Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL284C42241420500.0
KLLA0E14850g39636713650.0
Sklu_1484.339936912841e-177
Kwal_23.346740037712651e-174
Scas_618.1340736612401e-170
YGL143C (MRF1)41336412241e-167
CAGL0E04928g40536111181e-151
Kwal_56.23313158781122e-06
YLR281C155941095e-06
AGR281C176791071e-05
Sklu_2044.5123491032e-05
KLLA0C04642g168781042e-05
Scas_590.111649978e-05
CAGL0F05027g187781019e-05
KLLA0C02717g118685691.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL284C
         (414 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL284C [1457] [Homologous to ScYGL143C (MRF1) - SH] (203883..20...   794   0.0  
KLLA0E14850g 1324910..1326100 gi|1172907|sp|P41767|RF1M_KLULA Kl...   530   0.0  
Sklu_1484.3 YGL143C, Contig c1484 4090-5289                           499   e-177
Kwal_23.3467                                                          491   e-174
Scas_618.13                                                           482   e-170
YGL143C (MRF1) [1844] chr7 complement(234720..235961) Mitochondr...   476   e-167
CAGL0E04928g 476972..478189 similar to sp|P30775 Saccharomyces c...   435   e-151
Kwal_56.23313                                                          48   2e-06
YLR281C (YLR281C) [3672] chr12 complement(704495..704962) Protei...    47   5e-06
AGR281C [4592] [Homologous to ScYLR281C - SH] (1270719..1271249)...    46   1e-05
Sklu_2044.5 YLR281C, Contig c2044 6176-6547                            44   2e-05
KLLA0C04642g complement(427221..427727) some similarities with s...    45   2e-05
Scas_590.1                                                             42   8e-05
CAGL0F05027g complement(512367..512930) similar to tr|Q05863 Sac...    44   9e-05
KLLA0C02717g complement(242948..246508) weakly similar to sp|P38...    31   1.7  

>ADL284C [1457] [Homologous to ScYGL143C (MRF1) - SH]
           (203883..205151) [1269 bp, 422 aa]
          Length = 422

 Score =  794 bits (2050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/414 (93%), Positives = 386/414 (93%)

Query: 1   MQSEKLDNFAASSALRYQENGATRTMXXXXXXXXXXXXXXPVSVRCYSQAEGFRELHPSL 60
           MQSEKLDNFAASSALRYQENGATRTM              PVSVRCYSQAEGFRELHPSL
Sbjct: 1   MQSEKLDNFAASSALRYQENGATRTMALRFGRLLLLGRALPVSVRCYSQAEGFRELHPSL 60

Query: 61  IKRATGYAAELETLEKLLSKGESFDVEKQKKYSKLSSIVDTFRAYQDNVHMYRELQDMIA 120
           IKRATGYAAELETLEKLLSKGESFDVEKQKKYSKLSSIVDTFRAYQDNVHMYRELQDMIA
Sbjct: 61  IKRATGYAAELETLEKLLSKGESFDVEKQKKYSKLSSIVDTFRAYQDNVHMYRELQDMIA 120

Query: 121 QDASLRTEAQAELDELAPTLARSADTLLDKLLPPHPFAEKPCIVELRPGVGGIEAMIFTQ 180
           QDASLRTEAQAELDELAPTLARSADTLLDKLLPPHPFAEKPCIVELRPGVGGIEAMIFTQ
Sbjct: 121 QDASLRTEAQAELDELAPTLARSADTLLDKLLPPHPFAEKPCIVELRPGVGGIEAMIFTQ 180

Query: 181 DLLNMYIGYAQHHRWKWSVTSATENTTGAGLSEAILSIDEPGSYDRVKFESGVHRVQRIP 240
           DLLNMYIGYAQHHRWKWSVTSATENTTGAGLSEAILSIDEPGSYDRVKFESGVHRVQRIP
Sbjct: 181 DLLNMYIGYAQHHRWKWSVTSATENTTGAGLSEAILSIDEPGSYDRVKFESGVHRVQRIP 240

Query: 241 ATESKGRTHTSTAAVVVLPKMAEEAESDAYERTFKPGEIRIDVMRASGKGGQHVNTTDSA 300
           ATESKGRTHTSTAAVVVLPKMAEEAESDAYERTFKPGEIRIDVMRASGKGGQHVNTTDSA
Sbjct: 241 ATESKGRTHTSTAAVVVLPKMAEEAESDAYERTFKPGEIRIDVMRASGKGGQHVNTTDSA 300

Query: 301 VRITHFPSGIAIHMQEERSQHRNKAKAFQILRAKLADLXXXXXXXXXXXXXXDQVSSTDR 360
           VRITHFPSGIAIHMQEERSQHRNKAKAFQILRAKLADL              DQVSSTDR
Sbjct: 301 VRITHFPSGIAIHMQEERSQHRNKAKAFQILRAKLADLERKEREARERSARKDQVSSTDR 360

Query: 361 SDKIRTYNFPQNRVTDHRCAVSLHALAEVVTGERLDELIDSMARYDSEQKAKLL 414
           SDKIRTYNFPQNRVTDHRCAVSLHALAEVVTGERLDELIDSMARYDSEQKAKLL
Sbjct: 361 SDKIRTYNFPQNRVTDHRCAVSLHALAEVVTGERLDELIDSMARYDSEQKAKLL 414

>KLLA0E14850g 1324910..1326100 gi|1172907|sp|P41767|RF1M_KLULA
           Kluyveromyces lactis Peptide chain release factor 1,
           mitochondrial precursor (MRF-1), start by similarity
          Length = 396

 Score =  530 bits (1365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/367 (67%), Positives = 301/367 (82%)

Query: 48  SQAEGFRELHPSLIKRATGYAAELETLEKLLSKGESFDVEKQKKYSKLSSIVDTFRAYQD 107
           S+A  FR LH SLI RA  Y  EL  LE LLS+G SFD+EKQK ++KLS+IVD++  Y++
Sbjct: 24  SEAVEFRPLHSSLISRAELYVNELRELEDLLSQGGSFDLEKQKNFAKLSTIVDSYSKYRE 83

Query: 108 NVHMYRELQDMIAQDASLRTEAQAELDELAPTLARSADTLLDKLLPPHPFAEKPCIVELR 167
            V+ Y+ELQ+++  D SLR EA+A++  L P L ++ D+LL+KLLPPHPFA+KP I+ELR
Sbjct: 84  EVNQYKELQEILELDPSLREEAEADIAALLPDLNKTGDSLLNKLLPPHPFADKPSILELR 143

Query: 168 PGVGGIEAMIFTQDLLNMYIGYAQHHRWKWSVTSATENTTGAGLSEAILSIDEPGSYDRV 227
           PGVGG EAMIFTQDLLNMYI YA +H+WKW++ S TEN +G+G+ EAIL+IDEPGSYD++
Sbjct: 144 PGVGGSEAMIFTQDLLNMYINYANYHKWKWNLISKTENASGSGVLEAILNIDEPGSYDKL 203

Query: 228 KFESGVHRVQRIPATESKGRTHTSTAAVVVLPKMAEEAESDAYERTFKPGEIRIDVMRAS 287
           KFE+GVHRVQR+PATESKGRTHTSTAAV+VLPKM EE+ESDAYERTFKP EIRIDVMRAS
Sbjct: 204 KFEAGVHRVQRVPATESKGRTHTSTAAVIVLPKMGEESESDAYERTFKPDEIRIDVMRAS 263

Query: 288 GKGGQHVNTTDSAVRITHFPSGIAIHMQEERSQHRNKAKAFQILRAKLADLXXXXXXXXX 347
           GKGGQHVNTTDSAVR+TH+PSGI I MQEERSQHRNKAKAF ILRA+LA+          
Sbjct: 264 GKGGQHVNTTDSAVRLTHYPSGIVISMQEERSQHRNKAKAFAILRARLAEKERLEKEEKE 323

Query: 348 XXXXXDQVSSTDRSDKIRTYNFPQNRVTDHRCAVSLHALAEVVTGERLDELIDSMARYDS 407
                DQVS+TDRSDKIRTYN+PQNR+TDHRC  +L+ +  V+ GERLD++ID+M  + S
Sbjct: 324 RNARKDQVSTTDRSDKIRTYNYPQNRITDHRCGFTLYDIEGVMKGERLDDVIDAMDAFSS 383

Query: 408 EQKAKLL 414
           EQKAK L
Sbjct: 384 EQKAKQL 390

>Sklu_1484.3 YGL143C, Contig c1484 4090-5289
          Length = 399

 Score =  499 bits (1284), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 243/369 (65%), Positives = 299/369 (81%), Gaps = 2/369 (0%)

Query: 48  SQAEGFRELHPSLIKRATGYAAELETLEKLLSKGESFDVEKQKKYSKLSSIVDTFRAYQD 107
           ++A  F+ELHP LIKRA  +  EL  LE LLSKG SFDVE+QKK+++LSSIVDTF+ Y+D
Sbjct: 23  TEAIEFKELHPLLIKRAEKHVDELNKLEGLLSKGSSFDVERQKKFAELSSIVDTFQNYKD 82

Query: 108 NVHMYRELQDMIAQDASLRTEAQAELDELAPTLARSADTLLDKLLPPHPFAEKPCIVELR 167
            +  Y++L+DMI QD SL  EA+ EL+E+ P L +S+ +LL+KLLPPHPFA+KPCI+ELR
Sbjct: 83  GLDNYKDLKDMIQQDPSLEKEARIELEEIMPALIKSSSSLLNKLLPPHPFADKPCILELR 142

Query: 168 PGVGGIEAMIFTQDLLNMYIGYAQHHRWKWSVTSATENTTGAGLSEAILSIDEPGSYDRV 227
           PGVGG EAMIF QDLL+MYI YA   RWK+ +TS +EN +G+G+ +AILSIDEPGSY+++
Sbjct: 143 PGVGGTEAMIFAQDLLHMYINYAHTKRWKYHITSKSENESGSGILDAILSIDEPGSYNKL 202

Query: 228 KFESGVHRVQRIPATESKGRTHTSTAAVVVLPKMAEEA--ESDAYERTFKPGEIRIDVMR 285
           +FE+GVHRVQRIPATE+KGRTHTSTAAV+VLP+M EE+  E+DAYERTFKP EIRIDVMR
Sbjct: 203 RFEAGVHRVQRIPATETKGRTHTSTAAVIVLPQMGEESEKEADAYERTFKPDEIRIDVMR 262

Query: 286 ASGKGGQHVNTTDSAVRITHFPSGIAIHMQEERSQHRNKAKAFQILRAKLADLXXXXXXX 345
           A GKGGQHVNTTDSAVR+THFPSGI I MQ ERSQH+NKAKAF ILRAKLA+        
Sbjct: 263 ARGKGGQHVNTTDSAVRLTHFPSGIVISMQNERSQHKNKAKAFAILRAKLAERERKEKEE 322

Query: 346 XXXXXXXDQVSSTDRSDKIRTYNFPQNRVTDHRCAVSLHALAEVVTGERLDELIDSMARY 405
                   QV++TDRSDKIRTYNFPQNR+TDHRC  +LH +  V+ GERLD++I++M RY
Sbjct: 323 SARAARKGQVTTTDRSDKIRTYNFPQNRITDHRCGFNLHNIDGVMAGERLDDVIEAMERY 382

Query: 406 DSEQKAKLL 414
           +   K+K L
Sbjct: 383 EGATKSKEL 391

>Kwal_23.3467
          Length = 400

 Score =  491 bits (1265), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 240/377 (63%), Positives = 303/377 (80%), Gaps = 4/377 (1%)

Query: 42  VSVRCYSQAEG-FRELHPSLIKRATGYAAELETLEKLLSKGE-SFDVEKQKKYSKLSSIV 99
           +S+RCYS  +  F+ELHP L+KRA  Y  EL+ LE+ ++KG  SFDVE+QKK+SKLS++V
Sbjct: 16  LSLRCYSNTDTEFKELHPLLLKRAEKYVEELQKLEEWMAKGGGSFDVERQKKFSKLSAVV 75

Query: 100 DTFRAYQDNVHMYRELQDMIAQDASLRTEAQAELDELAPTLARSADTLLDKLLPPHPFAE 159
           D+FR Y   V  ++ELQDM+  D SLR EA+ EL ++ P L ++A +LL +LLPPHPFA+
Sbjct: 76  DSFRIYSREVSTFKELQDMVKDDPSLRDEAELELVQIKPQLEKTASSLLTQLLPPHPFAD 135

Query: 160 KPCIVELRPGVGGIEAMIFTQDLLNMYIGYAQHHRWKWSVTSATENTTGAGLSEAILSID 219
           +PCI+E+RPGVGGIEAMIF QDLLNMYI +A   RWK+ + S++EN +G+G+ +AILSID
Sbjct: 136 RPCILEIRPGVGGIEAMIFAQDLLNMYINFAHIKRWKYHLISSSENESGSGIVDAILSID 195

Query: 220 EPGSYDRVKFESGVHRVQRIPATESKGRTHTSTAAVVVLPKMAE--EAESDAYERTFKPG 277
           EPGSY+ ++FESGVHRVQRIPATE+KGRTHTSTAAVVVLP+MAE  E E+D+YERTFKP 
Sbjct: 196 EPGSYEMLRFESGVHRVQRIPATETKGRTHTSTAAVVVLPQMAEDSEKEADSYERTFKPD 255

Query: 278 EIRIDVMRASGKGGQHVNTTDSAVRITHFPSGIAIHMQEERSQHRNKAKAFQILRAKLAD 337
           EIRIDVMRA GKGGQHVNTTDSAVR+TH+PSGI I+MQ ERSQH+NKAKAF ILRA+LA+
Sbjct: 256 EIRIDVMRARGKGGQHVNTTDSAVRLTHYPSGIVINMQNERSQHKNKAKAFAILRARLAE 315

Query: 338 LXXXXXXXXXXXXXXDQVSSTDRSDKIRTYNFPQNRVTDHRCAVSLHALAEVVTGERLDE 397
                           QV++TDRSDKIRTYNFPQNRVTDHRC  +LH +  ++ GERL++
Sbjct: 316 AERKEKEEKARALRKGQVTTTDRSDKIRTYNFPQNRVTDHRCGFNLHDMEGIMAGERLED 375

Query: 398 LIDSMARYDSEQKAKLL 414
           +I +M+ YDS+ +AK L
Sbjct: 376 VISAMSVYDSDSRAKEL 392

>Scas_618.13
          Length = 407

 Score =  482 bits (1240), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 223/366 (60%), Positives = 287/366 (78%), Gaps = 2/366 (0%)

Query: 50  AEGFRELHPSLIKRATGYAAELETLEKLLSKGESFDVEKQKKYSKLSSIVDTFRAYQDNV 109
           + G  EL P+LI +AT Y  EL  L K LS+GE+FDV +QK+++ L+SI D F+ YQ  +
Sbjct: 40  SNGHVELQPALISKATEYMKELAELNKQLSQGETFDVAQQKRFAHLASIEDAFQTYQTQL 99

Query: 110 HMYRELQDMIAQDASLRTEAQAELDELAPTLARSADTLLDKLLPPHPFAEKPCIVELRPG 169
             Y+ LQ++   D SL+ EAQ EL EL P L+++ + L  +L+PPHPFA+K CI+ELRPG
Sbjct: 100 SNYKSLQELAQSDPSLKEEAQLELTELVPQLSQTMNELQSRLIPPHPFADKACILELRPG 159

Query: 170 VGGIEAMIFTQDLLNMYIGYAQHHRWKWSVTSATENTTGAGLSEAILSIDEPGSYDRVKF 229
           VGG EAMIFTQDLLNMYIGYA  H+WK+ + +  EN +G GL +AIL+IDEPGSYD+++F
Sbjct: 160 VGGTEAMIFTQDLLNMYIGYAHSHKWKYRILAQDENESGDGLVDAILNIDEPGSYDKLRF 219

Query: 230 ESGVHRVQRIPATESKGRTHTSTAAVVVLPKMAEEAES--DAYERTFKPGEIRIDVMRAS 287
           ESGVHRVQRIPATE+KGRTHTSTAAVVVLP+M ++++   +AYERTFKP EIRIDVMRA 
Sbjct: 220 ESGVHRVQRIPATETKGRTHTSTAAVVVLPQMGDDSDRAINAYERTFKPDEIRIDVMRAR 279

Query: 288 GKGGQHVNTTDSAVRITHFPSGIAIHMQEERSQHRNKAKAFQILRAKLADLXXXXXXXXX 347
           GKGGQHVNTTDSAVR+THFP+GI + MQ+ERSQ +NKAKAF ILRA+LA+          
Sbjct: 280 GKGGQHVNTTDSAVRLTHFPTGIVVSMQDERSQQKNKAKAFTILRARLAEREQKLKEEKE 339

Query: 348 XXXXXDQVSSTDRSDKIRTYNFPQNRVTDHRCAVSLHALAEVVTGERLDELIDSMARYDS 407
                +QV++TDRSDKIRTYN+PQNRVTDHRC ++L+AL  ++ GERL E+ID+M ++D 
Sbjct: 340 RDARKEQVTTTDRSDKIRTYNYPQNRVTDHRCGLTLYALDAIMKGERLGEVIDAMRQFDD 399

Query: 408 EQKAKL 413
            ++A+L
Sbjct: 400 RERARL 405

>YGL143C (MRF1) [1844] chr7 complement(234720..235961) Mitochondrial
           peptide chain release factor, directs termination of
           translation in response to termination codons UAA and
           UAG [1242 bp, 413 aa]
          Length = 413

 Score =  476 bits (1224), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 225/364 (61%), Positives = 287/364 (78%), Gaps = 2/364 (0%)

Query: 53  FRELHPSLIKRATGYAAELETLEKLLSKGESFDVEKQKKYSKLSSIVDTFRAYQDNVHMY 112
           + EL P L+K+A  Y AEL+ L+K LS G  FDV KQK Y+KLS++ DTF  Y++ ++  
Sbjct: 46  YTELSPLLVKQAEKYEAELKDLDKDLSCGIHFDVNKQKHYAKLSALTDTFIEYKEKLNEL 105

Query: 113 RELQDMIAQDASLRTEAQAELDELAPTLARSADTLLDKLLPPHPFAEKPCIVELRPGVGG 172
           + LQ+MI  D SLR EA+ E  EL P    ++  L++KLLPPHPFA+KP ++ELRPGVGG
Sbjct: 106 KSLQEMIVSDPSLRAEAEQEYAELVPQYETTSSRLVNKLLPPHPFADKPSLLELRPGVGG 165

Query: 173 IEAMIFTQDLLNMYIGYAQHHRWKWSVTSATENTTGAGLSEAILSIDEPGSYDRVKFESG 232
           IEAMIFTQ+LL+MYIGYA + +WK+ + S  EN +G+G+ +AILSI+E GSYDR++FE+G
Sbjct: 166 IEAMIFTQNLLDMYIGYANYRKWKYRIISKNENESGSGIIDAILSIEEAGSYDRLRFEAG 225

Query: 233 VHRVQRIPATESKGRTHTSTAAVVVLPKMAEEAES--DAYERTFKPGEIRIDVMRASGKG 290
           VHRVQRIP+TE+KGRTHTSTAAVVVLP++ +E+    DAYERTFKPGEIR+D+MRASGKG
Sbjct: 226 VHRVQRIPSTETKGRTHTSTAAVVVLPQIGDESAKSIDAYERTFKPGEIRVDIMRASGKG 285

Query: 291 GQHVNTTDSAVRITHFPSGIAIHMQEERSQHRNKAKAFQILRAKLADLXXXXXXXXXXXX 350
           GQHVNTTDSAVR+TH PSGI + MQ+ERSQH+NKAKAF ILRA+LA+             
Sbjct: 286 GQHVNTTDSAVRLTHIPSGIVVSMQDERSQHKNKAKAFTILRARLAEKERLEKEEKERKA 345

Query: 351 XXDQVSSTDRSDKIRTYNFPQNRVTDHRCAVSLHALAEVVTGERLDELIDSMARYDSEQK 410
              QVSST+RSDKIRTYNFPQNR+TDHRC  +L  L  V++GERLDE+I++M++YDS ++
Sbjct: 346 RKSQVSSTNRSDKIRTYNFPQNRITDHRCGFTLLDLPGVLSGERLDEVIEAMSKYDSTER 405

Query: 411 AKLL 414
           AK L
Sbjct: 406 AKEL 409

>CAGL0E04928g 476972..478189 similar to sp|P30775 Saccharomyces
           cerevisiae YGL143c MRF1 peptide chain release factor,
           hypothetical start
          Length = 405

 Score =  435 bits (1118), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 212/361 (58%), Positives = 278/361 (77%), Gaps = 3/361 (0%)

Query: 53  FRELHPSLIKRATGYAAELETLEKLLSKGESFDVEKQKKYSKLSSIVDTFRAYQDNVHMY 112
           F+EL+P L+KR +G + EL  LEK +S G  +D + Q+KY+ L S+ D +  Y++ +  Y
Sbjct: 39  FQELNPLLLKRVSGVSKELAELEKQISNG--YDEDVQRKYNSLMSLQDVYDRYKEQLGNY 96

Query: 113 RELQDMIAQDASLRTEAQAELDELAPTLARSADTLLDKLLPPHPFAEKPCIVELRPGVGG 172
           REL++MI  D SL  EA AEL EL P L ++   LL +L+PPHPFAEK C++ELRPGVGG
Sbjct: 97  RELKEMIDVDKSLAEEAAAELHELVPNLKKTTQDLLHRLIPPHPFAEKACMLELRPGVGG 156

Query: 173 IEAMIFTQDLLNMYIGYAQHHRWKWSVTSATENTTGAGLSEAILSIDEPGSYDRVKFESG 232
            EAMIF +DLLNMYIGYA + +WK  + S  EN  G+G+ +A+L+IDEPG+Y+ +K+E+G
Sbjct: 157 SEAMIFAKDLLNMYIGYAHNKKWKHHIVSIRENEAGSGIMDAVLAIDEPGTYNILKYEAG 216

Query: 233 VHRVQRIPATESKGRTHTSTAAVVVLPKMAEEAES-DAYERTFKPGEIRIDVMRASGKGG 291
           VHRVQRIPATESKGRTHTSTAAVVVLP++ +E +  DA+ER+FKP EIRIDV RASGKGG
Sbjct: 217 VHRVQRIPATESKGRTHTSTAAVVVLPQLGDEGKDLDAFERSFKPEEIRIDVKRASGKGG 276

Query: 292 QHVNTTDSAVRITHFPSGIAIHMQEERSQHRNKAKAFQILRAKLADLXXXXXXXXXXXXX 351
           QHVNTT+SAVR+TH P+GI IHMQ+ERSQHRNKAKAF ILR+KLA+L             
Sbjct: 277 QHVNTTESAVRLTHIPTGIMIHMQDERSQHRNKAKAFSILRSKLAELEQQQKAEKERQVR 336

Query: 352 XDQVSSTDRSDKIRTYNFPQNRVTDHRCAVSLHALAEVVTGERLDELIDSMARYDSEQKA 411
            +QV++ DRSDKIRTYNF QNR+TDHRC ++L+ L  V++GERLD++I+++  +D   +A
Sbjct: 337 KEQVTTMDRSDKIRTYNFSQNRITDHRCGLNLYDLEGVISGERLDDVINAVRSFDDNIQA 396

Query: 412 K 412
           +
Sbjct: 397 E 397

>Kwal_56.23313
          Length = 158

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 41/78 (52%), Gaps = 13/78 (16%)

Query: 259 PKMAEEAESDAYERTFKPGEIRIDVMRASGKGGQHVNTTDSAVRITHFPSGIAIHMQEER 318
           PK  +E E+D  E+    G          G GGQ +N  +S V++ H P+GI +  QE R
Sbjct: 29  PKFLQEMEADIEEKFLHGGR---------GPGGQKINKCNSKVQLRHLPTGIVVECQETR 79

Query: 319 SQHRNKAKAFQILRAKLA 336
           S+ +N+    ++ R KLA
Sbjct: 80  SRDQNR----RLARNKLA 93

>YLR281C (YLR281C) [3672] chr12 complement(704495..704962) Protein
           containing a peptidyl-tRNA hydrolase domain, which
           contain peptidyl-tRNA hydrolase activity [468 bp, 155
           aa]
          Length = 155

 Score = 46.6 bits (109), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 47/94 (50%), Gaps = 21/94 (22%)

Query: 251 STAAVVVL--------PKMAEEAESDAYERTFKPGEIRIDVMRASGKGGQHVNTTDSAVR 302
           S+AAV+++        PK   E E+   E+    G          G GGQ +N  +S V+
Sbjct: 11  SSAAVLLIKKNKLPPRPKFTPEMEAQCTEKFLHGG---------RGPGGQKINKCNSKVQ 61

Query: 303 ITHFPSGIAIHMQEERSQHRNKAKAFQILRAKLA 336
           + H P+GI +  QE RS+ +N+    ++ R KLA
Sbjct: 62  LRHEPTGIVVECQETRSREQNR----KLARLKLA 91

>AGR281C [4592] [Homologous to ScYLR281C - SH] (1270719..1271249)
           [531 bp, 176 aa]
          Length = 176

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 38/79 (48%), Gaps = 9/79 (11%)

Query: 259 PKMAEEAESDAYERTFKPGEIRIDVMRASGKGGQHVNTTDSAVRITHFPSGIAIHMQEER 318
           PK   E E+   E+    G          G GGQ +N  +S V++ H PSGI I  Q  R
Sbjct: 43  PKWTPEMEASIEEKFLHGGR---------GPGGQKINKCNSKVQLRHVPSGIVIECQATR 93

Query: 319 SQHRNKAKAFQILRAKLAD 337
           S+ +N+  A + L A LA 
Sbjct: 94  SREQNRKLAREKLAAALAQ 112

>Sklu_2044.5 YLR281C, Contig c2044 6176-6547
          Length = 123

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/49 (44%), Positives = 31/49 (63%)

Query: 288 GKGGQHVNTTDSAVRITHFPSGIAIHMQEERSQHRNKAKAFQILRAKLA 336
           G GGQ +N  +S V++ H P+GI +  QE RS+ +N+  A Q L  KLA
Sbjct: 15  GPGGQKINKCNSKVQLKHLPTGIVVECQETRSRDQNRTIARQKLALKLA 63

>KLLA0C04642g complement(427221..427727) some similarities with
           sgd|S0004271 Saccharomyces cerevisiae YLR281c,
           hypothetical start
          Length = 168

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 9/78 (11%)

Query: 259 PKMAEEAESDAYERTFKPGEIRIDVMRASGKGGQHVNTTDSAVRITHFPSGIAIHMQEER 318
           PK  ++ E D  E+    G          G GGQ +N  +S V++ H P+GI +  Q  R
Sbjct: 38  PKFTDDMERDIEEKFLHGGR---------GPGGQKINKCNSKVQLRHVPTGIVVDCQATR 88

Query: 319 SQHRNKAKAFQILRAKLA 336
           S+ +N+  A + L  +LA
Sbjct: 89  SRDQNRKIAREKLALRLA 106

>Scas_590.1
          Length = 116

 Score = 42.0 bits (97), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 31/49 (63%), Gaps = 4/49 (8%)

Query: 288 GKGGQHVNTTDSAVRITHFPSGIAIHMQEERSQHRNKAKAFQILRAKLA 336
           G GGQ +N  +S V++ H P+GI +  QE RS+ +N+    ++ R KLA
Sbjct: 3   GAGGQKINKCNSKVQLKHVPTGIIVSCQETRSRDQNR----KLARDKLA 47

>CAGL0F05027g complement(512367..512930) similar to tr|Q05863
           Saccharomyces cerevisiae YLR281c, hypothetical start
          Length = 187

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 38/78 (48%), Gaps = 13/78 (16%)

Query: 259 PKMAEEAESDAYERTFKPGEIRIDVMRASGKGGQHVNTTDSAVRITHFPSGIAIHMQEER 318
           PK     E+D  E+    G         +G GGQ +N  +S V+I H PS I +  Q  R
Sbjct: 41  PKFDASMEADIEEKFLHGG---------TGPGGQKINKCNSKVQIKHVPSNIVVTCQATR 91

Query: 319 SQHRNKAKAFQILRAKLA 336
           S+ +N+    +I R KLA
Sbjct: 92  SRDQNR----KIAREKLA 105

>KLLA0C02717g complement(242948..246508) weakly similar to sp|P38717
           Saccharomyces cerevisiae YNL257c SIP3 SNF1P protein
           kinase interacting protein, start by similarity
          Length = 1186

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 48/85 (56%), Gaps = 14/85 (16%)

Query: 83  SFDVEKQKKYSKLSSI------VDT--FRAYQDNVHM-YRELQDMIAQDASL-RTEAQAE 132
           +++  +  K ++L+++      +DT  FR   ++ HM    L++ I ++ +L + +A + 
Sbjct: 3   AYETRRNDKLTRLTALAYKEASIDTPSFRTSANHFHMQVLALENWIQENTNLSKNQALSG 62

Query: 133 LDELAPTLARSADTLLDKLLPPHPF 157
           L EL     +  D+++D+LLPP P+
Sbjct: 63  LAELN----KDEDSMIDRLLPPLPY 83

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.129    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,318,793
Number of extensions: 420672
Number of successful extensions: 1348
Number of sequences better than 10.0: 22
Number of HSP's gapped: 1355
Number of HSP's successfully gapped: 22
Length of query: 414
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 310
Effective length of database: 12,995,837
Effective search space: 4028709470
Effective search space used: 4028709470
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)