Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL285C64463234000.0
Kwal_23.346466863819520.0
YGL144C (ROG1)68565818360.0
KLLA0E14872g67763517910.0
CAGL0E04950g67364117810.0
Scas_669.1469065117310.0
Scas_613.1462863714140.0
YDL109C64758414110.0
CAGL0H10340g5925949001e-113
AER322C6366228321e-102
KLLA0B01375g6406317903e-96
Kwal_47.184826236247562e-91
CAGL0M10043g6584366141e-70
YDR444W6874256152e-70
Scas_717.506584255871e-66
AFR386C5042132004e-16
Kwal_55.217034413041843e-14
KLLA0F16423g4592141764e-13
KLLA0F16709g5312081738e-13
YOR059C4502341729e-13
CAGL0L10318g4572151612e-11
Kwal_27.101022582161562e-11
Sklu_2393.45462161561e-10
Sklu_2232.44452171523e-10
ADR202C4432191523e-10
Scas_698.394712281514e-10
KLLA0B07667g199991810.12
Scas_641.559338684.4
Kwal_47.1851262538667.4
CAGL0F04873g693114667.8
Scas_663.860456658.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL285C
         (632 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL285C [1456] [Homologous to ScYGL144C - SH; ScYDL109C - SH] (2...  1314   0.0  
Kwal_23.3464                                                          756   0.0  
YGL144C (ROG1) [1843] chr7 complement(232453..234510) Protein of...   711   0.0  
KLLA0E14872g 1326334..1328367 similar to sp|P53118 Saccharomyces...   694   0.0  
CAGL0E04950g 478626..480647 similar to sp|P53118 Saccharomyces c...   690   0.0  
Scas_669.14                                                           671   0.0  
Scas_613.14                                                           549   0.0  
YDL109C (YDL109C) [760] chr4 complement(265258..267201) Protein ...   548   0.0  
CAGL0H10340g 1007564..1009342 similar to sp|P53118 Saccharomyces...   351   e-113
AER322C [2823] [Homologous to ScYDR444W - SH] (1229579..1231489)...   325   e-102
KLLA0B01375g 110709..112631 similar to sgd|S0002852 Saccharomyce...   308   3e-96
Kwal_47.18482                                                         295   2e-91
CAGL0M10043g complement(999113..1001089) similar to tr|Q04093 Sa...   241   1e-70
YDR444W (YDR444W) [1264] chr4 (1350278..1352341) Protein of unkn...   241   2e-70
Scas_717.50                                                           230   1e-66
AFR386C [3578] [Homologous to NOHBY] (1131324..1132838) [1515 bp...    82   4e-16
Kwal_55.21703                                                          75   3e-14
KLLA0F16423g complement(1516717..1518096) similar to sgd|S000558...    72   4e-13
KLLA0F16709g 1539612..1541207 weakly similar to ca|CA1159|IPF134...    71   8e-13
YOR059C (YOR059C) [4867] chr15 complement(438907..440259) Protei...    71   9e-13
CAGL0L10318g complement(1103690..1105063) similar to tr|Q08448 S...    67   2e-11
Kwal_27.10102                                                          65   2e-11
Sklu_2393.4 , Contig c2393 3530-5170 reverse complement                65   1e-10
Sklu_2232.4 YOR059C, Contig c2232 3289-4626                            63   3e-10
ADR202C [1943] [Homologous to ScYOR059C - SH] (1060157..1061488)...    63   3e-10
Scas_698.39                                                            63   4e-10
KLLA0B07667g 667863..673862 weakly similar to sp|P25356 Saccharo...    36   0.12 
Scas_641.5                                                             31   4.4  
Kwal_47.18512                                                          30   7.4  
CAGL0F04873g 491732..493813 similar to sp|P32486 Saccharomyces c...    30   7.8  
Scas_663.8                                                             30   8.9  

>ADL285C [1456] [Homologous to ScYGL144C - SH; ScYDL109C - SH]
           (201714..203648) [1935 bp, 644 aa]
          Length = 644

 Score = 1314 bits (3400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 632/632 (100%), Positives = 632/632 (100%)

Query: 1   MGTEPAREVLYHYRSSVRIGEVERYVITYDLYDEEELPERIQLSSLWLKVKNVSSLTYRA 60
           MGTEPAREVLYHYRSSVRIGEVERYVITYDLYDEEELPERIQLSSLWLKVKNVSSLTYRA
Sbjct: 1   MGTEPAREVLYHYRSSVRIGEVERYVITYDLYDEEELPERIQLSSLWLKVKNVSSLTYRA 60

Query: 61  AYLMGPYMLYCDLRTEDYHHSQKLFSSADMPQFEPAMQPQHEFLAELSLHRLQKRYVWLL 120
           AYLMGPYMLYCDLRTEDYHHSQKLFSSADMPQFEPAMQPQHEFLAELSLHRLQKRYVWLL
Sbjct: 61  AYLMGPYMLYCDLRTEDYHHSQKLFSSADMPQFEPAMQPQHEFLAELSLHRLQKRYVWLL 120

Query: 121 DVVSQIIFTTNSVVPFEVTIASAKPALEDTATLAPQAGSFNRRLTVNRQTTLDLWNLPQQ 180
           DVVSQIIFTTNSVVPFEVTIASAKPALEDTATLAPQAGSFNRRLTVNRQTTLDLWNLPQQ
Sbjct: 121 DVVSQIIFTTNSVVPFEVTIASAKPALEDTATLAPQAGSFNRRLTVNRQTTLDLWNLPQQ 180

Query: 181 VFDDYTKPEHLVVLTHGLHSNVTADMQYLKETIEQCQQYYPNEHIVVKGFGDNVCKTEKG 240
           VFDDYTKPEHLVVLTHGLHSNVTADMQYLKETIEQCQQYYPNEHIVVKGFGDNVCKTEKG
Sbjct: 181 VFDDYTKPEHLVVLTHGLHSNVTADMQYLKETIEQCQQYYPNEHIVVKGFGDNVCKTEKG 240

Query: 241 IKYLGGRLGEYIVKQLYNERIKRISFIGHSLGGLTQTFAIAYIAINYPWFFEKVDPVNFV 300
           IKYLGGRLGEYIVKQLYNERIKRISFIGHSLGGLTQTFAIAYIAINYPWFFEKVDPVNFV
Sbjct: 241 IKYLGGRLGEYIVKQLYNERIKRISFIGHSLGGLTQTFAIAYIAINYPWFFEKVDPVNFV 300

Query: 301 ALSSPLLGIVTNNPAYVNILLSMGVVGKTGQDLGLQAHQGDDQPLLCSLPGHTTRRILRK 360
           ALSSPLLGIVTNNPAYVNILLSMGVVGKTGQDLGLQAHQGDDQPLLCSLPGHTTRRILRK
Sbjct: 301 ALSSPLLGIVTNNPAYVNILLSMGVVGKTGQDLGLQAHQGDDQPLLCSLPGHTTRRILRK 360

Query: 361 FKKRTLYANAVNDGIVPLYTSALLYLDYDSILKQLDTQEYQVDKQDFFTKTLINPLVKAI 420
           FKKRTLYANAVNDGIVPLYTSALLYLDYDSILKQLDTQEYQVDKQDFFTKTLINPLVKAI
Sbjct: 361 FKKRTLYANAVNDGIVPLYTSALLYLDYDSILKQLDTQEYQVDKQDFFTKTLINPLVKAI 420

Query: 421 NVLMPQTQSSSSIPKVSMFDSAMSVLLPPLPEKSYLMNPSGDPSVILHDKMYSEADIPEV 480
           NVLMPQTQSSSSIPKVSMFDSAMSVLLPPLPEKSYLMNPSGDPSVILHDKMYSEADIPEV
Sbjct: 421 NVLMPQTQSSSSIPKVSMFDSAMSVLLPPLPEKSYLMNPSGDPSVILHDKMYSEADIPEV 480

Query: 481 GQPPEKNIWSSLLLNIGNNEEYKQLEEEIAKKWHKGMTWRKVIVHLKPDAHNNIIVRRRF 540
           GQPPEKNIWSSLLLNIGNNEEYKQLEEEIAKKWHKGMTWRKVIVHLKPDAHNNIIVRRRF
Sbjct: 481 GQPPEKNIWSSLLLNIGNNEEYKQLEEEIAKKWHKGMTWRKVIVHLKPDAHNNIIVRRRF 540

Query: 541 ANAYGWPVIDHLVQNHFNGSDYPYTEGETEEAALDELIEQEKKWINRPHNETFFDVGPTG 600
           ANAYGWPVIDHLVQNHFNGSDYPYTEGETEEAALDELIEQEKKWINRPHNETFFDVGPTG
Sbjct: 541 ANAYGWPVIDHLVQNHFNGSDYPYTEGETEEAALDELIEQEKKWINRPHNETFFDVGPTG 600

Query: 601 MISSVGEILENIKNSAFQKTASASSLKPSDSF 632
           MISSVGEILENIKNSAFQKTASASSLKPSDSF
Sbjct: 601 MISSVGEILENIKNSAFQKTASASSLKPSDSF 632

>Kwal_23.3464
          Length = 668

 Score =  756 bits (1952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/638 (56%), Positives = 475/638 (74%), Gaps = 36/638 (5%)

Query: 9   VLYHYRSSVRIGEVERYVITYDLYDEEE-LPERIQLSSLWLKVKNVSSLTYRAAYLMGPY 67
           V+YH +SSV++GE+ERY+I+Y LYD++E LP  + L+SLWLKV+N+ S T+RAAYLMGPY
Sbjct: 6   VVYHAKSSVKVGEMERYIISYQLYDDDEGLPADLNLNSLWLKVRNIESFTFRAAYLMGPY 65

Query: 68  MLYCDLRTEDYHHSQKLFSSADMPQFEPAMQPQHEFLAELSLHRLQKRYVWLLDVVSQII 127
           +LYCD+R  DYHHSQ+LF SAD P FEP +QPQ +F+ ELSLH L+K YVW++DVVSQII
Sbjct: 66  LLYCDVRASDYHHSQRLFVSADQPTFEPTLQPQQDFITELSLHNLKKTYVWVVDVVSQII 125

Query: 128 FTTNSVVPFEVTIASAKPALEDTATLAPQAGSFNRRLTVNRQTTLDLWNLPQQVFDDYTK 187
           FTT + V FEV++ +++  L  ++  +P +GS   +L V R T+LDLWNLP Q+     +
Sbjct: 126 FTTTTQVGFEVSVGTSRKCLAKSSEFSPVSGSLESKLNVTRLTSLDLWNLPVQLSTHTHQ 185

Query: 188 PEHLVVLTHGLHSNVTADMQYLKETIEQCQQYYPNEHIVVKGFGDNVCKTEKGIKYLGGR 247
            EHLV+LTHGLHSNV ADM YLKE IE+CQ+YYP E IVVKGF  NVCKTEKGI YLG R
Sbjct: 186 KEHLVILTHGLHSNVHADMFYLKEQIEKCQKYYPEEQIVVKGFNGNVCKTEKGINYLGTR 245

Query: 248 LGEYIVKQLYNERIKRISFIGHSLGGLTQTFAIAYIAINYPWFFEKVDPVNFVALSSPLL 307
           L EYIVK+LY+ER+K+ISFIGHSLGGL QTFAIAYI + YPWFF+ V P+NF+ L++PLL
Sbjct: 246 LAEYIVKELYHERVKKISFIGHSLGGLVQTFAIAYIHVKYPWFFQNVSPINFITLATPLL 305

Query: 308 GIVTNNPAYVNILLSMGVVGKTGQDLGLQAHQGDDQPLLCSLPGHTTRRILRKFKKRTLY 367
           GIVT+NPAYVNILLS G+VGKTGQDLGL     D +PLL  LPG  T+ +LR FK+RT+Y
Sbjct: 306 GIVTDNPAYVNILLSFGIVGKTGQDLGLTELSKDGKPLLYLLPGKPTKTVLRMFKRRTIY 365

Query: 368 ANAVNDGIVPLYTSALLYLDYDSILKQLDTQEYQVDK------QDFFTKTLINPLVKAIN 421
           ANAVNDGIVPLY+++LL+LDY+ +L QL T+    ++       DF ++  ++P+ KAI+
Sbjct: 366 ANAVNDGIVPLYSASLLFLDYEDVLGQLKTKPELRERLSSNTSSDFISRNFLSPISKAIS 425

Query: 422 VLMPQT---QSSSSIPKVSMFDSAMSVLLPPLPEKSYLMNPSGDPSVILHDKMYSEADIP 478
              PQ      S  IPKVS+ +SA SVL+PPLPEK+Y+MNPS   ++I+HDK+Y + ++P
Sbjct: 426 FWAPQKFPDDGSLKIPKVSVIESATSVLIPPLPEKTYIMNPSSRENIIIHDKIYCDQEVP 485

Query: 479 EVGQPPEKNIWSS---LL--LNIGNNEEYKQLEEEIAKKWHKGMTWRKVIVHLKPDAHNN 533
                 EK +  S   LL      + ++ ++LEEEIA++WH+G++WRKV+V LKPDAHNN
Sbjct: 486 PRESQSEKELLESNNTLLKAFTRSSGKDNRRLEEEIARRWHEGISWRKVVVGLKPDAHNN 545

Query: 534 IIVRRRFANAYGWPVIDHLVQNHFNGSDYPYTEGETEEAALDELI--------------E 579
           IIVRRRF+NAYGWPV+DHL QNHFN  D      E+EE  +D ++              +
Sbjct: 546 IIVRRRFSNAYGWPVVDHLTQNHFNSMD-----DESEE--MDSMVTNSVKSDQTSPEDHK 598

Query: 580 QEKKWINRPHNETFFDVGPTGMISSVGEILENIKNSAF 617
           +++ W+     ET FDVGPTGMIS+VGEIL+++  ++F
Sbjct: 599 EDRSWMFDNGKETMFDVGPTGMISTVGEILDSMAKNSF 636

>YGL144C (ROG1) [1843] chr7 complement(232453..234510) Protein of
           unknown function, has high similarity to uncharacterized
           S. cerevisiae Ydl109p [2058 bp, 685 aa]
          Length = 685

 Score =  711 bits (1836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/658 (54%), Positives = 470/658 (71%), Gaps = 43/658 (6%)

Query: 1   MGTEPAREVLYHYRSSVRIGEVERYVITYDLYDEEELPERIQLSSLWLKVKNVSSLTYRA 60
           M   P  E+L+HY+SSV++GE+ERYVITY LYD EE+P  + L+SLWLKV+N++ L+YRA
Sbjct: 1   MSLTPTNEILFHYKSSVKVGELERYVITYHLYDGEEIPPDLNLNSLWLKVRNMNPLSYRA 60

Query: 61  AYLMGPYMLYCDLRTEDYHHSQKLFSSADMPQFEPAMQPQHEFLAELSLHRLQKRYVWLL 120
           AYLMGP+MLYCD++T  YHHSQK+ +S D P+FEP +Q Q +F+AELS+H ++++YVW+ 
Sbjct: 61  AYLMGPFMLYCDVKTAQYHHSQKIVASVDYPKFEPNVQTQQDFVAELSVHNIRQKYVWIA 120

Query: 121 DVVSQIIFTTNSVVPFEVTIASAKPALEDTATLAPQAGSFNRRLTVNRQTTLDLWNLPQQ 180
           DV+SQI+FTTN+ V +EVTI ++K ++E+   L    GS++ +LTVNR TTLDLWNLP Q
Sbjct: 121 DVMSQILFTTNTNVTYEVTIGTSKESVENPHDLPSHLGSYSPKLTVNRLTTLDLWNLPVQ 180

Query: 181 VFDDYTKPEHLVVLTHGLHSNVTADMQYLKETIEQCQQYYPNEHIVVKGFGDNVCKTEKG 240
           +     K +HLVVLTHGLHSNV+ D+ Y+ E I + Q+ YP+E IVVKG+  NVC+TEKG
Sbjct: 181 ITTP-QKKKHLVVLTHGLHSNVSTDLVYIMEQIYKAQKNYPHEQIVVKGYRGNVCQTEKG 239

Query: 241 IKYLGGRLGEYIVKQLYNERIKRISFIGHSLGGLTQTFAIAYIAINYPWFFEKVDPVNFV 300
           +KYLG RL EYI++ LY+E I++ISF+GHSLGGL Q FAIAYI   YPWFF+KV+P+NF+
Sbjct: 240 VKYLGTRLAEYIIQDLYDESIRKISFVGHSLGGLIQAFAIAYIYEVYPWFFKKVNPINFI 299

Query: 301 ALSSPLLGIVTNNPAYVNILLSMGVVGKTGQDLGLQAHQGDDQPLLCSLPGHTTRRILRK 360
            L+SPLLGIVT+NPAY+ +LLS GV+GKTGQDLGL+      +PLL  L G     ILR+
Sbjct: 300 TLASPLLGIVTDNPAYIKVLLSFGVIGKTGQDLGLENDVEVGKPLLYLLSGLPLIEILRR 359

Query: 361 FKKRTLYANAVNDGIVPLYTSALLYLDYDSILKQLDTQEYQVDK------------QDFF 408
           FK+RT+YANA+NDGIVPLYT++LL+LDY+ IL+QL   +    K            QDFF
Sbjct: 360 FKRRTVYANAINDGIVPLYTASLLFLDYNDILEQLQKLKENSKKSPLINDASTPVNQDFF 419

Query: 409 TKTLINPLVKAINVLMPQ---TQSSSSIPKVSMFDSAMSVLLPPLPEKSYLMNPSGDPSV 465
            KT I+PL K +++L PQ   T++ S IPKVS F+SA S+LLPPLPE++Y+M+P     V
Sbjct: 420 NKTFISPLTKMLSILAPQKFPTENGSEIPKVSFFESASSILLPPLPERAYIMDPDSRDPV 479

Query: 466 ILHDKMYSEADIP------EVGQPPEKNI-WSSLLLNIGNNEEYKQLEEEIAKKWHKGMT 518
           I+HDK+Y+E DIP      E G   +KNI   +         +Y+ LEE IA++WH+GM 
Sbjct: 480 IIHDKIYNEDDIPQSEFDIEDGFFGKKNILLQAFFAGKKERAKYRNLEETIARRWHEGMA 539

Query: 519 WRKVIVHLKPDAHNNIIVRRRFANAYGWPVIDHLVQNHFNGSDY---------------- 562
           WRKV+V LKPDAHNNIIVRR+FANAYGWPVIDHL+  HFNG D                 
Sbjct: 540 WRKVVVALKPDAHNNIIVRRKFANAYGWPVIDHLIDVHFNGDDDDDNDENDDINSTQVVE 599

Query: 563 ---PYTEGETEEAALDELIEQEKKWINRPHNETFFDVGPTGMISSVGEILENIKNSAF 617
                TEG+ +     E I QE  W+N+      FD GPTGMIS+VGEI+E +    F
Sbjct: 600 PIQSVTEGKKKYRKA-ENIPQEYGWLNKVETNGVFDEGPTGMISTVGEIVEALAKRGF 656

>KLLA0E14872g 1326334..1328367 similar to sp|P53118 Saccharomyces
           cerevisiae YGL144c, start by similarity
          Length = 677

 Score =  694 bits (1791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/635 (53%), Positives = 457/635 (71%), Gaps = 23/635 (3%)

Query: 3   TEPAREVLYHYRSSVRIGEVERYVITYDLYDEEELPERIQLSSLWLKVKNVSSLTYRAAY 62
           T    +++YH++SS+RIGE+ERY+ TYDLY  +E+P  + L SLWLK+KN+ ++T RAAY
Sbjct: 28  TASDHDIMYHFQSSLRIGELERYIFTYDLYMGDEIPSDLTLDSLWLKIKNIENVTLRAAY 87

Query: 63  LMGPYMLYCDLRTEDYHHSQKLFSSADMPQFEPAMQPQHEFLAELSLHRLQKRYVWLLDV 122
           LMGPY+LY D+RT+DYHH Q+LF SAD PQFE  +QPQ +F+AELSLH L+KRYVW++D+
Sbjct: 88  LMGPYVLYADVRTKDYHHKQRLFISADQPQFESNIQPQQDFIAELSLHNLKKRYVWIVDI 147

Query: 123 VSQIIFTTNSVVPFEVTIASAKPALEDTATLAPQAGSFNRRLTVNRQTTLDLWN---LPQ 179
            SQI+FT  + + F +T+  +K ++   +    Q G  + R+ V+R TT DLWN   L +
Sbjct: 148 ASQILFTKQASINFSITVGGSKESISVDSARNIQLGVQSSRMKVDRLTTADLWNASLLSK 207

Query: 180 QVFDDYTKPEHLVVLTHGLHSNVTADMQYLKETIEQCQQYYPNEHIVVKGFGDNVCKTEK 239
            VF    + EHLV+LTHGLHSNVT+D+ Y+KE IE+ Q  +  E +VVKGF DNVCKTEK
Sbjct: 208 SVFG--RRKEHLVILTHGLHSNVTSDLFYIKEQIEKTQNQH-EEMLVVKGFTDNVCKTEK 264

Query: 240 GIKYLGGRLGEYIVKQLYNERIKRISFIGHSLGGLTQTFAIAYIAINYPWFFEKVDPVNF 299
           GIK+LG RL E+IV  LYN+   +ISFIGHSLGGL Q+FAIAYI+ NYP FFE+V+PVNF
Sbjct: 265 GIKWLGTRLAEHIVHNLYNDATVKISFIGHSLGGLVQSFAIAYISYNYPKFFEQVEPVNF 324

Query: 300 VALSSPLLGIVTNNPAYVNILLSMGVVGKTGQDLGLQAHQGDDQPLLCSLPGHTT-RRIL 358
           + ++SP+LGIV++N  Y+  LL+MG+ GKTGQDL LQ + G  QPLL +L   +  RRIL
Sbjct: 325 ITMASPMLGIVSDNAVYIQRLLAMGIAGKTGQDLSLQTYNGLKQPLLQTLSSSSALRRIL 384

Query: 359 RKFKKRTLYANAVNDGIVPLYTSALLYLDYDSILKQL--DTQEYQVDKQDFFTKTLINPL 416
           + FK  T+YANA NDGIVPLYTSALL+LDYD IL +L  +T++ Q    DFF +  I+PL
Sbjct: 385 KCFKSCTVYANACNDGIVPLYTSALLFLDYDDILDKLNMNTEDLQT---DFFQRNFISPL 441

Query: 417 VKAINVLMPQ--TQSSSSIPKVSMFDSAMSVLLPPLPEKSYLMNPSGDPSVILHDKMYSE 474
            KA+++LMPQ  +Q+ + IP  SM DSA SVL+PPLP+KSY+ +P     V++HDK+YS 
Sbjct: 442 TKAMDILMPQRVSQNGTKIPVASMLDSAYSVLIPPLPDKSYITDPKTRKDVVVHDKVYSG 501

Query: 475 ADIPEVGQPPEKNIW--SSLLL---NIGNNEEYKQLEEEIAKKWHKGMTWRKVIVHLKPD 529
            DIP+     +  +   S++LL   NI    +YK+LEE+IA+ WHK + WRKVI++LKPD
Sbjct: 502 QDIPDHQSNSQLEVMNSSNVLLKTFNIAFGGQYKKLEEQIARNWHKDVKWRKVIINLKPD 561

Query: 530 AHNNIIVRRRFANAYGWPVIDHLVQNHFNGSDYPYTEGETEEAALDELIEQEKKWINRPH 589
           AHNNII RRRF+NAYGWPV+DHL + HF   D      + +  + DE  +    WI +P 
Sbjct: 562 AHNNIITRRRFSNAYGWPVVDHLTETHFLNDDKSSRSWKLDPISKDEDFD----WIVKPT 617

Query: 590 NETFFDVGPTGMISSVGEILENIKNSAFQKTASAS 624
            ++ FDVGPTGMI + GE+LEN+K S  +    ++
Sbjct: 618 VDSVFDVGPTGMICTFGEMLENLKTSTLEGMTEST 652

>CAGL0E04950g 478626..480647 similar to sp|P53118 Saccharomyces
           cerevisiae YGL144c or tr|Q12103 Saccharomyces cerevisiae
           YDL109c, hypothetical start
          Length = 673

 Score =  690 bits (1781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/641 (51%), Positives = 458/641 (71%), Gaps = 26/641 (4%)

Query: 7   REVLYHYRSSVRIGEVERYVITYDLYDEEELPERIQLSSLWLKVKNVSSLTYRAAYLMGP 66
           +++LYHYRSSV++GE+ERY+I Y LY+++E+P+ ++L SL++++KN S L++RA YL GP
Sbjct: 8   KDILYHYRSSVKVGEIERYLIEYILYEDDEIPDDLKLDSLYVRLKNCSPLSFRAGYLAGP 67

Query: 67  YMLYCDLRTEDYHHSQKLFSSADMPQFEPAMQPQHEFLAELSLHRLQKRYVWLLDVVSQI 126
           ++LY D+R+ +YHHSQ + SSAD PQFE  +Q Q   + ELSLH +Q +YVW+LDVVSQI
Sbjct: 68  FILYGDVRSNNYHHSQHIVSSADYPQFEANLQAQQVKVMELSLHNIQSKYVWILDVVSQI 127

Query: 127 IFTTNSVVPFEVTIASAKPALEDTATLA--PQAGSFNRRLTVNRQTTLDLWNLPQQVFDD 184
           +FTTN+ VPFEVT+   +  LE+   +   P  GS +  L V+R TT DLW LP+++   
Sbjct: 128 LFTTNTNVPFEVTVGMDRKMLEENNEIECLPHLGSTSNNLIVSRLTTDDLWKLPRELAPK 187

Query: 185 YTKPEHLVVLTHGLHSNVTADMQYLKETIEQCQQYYPNEHIVVKGFGDNVCKTEKGIKYL 244
               +HLV+LTHGLHSNV+AD+ YL E I + Q  +PNE ++V G+ DNVC+TEKG++YL
Sbjct: 188 -KDIKHLVILTHGLHSNVSADLSYLMEEIYKSQANFPNEILIVDGYFDNVCETEKGVRYL 246

Query: 245 GGRLGEYIVKQLYNERIKRISFIGHSLGGLTQTFAIAYIAINYPWFFEKVDPVNFVALSS 304
           G RL +YI+  LY+  +K+ISF+GHSLGGL QTFAI  +A  YPWFF+KV PVNF+ ++S
Sbjct: 247 GTRLADYIIDNLYDADVKKISFVGHSLGGLVQTFAIGNLAARYPWFFDKVKPVNFITIAS 306

Query: 305 PLLGIVTNNPAYVNILLSMGVVGKTGQDLGLQAHQGDDQPLLCSLPGHTTRRILRKFKKR 364
           P+LGIVT+NPAY+N+LLS GVVG+TG+DL L     D++PLL SL G   R ILRKF++R
Sbjct: 307 PMLGIVTDNPAYINLLLSFGVVGRTGKDLNLDVDLPDEKPLLYSLSGEFIRSILRKFERR 366

Query: 365 TLYANAVNDGIVPLYTSALLYLDYDSILKQLDTQEYQ-----------VDKQDFFTKTLI 413
           T+YANAVNDGIVPLYTS LLYLDYD+ILK+L  +E              D   FF K  I
Sbjct: 367 TIYANAVNDGIVPLYTSGLLYLDYDAILKKLREKEENKSLSGPNNITVSDNTAFFNKNFI 426

Query: 414 NPLVKAINVLMPQT--QSSSSIPKVSMFDSAMSVLLPPLPEKSYLMNPSGDPSVILHDKM 471
           +PL K +++  PQ   +S   IPKVS F SA S+LLPPLP+ ++++NP     +I+HDK+
Sbjct: 427 SPLTKMLSLWAPQKFPESDPKIPKVSFFQSAASILLPPLPDINFIVNPKHRNDIIIHDKI 486

Query: 472 YSEADIPEVGQPPE------KNIWSSLLLNIGNNE-EYKQLEEEIAKKWHKGMTWRKVIV 524
           Y+E DI +V + P+      KNI+   L  + + + +Y++LE+ IA +WHKG++WRKVIV
Sbjct: 487 YTEEDIKDVEKDPDSSFFNNKNIFLQALSTVTSEKTKYQELEKTIAIRWHKGLSWRKVIV 546

Query: 525 HLKPDAHNNIIVRRRFANAYGWPVIDHLVQNHFNGSDYPYTEGETEEAALDELIEQEKKW 584
            LKPDAHNNIIVRRRF+NAYGWPVIDHL+  HF+G ++   E ++++        ++  W
Sbjct: 547 ALKPDAHNNIIVRRRFSNAYGWPVIDHLISEHFSGENF---EMDSQKDVSITTTREDLNW 603

Query: 585 INRPHNETFFDVGPTGMISSVGEILENIKNSAFQKTASASS 625
           I RP  +  F  GPTGMIS+VGEI+E+     F     A++
Sbjct: 604 IKRPDEDGLFKEGPTGMISTVGEIVESFAKKRFSNLVDATA 644

>Scas_669.14
          Length = 690

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/651 (51%), Positives = 454/651 (69%), Gaps = 38/651 (5%)

Query: 8   EVLYHYRSSVRIGEVERYVITYDLYDEEELPERIQLSSLWLKVKNVSSLTYRAAYLMGPY 67
           ++LY  +S++   + +RY+ITY+LYD EE+P  I+L  L+L++KN+  ++YRAAYLMGP+
Sbjct: 3   DLLYQNKSTLGAAQQDRYIITYNLYDTEEIPSDIKLDPLYLRIKNIEPISYRAAYLMGPF 62

Query: 68  MLYCDLRTEDYHHSQKLFSSADMPQFEPAMQPQHEFLAELSLHRLQKRYVWLLDVVSQII 127
           +LYCD+R E YHHSQ+++S+ D PQFE  + P  + +  LSLH++QKRYVW++DVVSQI+
Sbjct: 63  ILYCDVRLETYHHSQRIYSTCDQPQFESNLLPSQDAIWSLSLHQIQKRYVWIVDVVSQIL 122

Query: 128 FTTNSVVPFEVTIASAKPALEDTATLAPQAGSFNRRLTVNRQTTLDLWNLPQQVF--DDY 185
           FTTN+ + +E+++   K +L  +     + GS   RL V +  TLDLW LP Q+   D  
Sbjct: 123 FTTNTDITYEISMGYTKESLHHSIN-NERLGS--DRLVVTKLNTLDLWKLPVQLAPSDRR 179

Query: 186 TKPEHLVVLTHGLHSNVTADMQYLKETIEQCQQYYPNEHIVVKGFGDNVCKTEKGIKYLG 245
            + +HLV+LTHGLHSN+T DM+Y+ E I + Q  YPNE IVV G+  N+C+TE+G+KYLG
Sbjct: 180 RRRKHLVILTHGLHSNLTVDMEYIMEQIYKSQDNYPNEQIVVDGYPGNICQTERGVKYLG 239

Query: 246 GRLGEYIVKQLYNERIKRISFIGHSLGGLTQTFAIAYIAINYPWFFEKVDPVNFVALSSP 305
            RL +YIV +LY+  I +ISFIGHSLGGL QTFAIAYI + YPWFF+KV P+NF+A++SP
Sbjct: 240 ERLAKYIVNELYDASIVKISFIGHSLGGLVQTFAIAYINVKYPWFFQKVQPINFIAMASP 299

Query: 306 LLGIVTNNPAYVNILLSMGVVGKTGQDLGLQAHQGDDQPLLCSLPGHTTRRILRKFKKRT 365
           LLGIVT+NPAYV +LLS GV+GKTGQDLGL      D+PLL  LPG  TR +L KFK+RT
Sbjct: 300 LLGIVTDNPAYVKLLLSFGVIGKTGQDLGLDRVSETDRPLLYLLPGEPTRSVLLKFKRRT 359

Query: 366 LYANAVNDGIVPLYTSALLYLDYDSILKQL---DTQEYQVDKQDF--------FTKTLIN 414
           LYANA+NDGIVPLYT++LL+LDYD IL+QL   + +E   D+Q+         F K  I+
Sbjct: 360 LYANAINDGIVPLYTASLLFLDYDDILEQLHKNEDEELAKDEQNVTIPENTASFNKNFIS 419

Query: 415 PLVKAINVLMPQT---QSSSSIPKVSMFDSAMSVLLPPLPEKSYLMNPSGDPSVILHDKM 471
           PL K +++  PQ       S +PKVSM  SA S+LLPPLP++ YL+NP     VI+HDK 
Sbjct: 420 PLTKMLSIWAPQKFPQGPDSKLPKVSMLQSATSILLPPLPDQEYLLNPKARHPVIIHDKT 479

Query: 472 YSEADIPEVGQPPEKNIWSS--LLLNI-----GNNEEYKQLEEEIAKKWHKGMTWRKVIV 524
           Y++ D+P+     E   ++S  +LL          + Y++LEE IA++WH+GM+WRKV+V
Sbjct: 480 YTQEDLPKGDTELEDTFFNSENMLLQAFTDIKAGRKRYQKLEESIARRWHEGMSWRKVVV 539

Query: 525 HLKPDAHNNIIVRRRFANAYGWPVIDHLVQNHFNGSDYPYTEGETEEAALD--------E 576
            LKPDAHNNIIVRRRFANAYGW VIDHL+  HFNG D    E E  +A L+         
Sbjct: 540 ALKPDAHNNIIVRRRFANAYGWNVIDHLIGVHFNGDD--RLEEEQTKAGLEAPLPNDQSS 597

Query: 577 LIE--QEKKWINRPHNETFFDVGPTGMISSVGEILENIKNSAFQKTASASS 625
           +IE   E  W+ +  +E+ FD GPTGMIS++GE+LE    +     ++ +S
Sbjct: 598 VIEPIDEYAWVTKAESESLFDEGPTGMISTMGEMLETFTKTHLATISNKNS 648

>Scas_613.14
          Length = 628

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/637 (45%), Positives = 398/637 (62%), Gaps = 33/637 (5%)

Query: 8   EVLYHYRSSVRIGEVERYVITYDLYDEEELPERIQLSSLWLKVKNVSSLTYRAAYLMGPY 67
           +VLY   S V+IG + RY+I Y+LY  +E+P  I L  L L +KN    +++AAYLMGP+
Sbjct: 9   QVLYQDTSEVKIGGIRRYIIKYNLYTGDEIPTTISLDPLKLTIKNKVRKSFKAAYLMGPF 68

Query: 68  MLYCDLRTEDYHHSQKLFSSADMPQFEPAMQPQHEFLAELSLHRLQKRYVWLLDVVSQII 127
            LYCD+R + YHH Q++ SS D+PQF   +QP  +F+AELSLH ++K+YVW++DV+SQ I
Sbjct: 69  TLYCDVRAQSYHHKQRIVSSKDVPQFISNLQPHSKFIAELSLHEIKKKYVWIIDVISQSI 128

Query: 128 FTTNSVVPFEVTIASAKPALEDTATLAPQAGSFNRRLTVNRQTTLDLWNLPQQV--FDDY 185
           F+ NSV  FE+T+         T T    +GS    L V   +T  +WN    +    + 
Sbjct: 129 FSLNSVTSFELTLG--------TTTNNYNSGS---SLEVETLSTDVIWNEKATIPLLRES 177

Query: 186 TKPEHLVVLTHGLHSNVTADMQYLKETIEQCQQYYPNEHIVVKGFGDNVCKTEKGIKYLG 245
            K  HLV+LTHG+HSNVTADM YL E I   Q  Y NE IVVKG+  NVCKTE GIK+LG
Sbjct: 178 RKMIHLVILTHGMHSNVTADMSYLMEQIYNTQSLYSNEKIVVKGYVGNVCKTEMGIKFLG 237

Query: 246 GRLGEYIVKQLYNERIKRISFIGHSLGGLTQTFAIAYIAINYPWFFEKVDPVNFVALSSP 305
             L +YI+  LY+  + +ISFIGHSLGGL Q+FAI+ IA+ +PWFFEKV PVNF+ L++P
Sbjct: 238 EGLAKYIIDTLYSVEVAKISFIGHSLGGLIQSFAISSIAVLHPWFFEKVKPVNFITLATP 297

Query: 306 LLGIVTNNPAYVNILLSMGVVGKTGQDLGLQAHQGDDQPLLCSLPGHTTRRILRKFKKRT 365
            LGIVT+NP+YV +LLS G++GKTG DLGL+ H  +   +L  L G   + I++KF++RT
Sbjct: 298 FLGIVTDNPSYVKMLLSAGIIGKTGVDLGLKEHYDN---ILYLLSGEPIKSIMKKFERRT 354

Query: 366 LYANAVNDGIVPLYTSALLYLDYDSILKQLDTQEYQVD------KQDFFTKTLINPLVKA 419
           LYANA+NDGIVPLYTS LL+LDY  +L +LD  +  +       +    ++ +IN     
Sbjct: 355 LYANAMNDGIVPLYTSCLLFLDYADVLSELDNLKRSIKITIDTPESGRESEKIINTSSSW 414

Query: 420 INVLMPQTQSSSSI--PKVSMFDSAMSVLLPPLPEKSYLMNPSGDPSVILHDKMYSEADI 477
             V   + +   S+  PK S+ +S  S+L PP P   Y+ NPS    VI+HDK+Y+E DI
Sbjct: 415 SKVFKHRKEDKHSVKLPKTSIIESMASILQPPSPTDEYITNPSSRAKVIIHDKVYTEDDI 474

Query: 478 PEVGQPPEK----NIWSSLLLNIGNNEEYKQLEEEIAKKWHKGMTWRKVIVHLKPDAHNN 533
             +     K     + S         ++ ++LE EIAK+WH G  WRKVIV L  +AHNN
Sbjct: 475 ERIESNFYKLKNDRLLSRFYRRHSTGKQNERLEVEIAKRWHSGTPWRKVIVALGSEAHNN 534

Query: 534 IIVRRRFANAYGWPVIDHLVQNHFNGSDYPYTEGETEEAALDELIE--QEKKWINRPHNE 591
           IIVRRRF+N YGW VIDHL++NHFNGSD        E+A +   +E  +E  WI +  + 
Sbjct: 535 IIVRRRFSNGYGWEVIDHLIENHFNGSDSLLVHNNEEQAVMKATMEPNKEFSWITKVEDP 594

Query: 592 TFFDVGPTGMISSVGEILENIKNSAFQKTASASSLKP 628
             +     G++S   ++L+ +  S  +   +   +KP
Sbjct: 595 CSYS---GGLLSRTTKLLDTMYVSNPEDRVTNKQVKP 628

>YDL109C (YDL109C) [760] chr4 complement(265258..267201) Protein of
           unknown function, has high similarity to uncharacterized
           S. cerevisiae Rog1p [1944 bp, 647 aa]
          Length = 647

 Score =  548 bits (1411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/584 (47%), Positives = 389/584 (66%), Gaps = 36/584 (6%)

Query: 6   AREVLYHYRSSVRIGEVERYVITYDLYDEEELPERIQLSSLWLKVKNVSSLTYRAAYLMG 65
           A EVLYH +SSV++GE+ERYVITY+LY  + +P  I L SLW+K+KN + L+Y+ AYL+G
Sbjct: 7   ADEVLYHNQSSVKLGELERYVITYELYQGDSIPADITLDSLWVKIKNTTKLSYKPAYLLG 66

Query: 66  PYMLYCDLRTEDYHHSQKLFSSADMPQFEPAMQPQHEFLAELSLHRLQKRYVWLLDVVSQ 125
           P++LYCD+R +DY  S K+  SAD P F+  +Q Q +F+AELSLH ++ RYVW++D+VSQ
Sbjct: 67  PFILYCDVRAKDYESSYKIICSADKPVFQSNLQAQQKFIAELSLHHIKPRYVWIVDIVSQ 126

Query: 126 IIFTTNSVVPFEVTIASAKPALED----TATLAPQAGS-FNRRLTVNRQTTLDLWNLPQQ 180
           I+F   + V FE+ + ++K +L+       +L  +A +  +  L+V+R TT D+W +P+ 
Sbjct: 127 ILFNKETKVTFEIVVGNSKASLKRKIRCNDSLPDKACNILHTGLSVHRLTTADIWKVPRP 186

Query: 181 VFDDYTKPEHLVVLTHGLHSNVTADMQYLKETIEQCQQYYPNEHIVVKGFGDNVCKTEKG 240
           +  D ++  HLV+LTHG  SNV+ADM+YL E I + Q   PNE +V+KG+  N C+TEKG
Sbjct: 187 I--DMSQKSHLVILTHGFQSNVSADMEYLMEEIYKAQMNNPNERLVIKGYMKNACETEKG 244

Query: 241 IKYLGGRLGEYIVKQLYNERIKRISFIGHSLGGLTQTFAIAYIAINYPWFFEKVDPVNFV 300
           IK+LG  L  YI+ +LY++ + +ISFIGHSLGGLTQTFAI YI   YP+FF+KV+P+NF+
Sbjct: 245 IKFLGVGLANYIIDELYDDSVGKISFIGHSLGGLTQTFAICYIKTKYPYFFKKVEPINFI 304

Query: 301 ALSSPLLGIVTNNPAYVNILLSMGVVGKTGQDLGLQAHQGDDQPLLCSLPGHTTRRILRK 360
           +L+SPLLGI T+ P YV + LSMG++G TGQ+LGL+     D+PLL  L   +   +L +
Sbjct: 305 SLASPLLGIATSTPNYVKMSLSMGIIGTTGQELGLKDGNYGDKPLLYLLSEESLISVLAR 364

Query: 361 FKKRTLYANAVNDGIVPLYTSALLYLDYDSILKQLDTQEYQVDKQDFFTKTLINPLVK-- 418
           FK+RTLYANAVNDGIVPLY+S+LL+LDY  +L++L  Q       D   +  ++P+ +  
Sbjct: 365 FKRRTLYANAVNDGIVPLYSSSLLFLDYSQLLQKLGGQ--TTAPCDPLFQPEVSPIGELP 422

Query: 419 ----------AINVLMPQT----------QSSSSIPKVSMFDSAMSVLLPPLPEKSYLMN 458
                      IN     T          + S  +   S+  S  SVLL P P+  +  +
Sbjct: 423 NHSDVANDDDGINASSWNTFWKSKENNCDKKSKRLMNASVIKSMKSVLLSPCPDAKFFSD 482

Query: 459 PSGDPSVILHDKMYSEADIPEVGQPPEKNIWSSLLLNIGNNEE-YKQLEEEIAKKWHKGM 517
           P    + I+HDK+Y+E ++P    PP   ++       G   +  K++EE IA++WHKGM
Sbjct: 483 PDARVATIIHDKIYTEKNLP----PPSPTLYEGTAAKEGETRKTRKEMEEIIARRWHKGM 538

Query: 518 TWRKVIVHLKPDAHNNIIVRRRFANAYGWPVIDHLVQNHFNGSD 561
            WRKV+V LKPDAHNNIIVRRRF+NAYGWPV+DHLV  HF   D
Sbjct: 539 HWRKVVVLLKPDAHNNIIVRRRFSNAYGWPVVDHLVTAHFQRDD 582

>CAGL0H10340g 1007564..1009342 similar to sp|P53118 Saccharomyces
           cerevisiae YGL144c or tr|Q12103 Saccharomyces cerevisiae
           YDL109c, hypothetical start
          Length = 592

 Score =  351 bits (900), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 213/594 (35%), Positives = 331/594 (55%), Gaps = 66/594 (11%)

Query: 10  LYHYRSSVRIGEVERYVITYDLYDEEELPERIQLSSLWLKVKNVSSLTYRAAYLMGPYML 69
           + H R ++ IGE  R++I        E+   I    ++++++N +  T RA YL+GP++L
Sbjct: 1   MIHVRGALAIGETSRFLI--------EVNSNID-GPVFVRLRNRTKATRRATYLLGPFVL 51

Query: 70  YCDLRTEDYHHSQKLFSSADMPQFEPAMQPQHEFLAEL---SLHRLQKRYVWLLDVVSQI 126
           YCD R     +  +      +PQF+  ++PQ +F  +L       +  +  W++DVVS++
Sbjct: 52  YCDSRPVIPANQNEY-----VPQFKANIEPQGKFTFQLKPEDARDVGGKRCWIIDVVSEV 106

Query: 127 IFTTNSVVPFEVTIASAKPALEDTATLAPQAGSFNRRLTVNRQTTLDLWNLPQ---QVFD 183
           +F   + V +E+ I+      + +        S    +   + +  D+    +   ++  
Sbjct: 107 LFNQITKVDYELLISLDINNFKKSKYQQDIYESIEGDVVAKQYSNHDIQEFIEVGAKIKK 166

Query: 184 DYTKP--EHLVVLTHGLHSNVTADMQYLKETIEQCQQYYPNEHIVVKGFGDNVCKTEKGI 241
             TK   +HLV++THG+ SNV+ DM Y+ E +    +   +E +++ G+  NVC+TE GI
Sbjct: 167 SQTKERNQHLVIVTHGMISNVSNDMMYIMEQLRAIDRDDLDEELILDGYTGNVCRTELGI 226

Query: 242 KYLGGRLGEYIVKQLYNERIKRISFIGHSLGGLTQTFAIAYIAINYPWFFEKVDPVNFVA 301
           K LG RL  YIVK+ YN  IK+ISFIGHSLGGL QTFAIAYI I + WFF+ V PVNF++
Sbjct: 227 KNLGIRLANYIVKERYNTNIKKISFIGHSLGGLVQTFAIAYIYILHGWFFDAVKPVNFIS 286

Query: 302 LSSPLLGIVTNNPAYVNILLSMGVVGKTGQDLGLQAHQG-DDQPLLCSLPGHTTRRILRK 360
           L++P LG+ ++   Y   LLS G +G+TG+DL   +H    +  +L  L G     IL+K
Sbjct: 287 LATPFLGLYSHIGNYTKRLLSSGALGQTGEDLRYHSHNKLKNFSILYLLSGDPAHSILQK 346

Query: 361 FKKRTLYANAVNDGIVPLYTSALLYLDYDSILKQ---------------LDTQEYQVDKQ 405
           F++RTLYANA+NDGIVPL +SALLYLDY  ILK                +  +E+Q D +
Sbjct: 347 FERRTLYANAINDGIVPLASSALLYLDYSKILKDSKLLKKETDDIRSIVMTWKEFQ-DSE 405

Query: 406 DFFTKTLINPLVKAINVLMPQTQSSSSIPKVSMFDSAMSVLLPPLPEKSYLMNPSGDPSV 465
           DF     +NP              S    +VS+ ++  +++LP  P+     N + D  V
Sbjct: 406 DFKVYKKVNP-------------KSKIFRRVSLTNTVGNLVLPEPPK-----NITSDMKV 447

Query: 466 ILHDKMYSEADIPEVGQPPEKNIWSSLLLNIGNNEEYKQLEEEIAKKWHKGMTWRKVIVH 525
           ++HD++Y   DIP+    P   I   + +      +  QL+E +A++WH G +WRKVIV 
Sbjct: 448 LIHDQVYQYNDIPDSEYFPPDGIDEIMAM------DRHQLQECMARRWHAGKSWRKVIVC 501

Query: 526 LKPDAHNNIIVRRRFANAYGWPVIDHLVQNHF---NGSDYPYTEGETEEAALDE 576
           L+ DAHN+I VRRR++N+ GW VI H++ NHF      D P  +  ++ A+ DE
Sbjct: 502 LEGDAHNSINVRRRYSNSCGWAVISHMILNHFIKPQKCDVPEADIVSQPASRDE 555

>AER322C [2823] [Homologous to ScYDR444W - SH] (1229579..1231489)
           [1911 bp, 636 aa]
          Length = 636

 Score =  325 bits (832), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 214/622 (34%), Positives = 329/622 (52%), Gaps = 90/622 (14%)

Query: 9   VLYHYRSSVRIGEVERYVITYDLYDEEELPERIQLSSLWLKVKNVSSLTYRAAYLMGPYM 68
           +LY+ +  +  GEV RY+I  D   + +L  + ++  L L++KNV S   R  YL GPY 
Sbjct: 24  LLYNDQRGISQGEVFRYIIKVD---KAQLDAKTKIEELVLRIKNVESPLLRPIYLTGPYS 80

Query: 69  LYCDLRTEDYHHSQKLFSSADMPQFEPAMQPQHEFLAELSLHRLQKR-----YVWLLDVV 123
           +Y ++R  +Y  +   F   D+ QF   ++P   F A L L+   +      Y W  DV+
Sbjct: 81  VYAEVRPYNYDENTA-FQGDDL-QFISDLKPDEAFSATLKLNGDSQVLESTVYSWTADVL 138

Query: 124 SQIIFTTNSVVPFEVTIAS----AKPALEDTATLAPQAGSFNRRLTVNRQTTLDLWNLPQ 179
           SQ+ +  +  +   ++I +     K A++  A        F    TV  Q T+ +WN P 
Sbjct: 139 SQMTWMVDHPILVRLSIGNTRSIGKAAMKTPARAVEPVSGF----TVEIQDTMTVWNEPP 194

Query: 180 QVFDDYTKPEHLVVLTHGLHSNVTADMQYLKETIEQCQQYYP---NEHIVVKGFGDNVCK 236
            +F +  +P HLV++THG+ SN+  DM YL++ +++C        N+++VV+G+  N+ K
Sbjct: 195 -LFPE--RPVHLVIVTHGIFSNIGCDMLYLRDRLKKCAHAVEENCNQNVVVRGYHGNIGK 251

Query: 237 TEKGIKYLGGRLGEYIVK---QLYNER-IKRISFIGHSLGGLTQTFAIAYIAINYPWFFE 292
           + KGI+YL  R+ +Y++K   Q+ NE  + RISFIGHSLGGL QTFAI Y+    P  F 
Sbjct: 252 SHKGIEYLAMRVADYVLKTIAQMPNEYFLDRISFIGHSLGGLVQTFAIQYMLERDPGIFS 311

Query: 293 ----KVDPVNFVALSSPLLGIVTNNPAYVNILLSMGVVGKTGQDLGLQ------------ 336
                + P+NF+AL+SP LG++ + P Y  + L+ G +G+TG+DL L+            
Sbjct: 312 PQAGGLRPMNFIALASPFLGVIGDFPLYATVALNFGALGRTGKDLNLKNDFAISELVRNP 371

Query: 337 AHQGDDQPLLCSLPGHTTRRILRKFKKRTLYANAVNDGIVPLYTSALLYLDY-------- 388
               + +P+L S+   + + +L+ F  RTLYANA++DGIVPL TSALLYLD+        
Sbjct: 372 KQAYNRRPVLESIVSGSMKSVLQAFSNRTLYANALHDGIVPLRTSALLYLDWYSLQEVNL 431

Query: 389 ---------------DSILKQLDTQEYQVD---KQDFFTKTLINPLVK------------ 418
                          D  LK+ DT E   D   K+D     L   L+K            
Sbjct: 432 IGAQEGAETFDLGEEDHALKRYDTVEIPPDLSEKKDTIRWLLPRALIKRRHKWYKRSQTV 491

Query: 419 --AINVLMPQTQSSSSIPKVSMFDSAMSVLLPPLPEKSYLMNPSGDPSVILHDKMYSEAD 476
              I  L  +      + K S   SA ++L+ P P + Y  +P      I HDK YS  +
Sbjct: 492 KPGIEQLWDEDSDYHPLTKASALSSAANILVAPPPTQDYYKDPQSRTDYIFHDKRYSPEE 551

Query: 477 IPEVGQPPEKNIWSSLLLNI-GNNEEYKQLEEEIAKKWHKGMTWRKVIVHLKPDAHNNII 535
           +P     P       LL  I   N++  + +E+IA+ + + M+WRKV+V+++P++HNNII
Sbjct: 552 LP-----PAYYRNRELLKKILYPNDKVHRTQEKIARGYQESMSWRKVLVNIQPESHNNII 606

Query: 536 VRRRFANAYGWPVIDHLVQNHF 557
           VRRRF N++GW VI+HLV  HF
Sbjct: 607 VRRRFVNSFGWIVIEHLVNEHF 628

>KLLA0B01375g 110709..112631 similar to sgd|S0002852 Saccharomyces
           cerevisiae YDR444w, start by similarity
          Length = 640

 Score =  308 bits (790), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 206/631 (32%), Positives = 326/631 (51%), Gaps = 98/631 (15%)

Query: 9   VLYHYRSSVRIGEVERYVITYDLYDEEELPERIQLS--SLWLKVKNVSSLTYRAAYLMGP 66
           +L     S+ IG+V RY I  D    + L + I+ +  +L+L+ KN  S   R  ++ GP
Sbjct: 19  LLLRETGSLGIGDVNRYKIIVD--KNKLLSDGIECTDDTLYLEFKNQESALLRPLWITGP 76

Query: 67  YMLYCDLRTEDYHHSQKLFSSADMPQFEPAMQPQHEFLAELSLHRLQK-----RYVWLLD 121
           Y +Y ++   +Y   ++     D  +F   ++P   F A+L L+   +      Y W +D
Sbjct: 77  YSIYVEITPNNYDERKQFI--GDGIEFMSDLKPDENFKAKLYLNSNARVDGTSCYAWKID 134

Query: 122 VVSQIIFTTNSVVPFEVTIAS----AKPALEDTATLAPQAGSFNRRLTVNRQTTLDLWNL 177
           +++Q    T   +PF  T+A+    AK + +D      Q       L +++  T  LWNL
Sbjct: 135 LIAQFTVVTIVRLPFVFTLATTYKTAKHSQKDKNIEVQQTDG----LKISKLDTEQLWNL 190

Query: 178 PQQVFDDYTKPEHLVVLTHGLHSNVTADMQYLKETIEQCQQYYP---NEHIVVKGFGDNV 234
           P    D   KP HLV++THG+ S++  DM  LK+TIE+   + P   N ++V++G+  NV
Sbjct: 191 PPPFPD---KPVHLVIITHGIFSSIGGDMLCLKDTIERASNFLPDDNNGNLVIRGYPGNV 247

Query: 235 CKTEKGIKYLGGRLGEYIVKQLYNER----IKRISFIGHSLGGLTQTFAIAYIAINYPWF 290
            K+ KGI++LG +L EYI+  +   +    + RISF+GHSLGG  Q  AI YI++  P  
Sbjct: 248 GKSHKGIRHLGFKLAEYIIDTIDKLQQQFTLTRISFVGHSLGGPVQAMAIHYISVERPDI 307

Query: 291 FEK---VDPVNFVALSSPLLGIVTNNPAYVNILLSMGVVGKTGQDL-----------GLQ 336
           F+K   + PVNFVA +SP LG++ + P Y++I+L +G +G+TG+DL           G+ 
Sbjct: 308 FDKTTGLTPVNFVAAASPFLGVIGDLPKYISIVLDIGALGQTGRDLTLKRSYFLPSKGIV 367

Query: 337 AHQGD-----DQPLLCSLPGHTTRRILRKFKKRTLYANAVNDGIVPLYTSALLYLDYDSI 391
            + G       +P+L  LP H    + ++FK RT+YAN   DGIVPL T+ALLYLD+  +
Sbjct: 368 NNDGSHDRIKSKPILELLPKHPALEVFQRFKCRTVYANVAFDGIVPLRTAALLYLDWRGL 427

Query: 392 --LKQLDTQ---------------------EYQVDKQDFFTKTLINPLVKAINVLMPQTQ 428
             ++Q+ ++                     E   D +      L   L+K      P  +
Sbjct: 428 SDVQQVRSENNAQSEEGVEEQKGSSLGEIPESSSDNKSILQWLLPQSLIKK-EKYKPYVR 486

Query: 429 SSSSI---------------------PK-VSMFDSAMSVLLPPLPEKSYLMNPSGDPSVI 466
           + ++                      PK  +   +A S +  PLP  SYL++PS     I
Sbjct: 487 TQTTSSVESASSDSNNNSDSPTTFKPPKKANTLQAAASTISAPLPGMSYLVDPSSRTDRI 546

Query: 467 LHDKMYSEADIPEVGQPPEKNIWSSLLLNIGNNEEYKQLEEEIAKKWHKGMTWRKVIVHL 526
           +HDK+Y+  ++P+     +K +   +  N   + +    EE IA+ W + M WRKVIV L
Sbjct: 547 IHDKVYTPEELPDKHYKHKKLVKKIIYPNYSIHMK----EERIARYWQETMDWRKVIVEL 602

Query: 527 KPDAHNNIIVRRRFANAYGWPVIDHLVQNHF 557
           +PD+HNNIIVRRRF N++GW V++H+   HF
Sbjct: 603 QPDSHNNIIVRRRFVNSFGWIVVNHIADEHF 633

>Kwal_47.18482
          Length = 623

 Score =  295 bits (756), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 203/624 (32%), Positives = 319/624 (51%), Gaps = 103/624 (16%)

Query: 14  RSSVRIGEVERYVITYD--LYDEEELPERIQLSSLWLKVKNVSSLTYRAAYLMGPYMLYC 71
           R  + +GE+ RY +T D  L D+        ++  +L  KN  S   R  YL GPY  Y 
Sbjct: 15  RLKLGLGELVRYNVTVDRSLLDDH----LSHITEFYLTFKNTESAFLRPIYLTGPYSFYV 70

Query: 72  DLRTEDYHH----SQKLFSSADMPQFEPAMQPQHEFLAELSLH---RLQK--RYVWLLDV 122
           D++  +Y      ++KL       QF   ++P  E+ A L L+   R+++  R+VW ++V
Sbjct: 71  DVQPCNYDERIPFNEKL-------QFCEDVKPNEEYRAVLQLNDNSRVEESERFVWQINV 123

Query: 123 VSQIIFTTNSVVPFEVTIASAKPALEDTATLAPQAGSFNRRLTVNRQTTLDLWNLPQQVF 182
           +SQ+  T   V+ F + I+  K +   ++ +    G         +  T  LWNLP +  
Sbjct: 124 MSQLSVTKIPVLGFRLCISCGKSSEIPSSPVTSIKG-----FVCEKWDTHGLWNLPPRFP 178

Query: 183 DDYTKPEHLVVLTHGLHSNVTADMQYLKETIEQCQQYYPNE----HIVVKGFGDNVCKTE 238
           D   +P HLVVLTHG+ SNV  D+ YLK+ IE        +    ++VV+G+  N  ++ 
Sbjct: 179 D---RPLHLVVLTHGIFSNVGCDLVYLKDRIEAAASVAGKDSKTSNLVVRGYMGNQGRSS 235

Query: 239 KGIKYLGGRLGEYIVKQLYNER----IKRISFIGHSLGGLTQTFAIAYIAINYPWFFE-- 292
           KGIK  G RL ++I++ + + +    ++ ISF+ HSLGG +Q  AI YI +  P  F+  
Sbjct: 236 KGIKANGVRLAKFIIETVDDLKEEYDLQYISFVAHSLGGPSQAMAIRYICLERPDIFDPA 295

Query: 293 -KVDPVNFVALSSPLLGIVTNNPAYVNILLSMGVVGKTGQDLGLQAH---------QGDD 342
             + P+NF+ L+SP LGI    P +V + L +GV+G+TG DL L            + D+
Sbjct: 296 KGLKPLNFITLASPYLGIAGEVPPFVTLALDVGVLGQTGADLNLNRTFFLSKDGIVRKDE 355

Query: 343 Q-------PLLCSLPGHTTRRILRKFKKRTLYANAVNDGIVPLYTSALLYLDYDSI---- 391
           +       PLL  +P      ++++F+ RT+YAN ++DGIVPL T+ALLYLD+ ++    
Sbjct: 356 KLGSYRRKPLLEIIPSRPLTELIQRFENRTIYANILHDGIVPLRTAALLYLDWKALGDVR 415

Query: 392 ------LKQLDTQEYQVDKQDFFTKTLINPLVK--AINVLMPQ----------------- 426
                  K  +   Y  +++D   K     + K  A+  LMPQ                 
Sbjct: 416 GIRRENGKDDEGTPYSSNEKDAIGKIPEEKMDKQSALKYLMPQAALRRKYKKYTRTQILS 475

Query: 427 -------------TQSSSSIPKVSMFDSAMSVLLPPLPEKSYLMNPSGDPSVILHDKMYS 473
                        T+  S  P  +   SA ++++ PLP + YL NP      I+HDK+Y 
Sbjct: 476 QESGNENSYSEESTEPISPPPSANPLVSAANIIVAPLPTQKYLQNPKEREDKIVHDKIYY 535

Query: 474 EADIPEVGQPPEKNIWSSLLLNIGNNEEYKQLEEEIAKKWHKGMTWRKVIVHLKPDAHNN 533
             ++P    P        L   I  N+   +++E IA++W + M WRKV+V ++PD+HNN
Sbjct: 536 PDELP----PAHYRKRDVLKKIIYPNDRIYRVQERIARQWQETMNWRKVLVSIEPDSHNN 591

Query: 534 IIVRRRFANAYGWPVIDHLVQNHF 557
           I+VRR+F NA+GW V+DHLV+ HF
Sbjct: 592 IVVRRKFVNAFGWVVVDHLVKEHF 615

>CAGL0M10043g complement(999113..1001089) similar to tr|Q04093
           Saccharomyces cerevisiae YDR444w, hypothetical start
          Length = 658

 Score =  241 bits (614), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 154/436 (35%), Positives = 243/436 (55%), Gaps = 49/436 (11%)

Query: 9   VLYHYRSSVRIGEVERYVITYDLYDEEELPERIQLSSLWLKVKNVSSLTYRAAYLMGPYM 68
           +L H ++S+ IG + RY++  D    +E  + I    L+L+ KN+ S   R  YL GPY 
Sbjct: 8   LLVHEKNSLGIGGMCRYILQVDHKKLKE--DGIDTQELYLRFKNLESPLLRPVYLTGPYA 65

Query: 69  LYCDLRTEDYHHSQKLFSSADMPQFEPAMQPQHEFLAELSLH---RLQKR------YVWL 119
            Y D+R  +Y   +    S D+  F   ++P  +F A+L  +   RLQ +      Y W 
Sbjct: 66  FYIDVRPCNYDEDKTYIGSEDV-AFCSDLKPDEKFKAKLYFNANSRLQTKNARDEIYSWT 124

Query: 120 LDVVSQIIFTTNSVVPFEVTIASAKPALEDTATLAPQAGSFNRRLTVNRQTTLDLWNLPQ 179
           +D++SQ+   T  ++ +   + ++K  ++ +      +    R L++       LWNLP 
Sbjct: 125 IDIISQLAVVTFPILKYSFKVGTSKKIVKKSKGKKVTSV---RGLSLKMWDEKSLWNLPP 181

Query: 180 QVFDDYTKPEHLVVLTHGLHSNVTADMQYLKETIEQC-----QQYYPNEHIVVKGFGDNV 234
           +  D   KP HLV+LTHG+ SNV  DM Y+K+ IEQ      ++Y PN  +VV+G  DN+
Sbjct: 182 KYPD---KPIHLVILTHGIFSNVGCDMLYMKDKIEQTAMNIEERYNPN--VVVRGCMDNM 236

Query: 235 CKTEKGIKYLGGRLGEYIVKQLYNER----IKRISFIGHSLGGLTQTFAIAYIAINYPWF 290
            K+  GI YLG RL +++V+ +   R    + +ISFIGHSLGG TQ+ AI YI++ YP F
Sbjct: 237 GKSAHGIYYLGKRLAKFVVRTVEELRKEYHVDKISFIGHSLGGPTQSMAIHYISVMYPDF 296

Query: 291 FEKVD---PVNFVALSSPLLGIVTNNPAYVNILLSMGVVGKTGQDLGLQ----------- 336
           F  V    P++F+AL+SP +G++ + P Y+++ L MG +G TG+DL L+           
Sbjct: 297 FNTVSGIKPMHFIALASPFIGVIGDFPLYLSVPLDMGALGLTGRDLNLKYTPLTSNEGLS 356

Query: 337 ----AHQGDDQP--LLCSLPGHTTRRILRKFKKRTLYANAVNDGIVPLYTSALLYLDYDS 390
               A +    P  +L  +P    +++ + F  RTLYAN V+DGIVPL T+ALLYLD+ S
Sbjct: 357 ALTLAQENSHLPKNILEIIPQPPAQQVFQLFMNRTLYANIVHDGIVPLRTAALLYLDWRS 416

Query: 391 ILKQLDTQEYQVDKQD 406
           + +  D ++   +K +
Sbjct: 417 LTQVKDIKKSAGEKSN 432

 Score =  104 bits (259), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 50/132 (37%), Positives = 76/132 (57%), Gaps = 4/132 (3%)

Query: 426 QTQSSSSIPKVSMFDSAMSVLLPPLPEKSYLMNPSGDPSVILHDKMYSEADIPEVGQPPE 485
           Q Q      + S F SA+S L  P+P + Y+ NP      ++HD++Y   D+PE      
Sbjct: 511 QEQKFKGPSEASTFMSALSTLTAPVPTQEYIKNPKVRKDRVVHDRVYEPQDLPEQHYLKR 570

Query: 486 KNIWSSLLLNIGNNEEYKQLEEEIAKKWHKGMTWRKVIVHLKPDAHNNIIVRRRFANAYG 545
               S++   +  NE   +++E IA+ W   M+WRKV+V ++PD+HNNI+VRRRF N YG
Sbjct: 571 ----STMKRVVYPNESVNRIQERIARAWQMNMSWRKVLVEIQPDSHNNIVVRRRFVNLYG 626

Query: 546 WPVIDHLVQNHF 557
              + H+V+ HF
Sbjct: 627 NVAVSHMVREHF 638

>YDR444W (YDR444W) [1264] chr4 (1350278..1352341) Protein of unknown
           function, has low similarity to C. albicans Orf6.7404p
           [2064 bp, 687 aa]
          Length = 687

 Score =  241 bits (615), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 151/425 (35%), Positives = 237/425 (55%), Gaps = 48/425 (11%)

Query: 3   TEPAREVLYHYRSSVRIGEVERY--VITYDLYDEEELPERIQLSSLWLKVKNVSSLTYRA 60
            E    +L   R  +RIGE+ RY   +  D+  E+ L     +S L+L++KN  S   R 
Sbjct: 15  NETGGTLLVDERKRLRIGELYRYKFSVNKDVIKEQGL----DVSHLFLRIKNEESALLRP 70

Query: 61  AYLMGPYMLYCDLRTEDYHHSQKLFSSADMPQFEPAMQPQHEFLAELSLHRLQK-----R 115
            YL GPY  Y D+R  +Y+ ++K F   ++  F   ++P   F  ++ L+   +      
Sbjct: 71  LYLTGPYSFYIDVRPHNYNENRK-FPGKEIIPFVENLKPDERFKVKILLNENSRVGDTSL 129

Query: 116 YVWLLDVVSQIIFTTNSVVPFEVTIASAKPALEDTATLAPQAGSFNRRLTVNRQTTLDLW 175
           Y W +D++SQ+  TT   + F   I + +  ++ +  L          +++    T  LW
Sbjct: 130 YSWTIDIISQLAVTTIPKLEFSFRIGTTRKVVKKSNGLFKSIEG----VSLEMWDTETLW 185

Query: 176 NLPQQVFDDYTKPEHLVVLTHGLHSNVTADMQYLKETIEQCQQYYP-----NEHIVVKGF 230
           +LP +  +   KP HLV++THG+ SN+  DM Y+K+ IE+    +P     N +I+V+GF
Sbjct: 186 DLPPKFPE---KPVHLVIMTHGIFSNIGCDMLYMKDKIEEMT--FPMDESINPNIIVRGF 240

Query: 231 GDNVCKTEKGIKYLGGRLGEYIVKQL--YNERIK--RISFIGHSLGGLTQTFAIAYIAIN 286
             NV K+  GI  LG R+G+Y+++ +   N++ K  RISFIGHSLGG TQ+ A+ YI+I 
Sbjct: 241 MGNVGKSGHGIHCLGVRVGKYVLETVDKLNKKYKVDRISFIGHSLGGPTQSMAVRYISIK 300

Query: 287 YPWFFEKVD---PVNFVALSSPLLGIVTNNPAYVNILLSMGVVGKTGQDLGLQ------- 336
            P FF+ V    PVNF+ L+SP +G++ + P Y+++ L MG +G TG+DL L+       
Sbjct: 301 RPDFFDAVKGVKPVNFITLASPFIGVIGDFPFYLSVPLDMGALGLTGRDLNLKYTPLTSK 360

Query: 337 -AHQGDDQP-------LLCSLPGHTTRRILRKFKKRTLYANAVNDGIVPLYTSALLYLDY 388
                DD+        +L  LP    +++   FK+RT+YAN ++DGIVPL T+ALLYLD+
Sbjct: 361 DGLYADDEVYPEHSKYILEILPQAPAKKVFESFKRRTIYANVMDDGIVPLRTAALLYLDW 420

Query: 389 DSILK 393
            SI K
Sbjct: 421 RSIHK 425

 Score =  106 bits (264), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 77/117 (65%), Gaps = 4/117 (3%)

Query: 441 SAMSVLLPPLPEKSYLMNPSGDPSVILHDKMYSEADIPEVGQPPEKNIWSSLLLNIGNNE 500
           SA+SVL   +P++ Y+ NP+     ++HDK+Y   ++P    PP       +   I  NE
Sbjct: 531 SALSVLTAAIPDQEYIKNPAVRKDEVIHDKLYHPEELP----PPHYENRPIVKKLIYPNE 586

Query: 501 EYKQLEEEIAKKWHKGMTWRKVIVHLKPDAHNNIIVRRRFANAYGWPVIDHLVQNHF 557
              +++E IA++W + MTWRKV+V ++PD+HNNI+VRRRF N YG+  ++H+V++HF
Sbjct: 587 SVNRIQERIAREWQETMTWRKVLVQIQPDSHNNIVVRRRFVNLYGYVAVEHMVEHHF 643

>Scas_717.50
          Length = 658

 Score =  230 bits (587), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 142/425 (33%), Positives = 226/425 (53%), Gaps = 48/425 (11%)

Query: 19  IGEVERYVITYDLYDEEELPERIQLSSLWLKVKNVSSLTYRAAYLMGPYMLYCDLRTEDY 78
           IG++ RY+I+ D    E+    I +  L+L++KN  S   R  YL GPY  Y D+R  +Y
Sbjct: 28  IGDLSRYIISVDKKKLED--SGICIEELFLRIKNEESPLLRPVYLTGPYTFYVDVRPHNY 85

Query: 79  HHSQKLFSSADMPQFEPAMQPQHEFLAELSLHRLQK-----RYVWLLDVVSQIIFTTNSV 133
           H  + +F   ++  F   ++P   F  ++ L++  +      Y W +D++SQ+       
Sbjct: 86  HEDE-IFEGDEVIPFCEHLKPDARFKTKIFLNKHSRVANTNTYSWTVDILSQLCVIPTPT 144

Query: 134 VPFEVTIASAKPALEDTATLAPQAGSFNRR------LTVNRQTTLDLWNLPQQVFDDYTK 187
           + +   IA+ K   ++        GS  ++        V    T  LW+ P +  +   K
Sbjct: 145 LKYSFRIATTKKETKN--------GSKGKKPVKMDGFEVKLLDTSSLWSFPPKYPN---K 193

Query: 188 PEHLVVLTHGLHSNVTADMQYLKETIEQCQQYYP---NEHIVVKGFGDNVCKTEKGIKYL 244
           P HLV++THG+ SN+  DM Y+K+ IE+     P   N ++VV+G   N+ K+  G+ YL
Sbjct: 194 PVHLVIMTHGIFSNIGCDMLYMKDKIEETANSVPEDINPNVVVRGCMKNMGKSAHGVHYL 253

Query: 245 GGRLGEYIVKQL--YNERIK--RISFIGHSLGGLTQTFAIAYIAINYPWFF---EKVDPV 297
           G R+ EYI++ +   N++ K  +ISFIGHSLGG TQ  A+ YI++  P  F   + + PV
Sbjct: 254 GKRVAEYIIETVDELNKKYKVDKISFIGHSLGGPTQGMAVHYISVKRPDIFHPTKGIKPV 313

Query: 298 NFVALSSPLLGIVTNNPAYVNILLSMGVVGKTGQDLGLQ-------------AHQGDDQP 344
           NF+ L+SP +G++ + P YV++ L  G +G TG+DL L+              +    + 
Sbjct: 314 NFITLASPFIGVIGDFPLYVSLPLDAGSLGLTGRDLNLKYTPLTSKDGLTTDGNAAKTKL 373

Query: 345 LLCSLPGHTTRRILRKFKKRTLYANAVNDGIVPLYTSALLYLDYDSILKQLDTQEYQVDK 404
           +L  +P      I  +F  RTLYAN V+DGIVPL T+ALLYLD++S+ K    Q+     
Sbjct: 374 ILEIIPQPPALAIFERFVHRTLYANVVHDGIVPLRTAALLYLDWNSLAKAKRIQDRSSST 433

Query: 405 QDFFT 409
           Q+  T
Sbjct: 434 QEAAT 438

 Score =  103 bits (256), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 75/128 (58%), Gaps = 11/128 (8%)

Query: 434 PKVSMFDSAMSVLLPPLPEKSYLMNPS-GDPSVILHDKMYSEADIPEV---GQPPEKNIW 489
           P+ S   +A+SVL  PLP + Y+ NP       I+HDK+Y+  +IP      +P  K + 
Sbjct: 526 PEASTMLAALSVLTAPLPSQEYIKNPEVRHHDAIVHDKIYTPKEIPRAHYANRPAIKKV- 584

Query: 490 SSLLLNIGNNEEYKQLEEEIAKKWHKGMTWRKVIVHLKPDAHNNIIVRRRFANAYGWPVI 549
                 I  NE   + +E IA++W   M WRKV+V +KPD+HNNI+VRRRF N YG   +
Sbjct: 585 ------IYPNESVNRTQERIARQWQMTMNWRKVLVKIKPDSHNNIVVRRRFVNLYGDVAV 638

Query: 550 DHLVQNHF 557
            H+V+ HF
Sbjct: 639 SHMVEEHF 646

>AFR386C [3578] [Homologous to NOHBY] (1131324..1132838) [1515 bp,
           504 aa]
          Length = 504

 Score = 81.6 bits (200), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 64/213 (30%), Positives = 102/213 (47%), Gaps = 20/213 (9%)

Query: 188 PE-HLVVLTHGLHSNVTADMQYLKETIEQCQQYYPNEHIVVKGFGDNVCKTEKGIKYLGG 246
           PE HLV L HGL  NVT  M+YL   + Q Q+  P   +V     +   +T  GI   G 
Sbjct: 2   PEIHLVFLVHGLWGNVT-HMEYLGRAVSQLQERSPETLVVYAAKMNQGYRTYDGIDICGY 60

Query: 247 RLGEYIVKQLYN-------ERIKRISFIGHSLGGLTQTFAIAYIAINYPWFFEKVDP--V 297
           R+ + I +Q+           + + S +G+S+GGL   +A+  +  N   FF+K D   +
Sbjct: 61  RVAKEIQEQVATLNCPETGTVVTKFSIVGYSMGGLISRYAVGLLYSNQ--FFKKQDIKLI 118

Query: 298 NFVALSSPLLGIVT---NNPAYVNILLSMGVVGKTGQDLGL----QAHQGDDQPLLCSLP 350
           NF    SP +G++    N    V   +   ++G +G+ + L    +A  G    +L S+ 
Sbjct: 119 NFTTFCSPHVGVLAPGKNLAVRVFNFVCSLILGNSGRQMFLKDRIKAANGMPLIVLMSVG 178

Query: 351 GHTTRRILRKFKKRTLYANAVNDGIVPLYTSAL 383
                + L +F+ R+LYAN VND     +TS +
Sbjct: 179 DSIFYKALEQFQHRSLYANIVNDKRTAWWTSGI 211

>Kwal_55.21703
          Length = 441

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 79/304 (25%), Positives = 132/304 (43%), Gaps = 27/304 (8%)

Query: 189 EHLVVLTHGLHSNVTADMQYLKETIEQCQQYYPNEHIVVKGFGDNVCKTEKGIKYLGGR- 247
           +HL VL HGL  N    M  +++   +    + N  +      +   KT  GI+ +G R 
Sbjct: 4   KHLFVLVHGLWGNY-KHMNAIRDVFAETFHDHENT-LFFSPRQNGYFKTFDGIEIMGYRT 61

Query: 248 ---LGEYIVKQLYNERIKRISFIGHSLGGLTQTFAIAYIAINYPWFFEKVDPVNFVALSS 304
              L  +I +Q     I +ISF+G+S+GGL   F I  +       F+ ++P  F+  ++
Sbjct: 62  LLELCRFI-EQFPKGEITKISFVGYSMGGLIARFMIGKMFTECHELFQCIEPQLFITFAT 120

Query: 305 PLLGI--------VTNNPAYVNILLSMG--VVGKTGQDLGLQAHQGDDQPLLCSLPGHTT 354
           P LG+         ++  A + IL ++G  ++G+TG+ L +Q     +Q +L  L     
Sbjct: 121 PHLGVHFFLKEDRASHRRALLRILSALGTTILGRTGRQLFIQDSL-PEQSILVQLSSGEY 179

Query: 355 RRILRKFKKRTLYANAVNDGIVPLYTSALLYLDYDSILKQLDTQEYQVDKQDFFTKTLIN 414
              L +FK R   AN  ND  V  YTS +   D D  L   +  +Y+ +         + 
Sbjct: 180 LHGLARFKHRLCVANVKNDRTVAFYTSFI--TDCDPFLDSENRIKYEFEHNLPGENLCMV 237

Query: 415 PLVKAINVLMPQTQS--SSSIPKVS-----MFDSAMSVLLPPLPEKSYLMNPSGDPSVIL 467
           P +  +  L P+     S   P V      +F  A++ LLP +   + L       + + 
Sbjct: 238 PRIIDMERLDPEMSRPPSEGSPFVRTVLLILFCGALTFLLPFIFTANVLGTCYSYLATVN 297

Query: 468 HDKM 471
           H KM
Sbjct: 298 HQKM 301

>KLLA0F16423g complement(1516717..1518096) similar to sgd|S0005585
           Saccharomyces cerevisiae YOR059c, start by similarity
          Length = 459

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 59/214 (27%), Positives = 101/214 (47%), Gaps = 21/214 (9%)

Query: 186 TKPEHLVVLTHGLHSNVTADMQYLKETIEQCQQYYPNEHIVVKGFGDNVCKTEKGIKYLG 245
           TK +HL +L HGL  N    M  +KE +E+      ++ ++ K       KT  GI+ + 
Sbjct: 4   TKKKHLFILVHGLWGN-HKHMNSIKEMLEKTLDDI-DDIVIFKPENSGYLKTLHGIRVVS 61

Query: 246 GRLGEYIVKQLYN---ERIKRISFIGHSLGGLTQTFAIAYIAINYPWFFEKVDPVNFVAL 302
             + + I K + N   E+  R+S IG+S+GGL   F I  +       F+ ++P+ F+  
Sbjct: 62  YNVLDEICKFVLNYGPEKFDRVSMIGYSMGGLVSRFIIGKMVTECRDIFQHMEPMIFMTF 121

Query: 303 SSPLLGIVTNNPA-----YV------NILLSMG--VVGKTGQDLGLQAHQGDDQPLLCSL 349
           ++P LG+    P+     YV      ++L  +G  ++G++G ++ +      D  +L  L
Sbjct: 122 ATPHLGVNFYLPSDKTRRYVSRKILTSVLSGLGRTILGRSGAEIFI---SNKDDRILVDL 178

Query: 350 PGHTTRRILRKFKKRTLYANAVNDGIVPLYTSAL 383
                   L +F  R  +AN  ND  V  YTS +
Sbjct: 179 SQGEYLYGLSRFHHRVCFANVKNDRTVAFYTSFI 212

>KLLA0F16709g 1539612..1541207 weakly similar to ca|CA1159|IPF13423
           Candida albicans unknown function, start by similarity
          Length = 531

 Score = 71.2 bits (173), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 65/208 (31%), Positives = 104/208 (50%), Gaps = 16/208 (7%)

Query: 190 HLVVLTHGL---HSNVTADMQYLKETIEQCQQYYP-NEHIVVKGFGDNVC-KTEKGIKYL 244
           HLVVL HGL    S++     YL    +    +   NE IVV     N   KT  GI   
Sbjct: 16  HLVVLVHGLWGNRSHMNEICNYLLSLNDSSAGHKSLNEMIVVHQTHLNEGYKTYDGIDVC 75

Query: 245 GGRLGEYIVKQLY---NERIKRISFIGHSLGGLTQTFAIAYIAINYPWFFEKVDPVNFVA 301
           G R+ + I  Q+    ++ + + S IG+SLGGL   +A+  +     +    ++ VNF+ 
Sbjct: 76  GIRVSKEIKDQINHYGSDHVVKFSLIGYSLGGLICRYALGVLYQAQTFKKNDIELVNFIT 135

Query: 302 LSSPLLGIVT--NNPA--YVNILLSMGVVGKTGQDLGLQAHQGDDQPLL--CSLPGHTTR 355
             +P +G++   NN A    NI++ + V+G +G+ + L+  + +  PLL   S P     
Sbjct: 136 FCTPHVGVLAPGNNVAVNLFNIIVPL-VLGNSGKQMFLK-DKYNGYPLLYVMSSPSSVFY 193

Query: 356 RILRKFKKRTLYANAVNDGIVPLYTSAL 383
           + L++FK R LYAN +ND     +TS +
Sbjct: 194 KALKQFKYRALYANIINDKRTAWWTSGI 221

>YOR059C (YOR059C) [4867] chr15 complement(438907..440259) Protein
           of unknown function, has low similarity to
           uncharacterized C. albicans Orf6.7873p [1353 bp, 450 aa]
          Length = 450

 Score = 70.9 bits (172), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 111/234 (47%), Gaps = 38/234 (16%)

Query: 186 TKPEHLVVLTHGLHSNVT--ADMQYL------KETIEQCQQYY-PNEHIVVKGFGDNVCK 236
           T  +HL VL HGL  N T    M+ +      KE +     Y+ P ++ + K F      
Sbjct: 2   TSDKHLFVLIHGLWGNYTHMESMRTILSTTLKKEDVNDDMIYFLPKQNAMFKTF------ 55

Query: 237 TEKGIKYLGGR----LGEYIVKQLYNERIKRISFIGHSLGGLTQTFAIAYIAINYPWFFE 292
              GI+ +G R    + E+I +   + +I ++S +G+S GGL   F I  +   +   FE
Sbjct: 56  --DGIEIIGYRTLIEVCEFI-RDYKDGKITKLSVMGYSQGGLVARFMIGKMLTEFKELFE 112

Query: 293 KVDPVNFVALSSPLLGIVTNNP-------AYVNILLSMG--VVGKTGQDLGLQAHQGDDQ 343
            ++P  F+ +++P LG+   NP       A  + L ++G  ++GK+G+++ +     +  
Sbjct: 113 DIEPQLFITMATPHLGVEFYNPTGIAYKSALYSALRTLGSTILGKSGREMFIANSSNN-- 170

Query: 344 PLLCSLPGHTTRRILRKFKKRTLYANAVNDGIVPLYTSALL----YLDYDSILK 393
            +L  L        L  FK R  +AN  ND  V  YT+ +     ++D+D+ LK
Sbjct: 171 -ILVKLSQGEYLEALSLFKWRIAFANVKNDRTVAFYTAFITDCDPFIDFDNKLK 223

>CAGL0L10318g complement(1103690..1105063) similar to tr|Q08448
           Saccharomyces cerevisiae YOR059c, start by similarity
          Length = 457

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 60/215 (27%), Positives = 103/215 (47%), Gaps = 20/215 (9%)

Query: 189 EHLVVLTHGLHSN---VTADMQYLKETIEQCQQYYPNEHIVVKGFGDNVCKTEKGIKYLG 245
           +HL VL HGL  N   + +  + L  T+   +     +++      +   KT  GI+ +G
Sbjct: 5   KHLFVLIHGLWGNYKHMKSLEKVLDATLNGKKSGKDKDYVFFLPKQNATFKTFDGIEIIG 64

Query: 246 GR----LGEYIVKQLYNERIKRISFIGHSLGGLTQTFAIAYIAINYPWFFEKVDPVNFVA 301
            R    L E++ K+  +  I +ISF+G+SLGGL   F +  +       F  ++   F+ 
Sbjct: 65  YRTLLELCEFM-KEFKDGNITKISFVGYSLGGLVARFVVGKMYSECNDIFGNIERCIFMT 123

Query: 302 LSSPLLGIVTNNP-AYVN--ILLS----MG--VVGKTGQDLGLQAHQGDDQPLLCSLPGH 352
           +++P LGI   NP  Y++  +L S    +G  ++GK+G++L +     D   +L  L   
Sbjct: 124 MATPHLGIQFYNPLGYLHRKLLFSTFTGLGSTILGKSGRELFIANSSND---ILVRLSEG 180

Query: 353 TTRRILRKFKKRTLYANAVNDGIVPLYTSALLYLD 387
                L +F  R L+AN  ND  V  +T  +  +D
Sbjct: 181 KYIEALEEFNHRILFANVKNDRTVAFFTGFIADVD 215

>Kwal_27.10102
          Length = 258

 Score = 64.7 bits (156), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 62/216 (28%), Positives = 103/216 (47%), Gaps = 26/216 (12%)

Query: 187 KPEHLVVLTHGLHSNVTADMQY----LKETIEQCQQYYPNEHIVV------KGFGDNVCK 236
           KP HLVVL HGL  N  + + Y    LKE+ E  +     E +VV      +G+     K
Sbjct: 12  KPCHLVVLVHGLWGN-RSHLDYMSNALKESFESREDTCSKEELVVYTPHLNEGY-----K 65

Query: 237 TEKGIKYLGGRLGEYIVKQLYN-ERIKRISFIGHSLGGLTQTFAIAYIAINYPWFFEKVD 295
           T  GI   G R+   I +Q+ +   + + S  G+SLGGL   +A+  +     +    + 
Sbjct: 66  TYDGIDVCGVRVASEIEEQIVSLGSVTKFSICGYSLGGLISRYALGVLHKRQLFKKRDIQ 125

Query: 296 PVNFVALSSPLLGIVT--NNPA--YVNILLSMGVVGKTGQDLGLQAHQ--GDDQPLLC-- 347
            VNF    +P +G+     N A    N ++ + V+G +G+ + L+       + PL+   
Sbjct: 126 LVNFTTFCTPHVGVYAPGKNVAVRLYNAIVPL-VLGSSGKQMFLKDKPKFSGELPLILSM 184

Query: 348 SLPGHTTRRILRKFKKRTLYANAVNDGIVPLYTSAL 383
           SL      + L++F+ ++LYAN +ND     +TS +
Sbjct: 185 SLENSIFYKALQEFQTKSLYANVINDKRTAWWTSGI 220

>Sklu_2393.4 , Contig c2393 3530-5170 reverse complement
          Length = 546

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 99/216 (45%), Gaps = 19/216 (8%)

Query: 186 TKPEHLVVLTHGLHSNVTADMQYLKETIEQCQQYY---------PNEHIVVKGFGDNVC- 235
           +K  HLVVL HGL  N  +   Y+  +I+   + +           E IVV     N   
Sbjct: 6   SKDYHLVVLVHGLWGN-GSHFDYISNSIDTSLKTHDVFQPGGKLAGEEIVVYTTCLNEGY 64

Query: 236 KTEKGIKYLGGRLGEYIVKQLYN-ERIKRISFIGHSLGGLTQTFAIAYIAINYPWFFEKV 294
           KT  GI   G R+ + I  Q+     + + S +G+SLGGL   +A+  +     +    +
Sbjct: 65  KTYDGIDVCGLRVAKEIEDQIETLGSVIKFSLVGYSLGGLIARYALGILYKKQLFKKHDI 124

Query: 295 DPVNFVALSSPLLGIVT-NNPAYVNILLSM--GVVGKTGQDLGL--QAHQGDDQPL--LC 347
           + +NF    +P +G+        VN+  ++   V+G +G+ + L  Q     + PL  L 
Sbjct: 125 ELINFTTFCTPHVGVYAPGKNIAVNLFNTIVPFVLGNSGKQMFLKDQVRSAGNLPLVYLM 184

Query: 348 SLPGHTTRRILRKFKKRTLYANAVNDGIVPLYTSAL 383
           S+      + L++FK + LYAN +ND     +TS +
Sbjct: 185 SMENSVFYKALQEFKYKALYANVINDKRTAWWTSGI 220

>Sklu_2232.4 YOR059C, Contig c2232 3289-4626
          Length = 445

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 63/217 (29%), Positives = 98/217 (45%), Gaps = 24/217 (11%)

Query: 189 EHLVVLTHGLHSNVTADMQYLKETIEQCQQYYPNEHIVVKGFGDN-VCKTEKGIKYLGGR 247
           +HL VL HGL  N    M  +K    +    + +E+++      N   KT  GI+ +G R
Sbjct: 4   KHLFVLVHGLWGNY-KHMDSIKGVFSKT---FGDENVIFFAPKQNGYFKTFDGIEIVGYR 59

Query: 248 ----LGEYIVKQLYNERIKRISFIGHSLGGLTQTFAIAYIAINYPWFFEKVDPVNFVALS 303
               L E+I K     +I +ISFIG+S+GGL   F I  +       FE ++   F+  +
Sbjct: 60  TLLELCEFIRKYGVG-KITKISFIGYSMGGLISRFIIGKMETECQELFEGINRQLFITFA 118

Query: 304 SPLLGI----------VTNNPAYVNILLSM---GVVGKTGQDLGLQAHQGDDQPLLCSLP 350
           +P LG+           T +  +++ +LS     V+G++G+ L ++     D  L+  L 
Sbjct: 119 TPHLGVEFYLPKEKPLQTRSRRFLHSVLSFLGSTVLGRSGRQLFIRDKHSWDSTLV-KLS 177

Query: 351 GHTTRRILRKFKKRTLYANAVNDGIVPLYTSALLYLD 387
                  L  FK R   AN  ND  V  YTS +   D
Sbjct: 178 SDEYLLGLSAFKYRICIANVKNDRTVAFYTSFITDCD 214

>ADR202C [1943] [Homologous to ScYOR059C - SH] (1060157..1061488)
           [1332 bp, 443 aa]
          Length = 443

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 61/219 (27%), Positives = 96/219 (43%), Gaps = 31/219 (14%)

Query: 189 EHLVVLTHGL---HSNVTADMQYLKETIEQCQQYYPNEHIVVKGFGDNVCKTEKGIKYLG 245
           +HL VL HGL   HS++ +      E +     +Y           +   KT  GI+ +G
Sbjct: 5   KHLFVLVHGLWGTHSHMNSIKTAFSEALGDDAVFYVPR-------SNGYVKTLHGIELVG 57

Query: 246 GR----LGEYIVKQLYNERIKRISFIGHSLGGLTQTFAIAYIAINYPWFFEKVDPVNFVA 301
            +    L E+ V+    ++  RISFIG+S+GGL   F I  I       F  + PV F+ 
Sbjct: 58  YQTVVELTEF-VQARDPQKFDRISFIGYSMGGLVSRFVIGTIFTECRVIFGHMRPVLFMT 116

Query: 302 LSSPLLGIVTNNP-----------AYVNILLSMG--VVGKTGQDLGLQAHQGDDQPLLCS 348
            ++P LG+    P           A + +   +G   +G++G+ L L A++ DD   L  
Sbjct: 117 FATPHLGVQFYQPRNPQAKSTVMGAVLPVARFVGSHFLGRSGRQLFL-AYENDDT--LVR 173

Query: 349 LPGHTTRRILRKFKKRTLYANAVNDGIVPLYTSALLYLD 387
           +        L +F+ R   AN  ND  V  YT+ +   D
Sbjct: 174 MTEGVYLEQLARFRHRVCLANVKNDRTVAFYTAFITDCD 212

>Scas_698.39
          Length = 471

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 61/228 (26%), Positives = 105/228 (46%), Gaps = 41/228 (17%)

Query: 187 KPEHLVVLTHGLHSNVTADMQYLKETIEQCQQ----------YYPNEHIVVKGFGDNVCK 236
           K  HL +L HGL  N    M+ LKET++   Q          + P ++ + K F      
Sbjct: 14  KDAHLFILLHGLWGNY-KHMESLKETLKNSIQDDTDRLPLVFFSPRQNAMFKTF------ 66

Query: 237 TEKGIKYLGGRLGEYIVK--QLYNE-RIKRISFIGHSLGGLTQTFAIAYIAI-----NYP 288
              G++ +G R    I++  QL+ E +  ++S +G+S+GGL   F I  +       +  
Sbjct: 67  --DGVEVVGYRALIEIIQFIQLHPEFKFTKLSILGYSMGGLIARFLIGVMFDKNNDEDEM 124

Query: 289 WFFEKVDPVNFVALSSPLLGIVTNNP------AYVNILLSM---GVVGKTGQDLGLQAHQ 339
             F+ ++P  F+  ++P LGI   NP       ++N +L++    ++G +G+++ +  + 
Sbjct: 125 KVFKGMEPQLFITFATPHLGIHFYNPLNNMLRTFLNPMLTLIGSNIIGVSGREMFIMRNT 184

Query: 340 GDDQPLLCSLPGHTTRRILRKFKKRTLYANAVNDGIVPLYTSALLYLD 387
                 L  L        L KFK R ++AN  ND  V  YTS +   D
Sbjct: 185 E-----LVELSSGKYLDALSKFKWRIVFANVKNDRTVAFYTSFITDCD 227

>KLLA0B07667g 667863..673862 weakly similar to sp|P25356
           Saccharomyces cerevisiae YCR032w BPH1g to human
           beige-like protein and mouse lysosomal trafficking
           regulator singleton, start by similarity
          Length = 1999

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 44/91 (48%), Gaps = 14/91 (15%)

Query: 366 LYANAVNDGIVPLYTSALLYLDYDSI------LKQLDT--QEYQVDKQDFFTKTL-INPL 416
           LY N  NDG +     +   L    I      L+ LD+   +YQ+D +DF  K++ IN  
Sbjct: 556 LYCNIRNDGTIVHLQFSYFCLKKGHITLAKVLLESLDSVFTQYQIDDRDFLCKSIPINLY 615

Query: 417 VKAINVLMPQTQSSSSIPKVSMFDSAMSVLL 447
           VK I +LM      SSI  + +   A S+LL
Sbjct: 616 VKVIFILM-----QSSIQHLEILKVAYSILL 641

>Scas_641.5
          Length = 593

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 11/38 (28%), Positives = 23/38 (60%)

Query: 356 RILRKFKKRTLYANAVNDGIVPLYTSALLYLDYDSILK 393
           R++     +  +  ++ND +VPLY+S  L+ D+ +I +
Sbjct: 408 RVIIANNVKITFVGSINDQLVPLYSSMCLFADHPNIFR 445

>Kwal_47.18512
          Length = 625

 Score = 30.0 bits (66), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 11/38 (28%), Positives = 23/38 (60%)

Query: 356 RILRKFKKRTLYANAVNDGIVPLYTSALLYLDYDSILK 393
           R++     +  +  ++ND +VPLY+S  L+ ++ +I K
Sbjct: 440 RLIIASNVKVTFVGSINDQLVPLYSSTCLFANHPNIFK 477

>CAGL0F04873g 491732..493813 similar to sp|P32486 Saccharomyces
           cerevisiae YPR159w KRE6, hypothetical start
          Length = 693

 Score = 30.0 bits (66), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 23/114 (20%), Positives = 50/114 (43%), Gaps = 7/114 (6%)

Query: 380 TSALLYLDYDS----ILKQLDTQEYQVDKQDFFTKTLINPLVKAINVLMPQTQSSSSIPK 435
           +S+ ++ D D+     L+ LD Q +  D + +++K      +   N   P   +S     
Sbjct: 40  SSSFIHYDRDASRQAALEGLDGQRHVSDYKGYYSKNNTAQNLNTGNGNTPNLDNSKRYFS 99

Query: 436 VSMFDSAMS---VLLPPLPEKSYLMNPSGDPSVILHDKMYSEADIPEVGQPPEK 486
            +  ++ ++   +L PP  ++  L+      S  LH + YS + +P +   P+ 
Sbjct: 100 QTSLNTGLTRNDILSPPEFDRYPLVGSRVASSTQLHQQAYSSSPVPRMASSPDN 153

>Scas_663.8
          Length = 604

 Score = 29.6 bits (65), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 35/56 (62%), Gaps = 3/56 (5%)

Query: 367 YANAVNDGIVPLYTSALLYLDYDSILKQLDTQEYQVD--KQDFFTKT-LINPLVKA 419
           + N +NDG +P Y +A LY+  +    + +++++ +D   +  FTK+ L++ LVK+
Sbjct: 94  WVNEINDGKIPYYENAKLYVSTEIGNGKYNSRDFGIDISPKILFTKSDLLSILVKS 149

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.135    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 21,814,417
Number of extensions: 993863
Number of successful extensions: 2940
Number of sequences better than 10.0: 43
Number of HSP's gapped: 2907
Number of HSP's successfully gapped: 49
Length of query: 632
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 524
Effective length of database: 12,857,365
Effective search space: 6737259260
Effective search space used: 6737259260
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)