESTVESR 480
           SHITHDRYCHEEQLCEGCQHSFANAIELGRHKALDCPMSFHYCRFCQLKVLHGESTVESR
Sbjct: 421 SHITHDRYCHEEQLCEGCQHSFANAIELGRHKALDCPMSFHYCRFCQLKVLHGESTVESR 480

Query: 481 YFGLSGHEYHCGVKTVDCYKCQKPVRRLELASHLALHDHERKVRGKNTLILLCGNVNCRR 540
           YFGLSGHEYHCGVKTVDCYKCQKPVRRLELASHLALHDHERKVRGKNTLILLCGNVNCRR
Sbjct: 481 YFGLSGHEYHCGVKTVDCYKCQKPVRRLELASHLALHDHERKVRGKNTLILLCGNVNCRR 540

Query: 541 AVSSFSNDHNLCDTCFGPFYSTEEDLNGKRFRIRLERRYFIQMSRGCGSTYCKNSACISS 600
           AVSSFSNDHNLCDTCFGPFYSTEEDLNGKRFRIRLERRYFIQMSRGCGSTYCKNSACISS
Sbjct: 541 AVSSFSNDHNLCDTCFGPFYSTEEDLNGKRFRIRLERRYFIQMSRGCGSTYCKNSACISS 600

Query: 601 GLASFPDTLSLMKYVQQLLLETDYYLCVDEATTRRKLLADTFLEVSDAYASPWVYRAVDT 660
           GLASFPDTLSLMKYVQQLLLETDYYLCVDEATTRRKLLADTFLEVSDAYASPWVYRAVDT
Sbjct: 601 GLASFPDTLSLMKYVQQLLLETDYYLCVDEATTRRKLLADTFLEVSDAYASPWVYRAVDT 660

Query: 661 GAKDVASVE 669
           GAKDVASVE
Sbjct: 661 GAKDVASVE 669

>Kwal_27.12580
          Length = 691

 Score =  452 bits (1163), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 242/669 (36%), Positives = 372/669 (55%), Gaps = 14/669 (2%)

Query: 1   MFKKISIDVDIHPLSDKVVLPHEVLANWAGLSTGDVFEQSKPLTLLLTARRQGATGA--I 58
           M  KI++DV  +P SDK++LP  +L     +S G  F  S+ + L L A  +   G    
Sbjct: 1   MLSKITVDVTKNPFSDKIILPQAILNRL--ISDGFDFTTSRSIFLQLRAYEETENGTKEC 58

Query: 59  GTCVVGIREFSLDDKEAILLPWLVAQRLELGNDLSE--VTIEYRVFSELPNGTSMQLEPL 116
              VVG+REF+LDD ++++LPW VA R+ + + +    + I+    + +P+G  + LEPL
Sbjct: 59  ANAVVGVREFALDDPDSVILPWSVAFRMNILDKVHAGMILIDASPDTSIPDGKHISLEPL 118

Query: 117 GVVFWSRLLAEPGHGMDDS-VDAPLPAWLQSDDEHVRAFLEARWNNTLTSVMAGDCLLVS 175
           G + W  +   P   M++S VD P P  +  D+  ++ FLEAR NNT+TS+   + +++ 
Sbjct: 119 GKIRWQNIHDCPNEYMNNSNVDEPFPIRVVHDEFFIKNFLEARLNNTVTSISEDEYIILP 178

Query: 176 TAENGAAAEELYKFKVLRLEPAEVVCVVNTDLRLDVVRSVRA-PTAAGSEVEHVREV-VG 233
           T  NG  +EELYKFKV ++ P + V ++NTD+ L+V+ +++  PT+   + +  +   + 
Sbjct: 179 TQPNGETSEELYKFKVEKVTPGKTVSLINTDVELEVLHTLKKLPTSIPQQSDTDKAADID 238

Query: 234 QSGRTATVQLGDVVHVLPGTNEMYQIDTRGERAVVEILCNDEDESFHIVGGTSDLVTEEF 293
                  +Q  +V+ V P           G    + IL ND DES  +     + V+ + 
Sbjct: 239 TQCELVEIQENEVITVTPTGRPTIYTHEGGPNLKLNILENDLDESGQVFLCRDEAVSSDH 298

Query: 294 YEITSVASAAKESHNGKNRGNCIPIDSSIRFLRSCFSSAPKGSTFSFTVRPAAEPSVACI 353
           Y ++++ S +     GKN G    + S   F + CF      +   F +   ++ +   I
Sbjct: 299 YLLSTLDSPSLVLQEGKNVGAATALPSDKLFYKVCFEDTAPNTKVKFVIEQNSKDTSEDI 358

Query: 354 TSADEVCCEYCGNCILKDTYMMHELHCQRRTKICDVCGKKYINTRVKPTAHWHCPKQDCG 413
           TS  + C  +CG  + K+ + +HEL C R  K+C  C KKY N+   P  HWHC +    
Sbjct: 359 TSGKQKC-PHCGTVVSKEAFFLHELRCSRMLKVCHTCSKKYFNSGGIPDDHWHCNEGHSM 417

Query: 414 GVGDTEQSHITHDRYCHEEQLCEGCQHSFANAIELGRHKALDCPMSFHYCRFCQLKVLHG 473
             GDT  S+  H  Y H+++ C  C   F N   + +H+  DC    H CR+C L V  G
Sbjct: 418 SFGDTVHSYERHMNYFHKQKSCPECGVQFPNNNLMAKHRHDDCRFGLHCCRYCHLSVPRG 477

Query: 474 ESTVESRYFGLSGHEYHCGVKTVDCYKCQKPVRRLELASHLALHDHERKVRGKNTLILLC 533
           + TVESR+FG+S HE  CG+KT +CYKC + VRR++L SHL  H  E++   K+  I LC
Sbjct: 478 DPTVESRHFGISSHELSCGLKTTECYKCLRIVRRIDLNSHLEFHRLEKEANAKSLHINLC 537

Query: 534 GNVNCRRAVSSFSNDHNLCDTCFGPFYSTEEDLNGKRFRIRLERRYFIQMSRGCGSTYCK 593
            N NC R +        LCD+C+GPFYS E+DL GK+F  +L R+Y IQ+SRGCGST+CK
Sbjct: 538 RNTNCCRTLGEVGRSTGLCDSCYGPFYSPEDDLYGKKFLKKLGRKYVIQLSRGCGSTFCK 597

Query: 594 NSACISSGLASFPDTLSLMKYVQQLLLETD---YYLCVDEATTRRKLLADTFLEVSDA-Y 649
           N  C SSGL++  +   +M +V Q +       Y++CVDEATT++K++AD ++EV+   Y
Sbjct: 598 NPKCKSSGLSNPSNMQDIMTFVDQNVESFPPQVYWICVDEATTKKKMVADFYIEVNGGKY 657

Query: 650 ASPWVYRAV 658
           +  WVY  V
Sbjct: 658 SKEWVYLGV 666

>ACL057W [992] [Homologous to ScYER130C - SH]
           complement(264934..266496) [1563 bp, 520 aa]
          Length = 520

 Score = 33.9 bits (76), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 31/77 (40%), Gaps = 9/77 (11%)

Query: 327 SCFSSAPKGSTFSFTVRPAAEPSV------ACITSADEVCCEYCGNCILKDTYM---MHE 377
           S FSSAP       T + A  P          + +     CEYC     +  ++   +  
Sbjct: 422 SSFSSAPDPLDPGITKKRAGMPKTRGRKPSPALDATKPFGCEYCERRFKRQEHLKRHIRS 481

Query: 378 LHCQRRTKICDVCGKKY 394
           LH   +   CD+CGKK+
Sbjct: 482 LHMGEKPYGCDICGKKF 498

>AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH]
           complement(117043..118473) [1431 bp, 476 aa]
          Length = 476

 Score = 33.1 bits (74), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 40/103 (38%), Gaps = 11/103 (10%)

Query: 361 CEYCGNCILKDTYMMHELHCQRRTK--ICDVCGKKYINTR-------VKPTAHWHCPKQD 411
           CE CG    K +++   L     TK   C VCGK  + TR       +  T  + CP + 
Sbjct: 152 CEQCGRGFTKKSHLERHLFSHSETKPFSCTVCGKG-VTTRQQLRRHEITHTKSFKCPHEG 210

Query: 412 CGGVGDTEQSHITHDRYCHEEQL-CEGCQHSFANAIELGRHKA 453
           CG          +H    HE++L C  C   F     L  H A
Sbjct: 211 CGEAFYKHPQLRSHVLAVHEQKLTCTHCDKRFQRPYRLKTHIA 253

>YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-dependent
           transcription factor, regulates gene expression
           downstream of calcineurin in response to multiple
           environmental signals, has two C2H2-type zinc finger
           domains [2037 bp, 678 aa]
          Length = 678

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 36/98 (36%), Gaps = 21/98 (21%)

Query: 360 CCEYCGNCILKDTYMMHEL--HCQRRTKICDVCGKKYINTRVKPTAHWHCPKQDCGGVGD 417
            C+ CG    +   +   L  H   R  IC +CGK +        A  H  K+       
Sbjct: 570 ACDVCGKKFTRPYNLKSHLRTHTNERPFICSICGKAF--------ARQHDRKR------- 614

Query: 418 TEQSHITHDRYCHEEQLCE----GCQHSFANAIELGRH 451
            E  H    RY    +L +    GC   FA +  LGRH
Sbjct: 615 HEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRH 652

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.135    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 21,700,201
Number of extensions: 919746
Number of successful extensions: 1983
Number of sequences better than 10.0: 11
Number of HSP's gapped: 2040
Number of HSP's successfully gapped: 11
Length of query: 669
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 561
Effective length of database: 12,857,365
Effective search space: 7212981765
Effective search space used: 7212981765
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)