Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL283W30630016130.0
KLLA0E14828g31029913450.0
Scas_613.13*31230013170.0
YDL108W (KIN28)30629612990.0
CAGL0H10318g30729812861e-180
Kwal_23.347126025311791e-165
KLLA0D11990g3043015561e-69
CAGL0L12474g3023035369e-67
KLLA0B09790g2952965315e-66
ADR058C2952945245e-65
YBR160W (CDC28)2982965221e-64
Scas_721.462962925202e-64
Scas_568.9*3062945202e-64
AGL242C3033005177e-64
CAGL0H07535g2982955114e-63
AFR205C4572974843e-57
Kwal_26.75524612984791e-56
Scas_610.76683374883e-56
Kwal_27.118032462434422e-53
CAGL0I08349g6673314682e-53
KLLA0E12177g4552944512e-52
Scas_721.1105203054501e-51
AFR019W3593044363e-51
ABR177C7533244511e-50
Kwal_55.219006253294462e-50
CAGL0D02002g5532944422e-50
Kwal_27.119192092074183e-50
KLLA0E10527g3713264226e-49
KLLA0D10527g6453334359e-49
CAGL0J00539g4882954262e-48
YBL016W (FUS3)3532944068e-47
Scas_710.283522934023e-46
Kwal_17.26873623024024e-46
KLLA0F17006g4152974046e-46
Scas_688.144792924061e-45
CAGL0L12650g5672874082e-45
Kwal_27.125594143094002e-45
Kwal_27.118305752864083e-45
KLLA0B11902g4952814025e-45
Kwal_14.14163652953921e-44
ACL191C3652953921e-44
CAGL0J04290g3573093911e-44
Kwal_23.55765042933973e-44
KLLA0A02497g3622943884e-44
Kwal_56.238414322923925e-44
Scas_680.204822953945e-44
Scas_683.63772963879e-44
ADR253W3803173871e-43
YHR030C (SLT2)4842933931e-43
KLLA0F20053g4442853901e-43
Kwal_47.178683653023833e-43
YGR040W (KSS1)3682973833e-43
Scas_713.384322923856e-43
CAGL0D01694g4323123831e-42
Scas_623.113782933782e-42
Scas_667.184373123822e-42
CAGL0L06820g3663023753e-42
KLLA0D11814g5932913864e-42
CAGL0M11748g4472853794e-42
AER232C5692933793e-41
ADL315C4342823715e-41
AGR048C4532923717e-41
KLLA0B11946g4393043654e-40
CAGL0K04169g3983213564e-39
AGL249C5812353557e-38
YDL079C (MRK1)5012993395e-36
Scas_678.134622923211e-33
Scas_22.12482232863e-30
Kwal_26.72766462812933e-29
YJL106W (IME2)6452462891e-28
CAGL0M08910g6123002853e-28
YDR477W (SNF1)6332212853e-28
CAGL0G04455g7511982853e-28
Scas_660.286232212844e-28
AEL230W6082992811e-27
Kwal_55.220013633022751e-27
Scas_711.157272982801e-27
CAGL0E01683g3753032732e-27
KLLA0E07414g3653022714e-27
AFR076W8202092741e-26
Kwal_47.182335982162731e-26
KLLA0A03806g6022942722e-26
KLLA0F02838g7551982713e-26
ADL168C3623032643e-26
Scas_635.13783032611e-25
YGL180W (ATG1)8973242458e-23
Scas_493.211172932458e-23
CAGL0K05709g11032812441e-22
CAGL0L07326g5062972421e-22
CAGL0G02035g3392242371e-22
KLLA0C01650g11122902403e-22
ABR014W9712262394e-22
Scas_613.55172242367e-22
Scas_673.20*7582012377e-22
YDR507C (GIN4)11422902378e-22
Scas_648.173402242311e-21
YCL024W (KCC4)10372032361e-21
KLLA0F14190g13382012361e-21
Kwal_26.735514462092351e-21
AFR092W14232082333e-21
KLLA0E03487g6472152323e-21
ADL102C3722362293e-21
CAGL0L06006g9423232324e-21
CAGL0C05005g10762012315e-21
YAR019C (CDC15)9742012315e-21
ACR249C6432192306e-21
ADR204W3392262258e-21
Scas_668.228932022298e-21
CAGL0J11638g7462272281e-20
YDL101C (DUN1)5133142271e-20
Kwal_55.203267502702281e-20
Kwal_23.632515423072281e-20
CAGL0K02673g9151962271e-20
Scas_651.37932322272e-20
KLLA0C17160g8312452272e-20
KLLA0F16467g3402242222e-20
Kwal_26.78619552312253e-20
CAGL0M10153g8671972253e-20
YJL141C (YAK1)8072232244e-20
AFR696C11422902244e-20
Scas_718.906472942234e-20
Scas_640.14*7282102226e-20
KLLA0C04191g7971992227e-20
CAGL0I05896g7782202218e-20
AFR377C7262302219e-20
ABL034W14252092211e-19
Kwal_26.87098292122211e-19
KLLA0A05819g7042222201e-19
ABL011C7012652201e-19
YJL095W (BCK1)14782022201e-19
Scas_692.247182202191e-19
KLLA0F13552g12672082202e-19
AER223C9021992192e-19
Scas_711.2515152032192e-19
KLLA0B13607g9891972192e-19
ADR174C6712432182e-19
CAGL0K08514g14892262183e-19
CAGL0C02893g6492272163e-19
CAGL0K12496g3602202133e-19
Scas_698.373473042124e-19
Kwal_0.964272022144e-19
Kwal_56.224766972032155e-19
KLLA0E01584g4152242135e-19
Kwal_55.217093402222116e-19
KLLA0F11143g8132042148e-19
Kwal_26.778812672052148e-19
KLLA0F23155g4272052129e-19
Scas_707.315981632131e-18
Scas_644.157262262121e-18
Kwal_26.89416612502121e-18
YIL035C (CKA1)3721662092e-18
Scas_618.84272092102e-18
KLLA0C06138g7082002112e-18
CAGL0F04741g4422072102e-18
YDL025C6202042112e-18
Scas_713.79832012112e-18
Scas_616.1014611612112e-18
AAR009W4532032092e-18
CAGL0J03872g6612112102e-18
CAGL0L03520g14472032103e-18
CAGL0K01661g4822052083e-18
Scas_704.503691662063e-18
KLLA0A06820g7722282094e-18
CAGL0I05192g3733272054e-18
Scas_700.348642162084e-18
Kwal_47.180983741732054e-18
Kwal_33.139846492262085e-18
YFR014C (CMK1)4462002065e-18
ACL006W7082062067e-18
Kwal_33.144347592102068e-18
YGL179C (TOS3)5602232051e-17
Scas_598.67902162051e-17
Scas_720.9416833252051e-17
Scas_715.3411502622051e-17
KLLA0E06413g11612622051e-17
KLLA0F11319g8432782041e-17
ADR313W5782862031e-17
YHL007C (STE20)9392392041e-17
Kwal_33.138317002272042e-17
KLLA0E04136g3732072012e-17
Scas_700.546982032032e-17
AEL118C6832322032e-17
YCR073C (SSK22)13312522023e-17
Kwal_23.35904992332013e-17
CAGL0M02299g8932162023e-17
ACL054W9723322013e-17
KLLA0C07535g6242432004e-17
AFL188C4723001994e-17
Kwal_33.141925772071996e-17
AEL284C4792211986e-17
KLLA0E11979g6141971987e-17
Kwal_33.131125052921978e-17
Scas_477.57032761988e-17
CAGL0B02739g6762871989e-17
CAGL0J03828g4671941979e-17
Scas_690.133542001959e-17
Kwal_26.87967962071989e-17
YBL105C (PKC1)11512781981e-16
KLLA0F08877g3211391931e-16
Kwal_27.1058111542731971e-16
KLLA0C08525g15512141971e-16
Kwal_27.97638681991952e-16
CAGL0F03707g6082521952e-16
CAGL0M09361g11442781952e-16
KLLA0A07403g8792191952e-16
Kwal_47.172528723281952e-16
Kwal_0.3074901971942e-16
ACR119W9312061943e-16
Kwal_14.12493442281913e-16
AER264C14833021943e-16
KLLA0B13112g7302501933e-16
CAGL0M02233g7672091933e-16
ACR142W8372051934e-16
CAGL0K10604g4461991924e-16
YFL029C (CAK1)3682401904e-16
CAGL0L07810g5962951925e-16
AFR150C3492911888e-16
AER222C4232541899e-16
Kwal_14.115915212021901e-15
Scas_707.73761481871e-15
CAGL0M03729g8612241891e-15
KLLA0D08415g7742051891e-15
CAGL0G09020g3611941861e-15
Kwal_26.87518482361891e-15
Scas_201.1*2741511841e-15
AEL205W7932231882e-15
Kwal_55.215458651991882e-15
Scas_700.288962011882e-15
YBR274W (CHK1)5272121872e-15
ACR218W15691521882e-15
CAGL0I09504g5282081872e-15
YFL033C (RIM15)17701611882e-15
YCR008W (SAT4)6032001863e-15
CAGL0E05720g3581981843e-15
KLLA0D07348g9091941863e-15
Scas_628.96211971863e-15
ACR191C11492621863e-15
Kwal_27.97734062361853e-15
Scas_653.256662091863e-15
Kwal_56.240593531931843e-15
CAGL0M02519g7561891863e-15
Kwal_23.52908192221863e-15
Scas_700.354392371844e-15
Kwal_47.183076212231845e-15
KLLA0D07304g4651941835e-15
AER195C5041951835e-15
KLLA0D03190g3721931826e-15
Scas_685.245152131837e-15
CAGL0K12562g16821511847e-15
Scas_651.198012281829e-15
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL283W
         (300 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH] complement...   625   0.0  
KLLA0E14828g complement(1323743..1324675) gi|27526973|emb|CAD369...   522   0.0  
Scas_613.13*                                                          511   0.0  
YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699) Cycli...   504   0.0  
CAGL0H10318g complement(1006299..1007222) highly similar to sp|P...   499   e-180
Kwal_23.3471                                                          458   e-165
KLLA0D11990g join(complement(1023928..1023944), gi|2499590|sp|Q9...   218   1e-69
CAGL0L12474g complement(1345044..1345952) highly similar to sp|P...   211   9e-67
KLLA0B09790g complement(855327..856214) highly similar to sp|P00...   209   5e-66
ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH] (810941..8...   206   5e-65
YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent pro...   205   1e-64
Scas_721.46                                                           204   2e-64
Scas_568.9*                                                           204   2e-64
AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH] (246896..2...   203   7e-64
CAGL0H07535g 736241..737137 highly similar to sp|P00546 Saccharo...   201   4e-63
AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH] (805583..80...   191   3e-57
Kwal_26.7552                                                          189   1e-56
Scas_610.7                                                            192   3e-56
Kwal_27.11803                                                         174   2e-53
CAGL0I08349g complement(813728..815731) similar to sp|P23293 Sac...   184   2e-53
KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1 Kluyverom...   178   2e-52
Scas_721.110                                                          177   1e-51
AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH] complement(...   172   3e-51
ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH] (735828..738...   178   1e-50
Kwal_55.21900                                                         176   2e-50
CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces c...   174   2e-50
Kwal_27.11919                                                         165   3e-50
KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces c...   167   6e-49
KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces c...   172   9e-49
CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomy...   168   2e-48
YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine prot...   160   8e-47
Scas_710.28                                                           159   3e-46
Kwal_17.2687                                                          159   4e-46
KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA6115...   160   6e-46
Scas_688.14                                                           160   1e-45
CAGL0L12650g 1357789..1359492 similar to sp|P39073 Saccharomyces...   161   2e-45
Kwal_27.12559                                                         158   2e-45
Kwal_27.11830                                                         161   3e-45
KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_...   159   5e-45
Kwal_14.1416                                                          155   1e-44
ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..2757...   155   1e-44
CAGL0J04290g complement(400939..402012) similar to sp|P16892 Sac...   155   1e-44
Kwal_23.5576                                                          157   3e-44
KLLA0A02497g 218592..219680 highly similar to sp|P14681 Saccharo...   154   4e-44
Kwal_56.23841                                                         155   5e-44
Scas_680.20                                                           156   5e-44
Scas_683.6                                                            153   9e-44
ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C ...   153   1e-43
YHR030C (SLT2) [2317] chr8 complement(168882..170336) Serine/thr...   155   1e-43
KLLA0F20053g 1867209..1868543 highly similar to sp|P32485 Saccha...   154   1e-43
Kwal_47.17868                                                         152   3e-43
YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine pro...   152   3e-43
Scas_713.38                                                           152   6e-43
CAGL0D01694g complement(176981..178279) similar to sp|P41808 Sac...   152   1e-42
Scas_623.11                                                           150   2e-42
Scas_667.18                                                           151   2e-42
CAGL0L06820g 767038..768138 highly similar to sp|P38615 Saccharo...   149   3e-42
KLLA0D11814g complement(1007240..1009021) similar to sp|P39073 S...   153   4e-42
CAGL0M11748g 1167306..1168649 highly similar to sp|P32485 Saccha...   150   4e-42
AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -...   150   3e-41
ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH] (146098..14...   147   5e-41
AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH] (807470..80...   147   7e-41
KLLA0B11946g complement(1048033..1049352) similar to sp|P41808 S...   145   4e-40
CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces c...   141   4e-39
AGL249C [4063] [Homologous to ScYPL042C (SSN3) - SH] (234347..23...   141   7e-38
YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..3147...   135   5e-36
Scas_678.13                                                           128   1e-33
Scas_22.1                                                             114   3e-30
Kwal_26.7276                                                          117   3e-29
YJL106W (IME2) [2809] chr10 (221307..223244) Serine/threonine pr...   115   1e-28
CAGL0M08910g complement(887703..889541) highly similar to sp|Q00...   114   3e-28
YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine p...   114   3e-28
CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces c...   114   3e-28
Scas_660.28                                                           114   4e-28
AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH] complement(...   112   1e-27
Kwal_55.22001                                                         110   1e-27
Scas_711.15                                                           112   1e-27
CAGL0E01683g complement(166584..167711) highly similar to sp|P21...   109   2e-27
KLLA0E07414g complement(672690..673787) highly similar to sp|P21...   108   4e-27
AFR076W [3268] [Homologous to ScYJL106W (IME2) - SH] complement(...   110   1e-26
Kwal_47.18233                                                         109   1e-26
KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235....   109   2e-26
KLLA0F02838g 264329..266596 some similarities with sp|P32581 Sac...   108   3e-26
ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -...   106   3e-26
Scas_635.1                                                            105   1e-25
YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine pro...    99   8e-23
Scas_493.2                                                             99   8e-23
CAGL0K05709g complement(555903..559214) similar to sp|Q12263 Sac...    99   1e-22
CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces c...    98   1e-22
CAGL0G02035g 179911..180930 highly similar to sp|P19454 Saccharo...    96   1e-22
KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces c...    97   3e-22
ABR014W [605] [Homologous to ScYHL007C (STE20) - SH] complement(...    97   4e-22
Scas_613.5                                                             96   7e-22
Scas_673.20*                                                           96   7e-22
YDR507C (GIN4) [1321] chr4 complement(1462346..1465774) Serine/t...    96   8e-22
Scas_648.17                                                            94   1e-21
YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protei...    96   1e-21
KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyvero...    96   1e-21
Kwal_26.7355                                                           95   1e-21
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...    94   3e-21
KLLA0E03487g complement(323764..325707) similar to sgd|S0002874 ...    94   3e-21
ADL102C [1639] [Homologous to ScYIL035C (CKA1) - SH] (503670..50...    93   3e-21
CAGL0L06006g complement(670707..673535) similar to sp|P53104 Sac...    94   4e-21
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...    94   5e-21
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...    94   5e-21
ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH] (797020..79...    93   6e-21
ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH] complement(...    91   8e-21
Scas_668.22                                                            93   8e-21
CAGL0J11638g complement(1128620..1130860) highly similar to sp|P...    92   1e-20
YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kin...    92   1e-20
Kwal_55.20326                                                          92   1e-20
Kwal_23.6325                                                           92   1e-20
CAGL0K02673g complement(240509..243256) similar to sp|Q03497 Sac...    92   1e-20
Scas_651.3                                                             92   2e-20
KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces...    92   2e-20
KLLA0F16467g 1519800..1520822 highly similar to sp|P19454 Saccha...    90   2e-20
Kwal_26.7861                                                           91   3e-20
CAGL0M10153g complement(1010688..1013291) some similarities with...    91   3e-20
YJL141C (YAK1) [2777] chr10 complement(147885..150308) Serine/th...    91   4e-20
AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W (...    91   4e-20
Scas_718.90                                                            91   4e-20
Scas_640.14*                                                           90   6e-20
KLLA0C04191g 384198..386591 weakly similar to sp|P27636 Saccharo...    90   7e-20
CAGL0I05896g 560169..562505 some similarities with sp|P14680 Sac...    90   8e-20
AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)...    90   9e-20
ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH] complement(3...    90   1e-19
Kwal_26.8709                                                           90   1e-19
KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces c...    89   1e-19
ABL011C [581] [Homologous to ScYLR362W (STE11) - SH] (378259..38...    89   1e-19
YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine pr...    89   1e-19
Scas_692.24                                                            89   1e-19
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...    89   2e-19
AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH] (1044971.....    89   2e-19
Scas_711.25                                                            89   2e-19
KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497 Saccha...    89   2e-19
ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)...    89   2e-19
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...    89   3e-19
CAGL0C02893g complement(286017..287966) similar to tr|Q08732 Sac...    88   3e-19
CAGL0K12496g 1218391..1219473 similar to sp|P43568 Saccharomyces...    87   3e-19
Scas_698.37                                                            86   4e-19
Kwal_0.96                                                              87   4e-19
Kwal_56.22476                                                          87   5e-19
KLLA0E01584g 149713..150960 highly similar to sp|P39009 Saccharo...    87   5e-19
Kwal_55.21709                                                          86   6e-19
KLLA0F11143g complement(1026129..1028570) similar to sp|P22216 S...    87   8e-19
Kwal_26.7788                                                           87   8e-19
KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces...    86   9e-19
Scas_707.3                                                             87   1e-18
Scas_644.15                                                            86   1e-18
Kwal_26.8941                                                           86   1e-18
YIL035C (CKA1) [2632] chr9 complement(287789..288907) Casein kin...    85   2e-18
Scas_618.8                                                             86   2e-18
KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces c...    86   2e-18
CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces c...    86   2e-18
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    86   2e-18
Scas_713.7                                                             86   2e-18
Scas_616.10                                                            86   2e-18
AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C (C...    85   2e-18
CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces c...    86   2e-18
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...    86   3e-18
CAGL0K01661g complement(146952..148400) some similarities with t...    85   3e-18
Scas_704.50                                                            84   3e-18
KLLA0A06820g complement(615686..618004) some similarities with s...    85   4e-18
CAGL0I05192g complement(493635..494756) highly similar to sp|P15...    84   4e-18
Scas_700.34                                                            85   4e-18
Kwal_47.18098                                                          84   4e-18
Kwal_33.13984                                                          85   5e-18
YFR014C (CMK1) [1695] chr6 complement(172529..173869) Calcium/ca...    84   5e-18
ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH] complement(...    84   7e-18
Kwal_33.14434                                                          84   8e-18
YGL179C (TOS3) [1812] chr7 complement(163413..165095) Serine/thr...    84   1e-17
Scas_598.6                                                             84   1e-17
Scas_720.94                                                            84   1e-17
Scas_715.34                                                            84   1e-17
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....    84   1e-17
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...    83   1e-17
ADR313W [2054] [Homologous to ScYDL025C - SH] complement(1255932...    83   1e-17
YHL007C (STE20) [2279] chr8 complement(95113..97932) Serine/thre...    83   1e-17
Kwal_33.13831                                                          83   2e-17
KLLA0E04136g 382874..383995 similar to sp|P15790 Saccharomyces c...    82   2e-17
Scas_700.54                                                            83   2e-17
AEL118C [2388] [Homologous to ScYKL168C (KKQ8) - SH; ScYJL165C (...    83   2e-17
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    82   3e-17
Kwal_23.3590                                                           82   3e-17
CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces c...    82   3e-17
ACL054W [995] [Homologous to ScYGL180W (APG1) - SH] complement(2...    82   3e-17
KLLA0C07535g 658746..660620 some similarities with sgd|S0005793 ...    82   4e-17
AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..902...    81   4e-17
Kwal_33.14192                                                          81   6e-17
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    81   6e-17
KLLA0E11979g complement(1060048..1061892) some similarities with...    81   7e-17
Kwal_33.13112                                                          80   8e-17
Scas_477.5                                                             81   8e-17
CAGL0B02739g complement(262590..264620) similar to sp|P23561 Sac...    81   9e-17
CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces c...    80   9e-17
Scas_690.13                                                            80   9e-17
Kwal_26.8796                                                           81   9e-17
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...    81   1e-16
KLLA0F08877g 825217..826182 gi|27526975|emb|CAD36965.1 Kluyverom...    79   1e-16
Kwal_27.10581                                                          80   1e-16
KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces c...    80   1e-16
Kwal_27.9763                                                           80   2e-16
CAGL0F03707g complement(359839..361665) similar to sp|Q08732 Sac...    80   2e-16
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...    80   2e-16
KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces c...    80   2e-16
Kwal_47.17252                                                          80   2e-16
Kwal_0.307                                                             79   2e-16
ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -...    79   3e-16
Kwal_14.1249                                                           78   3e-16
AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C ...    79   3e-16
KLLA0B13112g complement(1146006..1148198) similar to sp|P23561 S...    79   3e-16
CAGL0M02233g complement(267332..269635) highly similar to sp|P22...    79   3e-16
ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH] complement...    79   4e-16
CAGL0K10604g complement(1029226..1030566) similar to sp|P27466 S...    79   4e-16
YFL029C (CAK1) [1654] chr6 complement(78053..79159) Cdk-activati...    78   4e-16
CAGL0L07810g complement(857656..859446) similar to sp|P25333 Sac...    79   5e-16
AFR150C [3342] [Homologous to ScYFL029C (CAK1) - SH] (707306..70...    77   8e-16
AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH] (1043479..1...    77   9e-16
Kwal_14.1159                                                           78   1e-15
Scas_707.7                                                             77   1e-15
CAGL0M03729g complement(420316..422901) similar to sp|P48562 Sac...    77   1e-15
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    77   1e-15
CAGL0G09020g 860266..861351 highly similar to sp|P06245 Saccharo...    76   1e-15
Kwal_26.8751                                                           77   1e-15
Scas_201.1*                                                            75   1e-15
AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W (...    77   2e-15
Kwal_55.21545                                                          77   2e-15
Scas_700.28                                                            77   2e-15
YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase, re...    77   2e-15
ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH] complement...    77   2e-15
CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces c...    77   2e-15
YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/thre...    77   2e-15
YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine prot...    76   3e-15
CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces c...    75   3e-15
KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062 Sacch...    76   3e-15
Scas_628.9                                                             76   3e-15
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...    76   3e-15
Kwal_27.9773                                                           76   3e-15
Scas_653.25                                                            76   3e-15
Kwal_56.24059                                                          75   3e-15
CAGL0M02519g complement(290723..292993) highly similar to tr|Q03...    76   3e-15
Kwal_23.5290                                                           76   3e-15
Scas_700.35                                                            75   4e-15
Kwal_47.18307                                                          75   5e-15
KLLA0D07304g 623352..624749 some similarities with sp|P32491 Sac...    75   5e-15
AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH] (1005431..1...    75   5e-15
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...    75   6e-15
Scas_685.24                                                            75   7e-15
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...    75   7e-15
Scas_651.19                                                            75   9e-15
KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces...    74   2e-14
AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH] complement(...    73   2e-14
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    74   2e-14
KLLA0B02332g complement(206863..207948) similar to sp|P38991 Sac...    73   2e-14
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...    74   2e-14
Scas_660.20                                                            74   2e-14
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...    74   2e-14
Scas_619.5*                                                            74   2e-14
Kwal_26.7635                                                           73   3e-14
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    73   3e-14
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...    74   3e-14
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...    73   3e-14
ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023) [...    73   3e-14
Kwal_56.22693                                                          73   4e-14
YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threon...    73   5e-14
KLLA0F09020g 836287..839073 weakly similar to sp|P43565 Saccharo...    73   5e-14
AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH] (1769897..1...    72   6e-14
KLLA0C03938g complement(358851..360632) some similarities with s...    72   7e-14
KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces c...    71   8e-14
Scas_707.34                                                            72   9e-14
ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C (Y...    72   9e-14
Kwal_56.24584                                                          71   1e-13
CAGL0M08360g complement(833220..835520) some similarities with s...    72   1e-13
AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH] (249144..25...    71   1e-13
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    71   1e-13
Scas_678.24                                                            71   1e-13
KLLA0D12100g complement(1031728..1033161) some similarities with...    71   1e-13
ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C (...    71   1e-13
Scas_580.6                                                             71   2e-13
Scas_640.16                                                            70   2e-13
KLLA0C16577g complement(1451181..1452695) some similarities with...    70   2e-13
Scas_633.29                                                            71   2e-13
CAGL0K11550g 1118142..1119758 similar to sp|P28708 Saccharomyces...    70   2e-13
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...    70   2e-13
Scas_675.2                                                             70   2e-13
CAGL0I04422g 394159..395427 some similarities with sp|P22209 Sac...    70   3e-13
ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH] complement(...    70   3e-13
Kwal_33.13222                                                          66   3e-13
CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces c...    70   3e-13
YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capab...    70   4e-13
KLLA0E21780g complement(1936438..1939488) similar to sp|P38692 S...    70   4e-13
CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces c...    69   4e-13
CAGL0I06248g 600351..602792 similar to sp|P38970 Saccharomyces c...    70   5e-13
KLLA0B03586g complement(326871..329075) similar to sp|P11792 Sac...    70   5e-13
Scas_655.2                                                             69   6e-13
YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine ...    69   6e-13
Scas_689.25*                                                           69   6e-13
CAGL0K07458g complement(736336..738450) similar to sp|P12688 Sac...    69   6e-13
Scas_689.24                                                            69   6e-13
Scas_336.1                                                             69   6e-13
KLLA0F01276g complement(120001..121560) similar to sp|P38147 Sac...    69   7e-13
Scas_683.12                                                            68   8e-13
KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces cer...    69   9e-13
CAGL0K03399g complement(310487..312598) highly similar to sp|P12...    69   1e-12
KLLA0B07205g complement(624606..625973) some similarities with s...    68   1e-12
KLLA0A02717g 245082..246380 some similarities with sp|P53233 Sac...    68   1e-12
Kwal_14.1273                                                           68   1e-12
Kwal_14.2497                                                           68   1e-12
Scas_502.2                                                             69   1e-12
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    68   1e-12
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...    68   1e-12
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    68   2e-12
Scas_693.17                                                            68   2e-12
Kwal_56.24091                                                          67   2e-12
Kwal_26.7682                                                           68   2e-12
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...    68   2e-12
CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces c...    67   2e-12
Kwal_47.16761                                                          67   2e-12
YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine p...    67   3e-12
Kwal_33.13846                                                          67   3e-12
Scas_703.5                                                             67   3e-12
Kwal_23.5668                                                           67   3e-12
CAGL0M08404g complement(836791..838179) some similarities with s...    67   3e-12
Kwal_26.8703                                                           67   3e-12
CAGL0G05720g complement(547617..549833) similar to sp|P22211 Sac...    67   3e-12
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    67   5e-12
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...    67   5e-12
YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine pro...    66   6e-12
YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic...    65   8e-12
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    65   8e-12
Scas_721.124                                                           66   9e-12
Scas_634.5                                                             66   9e-12
CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces...    66   9e-12
Scas_651.18                                                            65   9e-12
Scas_582.1                                                             65   9e-12
AEL083W [2423] [Homologous to ScYBR028C - SH] complement(470964....    65   1e-11
Scas_627.7                                                             65   1e-11
Scas_721.61                                                            65   1e-11
AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W (...    65   1e-11
ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) ...    65   1e-11
Kwal_56.22788                                                          65   2e-11
Scas_568.13                                                            65   2e-11
Scas_717.69                                                            65   2e-11
CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces c...    65   2e-11
AEL179W [2327] [Homologous to NOHBY] complement(302948..303817) ...    64   2e-11
Scas_564.7                                                             65   2e-11
CAGL0C03509g complement(350846..353533) similar to sp|P53739 Sac...    65   2e-11
Scas_721.132                                                           64   2e-11
YDR247W (VHS1) [1081] chr4 (956005..957390) Serine/threonine pro...    64   2e-11
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...    64   3e-11
CAGL0H01199g 110610..115556 highly similar to sp|P15442 Saccharo...    64   3e-11
CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces c...    64   3e-11
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    64   3e-11
Scas_677.18                                                            64   3e-11
CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces c...    64   4e-11
Scas_544.6                                                             63   5e-11
AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C (...    63   5e-11
Kwal_0.155                                                             63   6e-11
Kwal_33.14167                                                          63   6e-11
Scas_643.20                                                            64   6e-11
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    63   6e-11
KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces c...    63   7e-11
ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH] (1222346..1...    63   7e-11
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...    63   7e-11
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...    63   7e-11
YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine pro...    63   8e-11
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    63   8e-11
YDR523C (SPS1) [1335] chr4 complement(1485554..1487026) Serine/t...    62   1e-10
AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..328...    62   1e-10
YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine prote...    62   1e-10
CAGL0F03311g complement(327599..330736) similar to sp|P38691 Sac...    62   1e-10
Scas_593.14d                                                           62   1e-10
CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces c...    62   1e-10
YBR028C (YBR028C) [220] chr2 complement(294387..295964) Serine/t...    62   1e-10
Scas_705.23                                                            62   2e-10
KLLA0F01408g 135424..136302 weakly similar to sgd|S0002183 Sacch...    61   2e-10
KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces c...    62   2e-10
CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces ce...    62   2e-10
Scas_716.33                                                            61   2e-10
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    62   2e-10
YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine prot...    62   2e-10
KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces...    61   2e-10
YJL165C (HAL5) [2756] chr10 complement(106887..109454) Serine/th...    62   2e-10
YDR490C (PKH1) [1306] chr4 complement(1431956..1434256) Serine/t...    61   2e-10
KLLA0D07810g complement(669095..671251) gi|401646|sp|P31034|YL44...    61   2e-10
Kwal_33.14554                                                          61   3e-10
Kwal_33.13681                                                          61   3e-10
ADR163W [1905] [Homologous to ScYDR247W - SH; ScYPL026C (SKS1) -...    60   4e-10
AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH] complement(...    60   5e-10
Scas_548.6                                                             61   5e-10
Kwal_23.6458                                                           60   5e-10
CAGL0J06072g complement(572377..574698) similar to sp|P53894 Sac...    60   5e-10
AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W (R...    60   6e-10
KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1 Kluyvero...    60   6e-10
YAR018C (KIN3) [73] chr1 complement(170393..171700) Serine/threo...    60   6e-10
Kwal_23.3992                                                           60   7e-10
Scas_584.11                                                            60   7e-10
YJL128C (PBS2) [2790] chr10 complement(178015..180021) MAP kinas...    60   8e-10
YDL028C (MPS1) [834] chr4 complement(400994..403288) Multi-funct...    60   8e-10
Scas_654.12                                                            60   9e-10
Scas_716.73                                                            59   9e-10
ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W (...    59   1e-09
ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH] (692321..69...    59   1e-09
KLLA0E15378g 1362851..1365025 some similarities with sp|P08018 S...    59   1e-09
Scas_629.16                                                            59   1e-09
YJL187C (SWE1) [2737] chr10 complement(76802..79261) Serine/tyro...    59   1e-09
CAGL0I05390g complement(508677..510041) similar to sp|Q12505 Sac...    59   1e-09
Kwal_55.20221                                                          59   1e-09
Kwal_26.7154                                                           59   1e-09
CAGL0B04147g 402798..404498 highly similar to sp|P22204 Saccharo...    59   1e-09
YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine pro...    59   1e-09
YHR079C (IRE1) [2368] chr8 complement(258245..261592) Protein ki...    59   2e-09
CAGL0K11275g 1093797..1095374 similar to tr|Q03785 Saccharomyces...    59   2e-09
Scas_720.103                                                           59   2e-09
ADR317C [2058] [Homologous to ScYDL028C (MPS1) - SH] (1263082..1...    59   2e-09
Kwal_27.11777                                                          58   2e-09
KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1 Kluyvero...    59   2e-09
ADR293C [2034] [Homologous to ScYHR079C (IRE1) - SH] (1207023..1...    59   2e-09
Kwal_56.23717                                                          59   2e-09
CAGL0G03047g 282299..283918 highly similar to sp|P22204 Saccharo...    58   3e-09
KLLA0B07579g 659591..661759 weakly similar to sp|P32944 Saccharo...    58   3e-09
Kwal_55.20189                                                          58   3e-09
KLLA0D13266g complement(1137750..1141208) similar to sp|P32361 S...    58   4e-09
ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) ...    58   4e-09
ADL043C [1698] [Homologous to ScYLL019C (KNS1) - SH] (612091..61...    57   4e-09
AGR334W [4645] [Homologous to ScYMR291W - SH] complement(1354612...    57   5e-09
Scas_713.21                                                            57   5e-09
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    57   6e-09
KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces...    57   7e-09
Scas_602.11                                                            57   9e-09
Kwal_33.14081                                                          56   1e-08
CAGL0K01617g complement(142479..144803) similar to sp|P54199 Sac...    56   1e-08
CAGL0F03245g complement(316924..320034) similar to sp|P32361 Sac...    56   1e-08
YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine pro...    55   2e-08
Kwal_23.4276                                                           55   2e-08
KLLA0D09328g complement(788565..791705) some similarities with s...    56   2e-08
Kwal_47.17263                                                          55   3e-08
Scas_707.36                                                            55   3e-08
Scas_618.15                                                            55   3e-08
CAGL0H09152g complement(895722..898055) similar to sp|P47116 Sac...    55   4e-08
CAGL0K06479g 636296..639271 some similarities with tr|Q03306 Sac...    55   5e-08
CAGL0K00693g complement(74637..77267) similar to sp|P32944 Sacch...    54   5e-08
Scas_584.8                                                             54   6e-08
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...    54   6e-08
Scas_573.10                                                            53   1e-07
CAGL0H01837g complement(176352..178736) tr|Q9C1R8 Candida glabra...    53   1e-07
ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C (T...    53   2e-07
KLLA0A09713g 851952..853625 similar to sp|Q03533 Saccharomyces c...    52   2e-07
CAGL0D06600g 626571..628748 similar to tr|Q12399 Saccharomyces c...    52   2e-07
Scas_671.16                                                            52   3e-07
Scas_697.12                                                            52   3e-07
Scas_601.6                                                             51   4e-07
Kwal_47.17345                                                          51   5e-07
AFL091W [3102] [Homologous to ScYPL204W (HRR25) - SH] complement...    50   6e-07
CAGL0G06138g complement(585585..587204) similar to sp|P23291 Sac...    50   9e-07
ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH] (295497..297...    50   1e-06
Scas_703.47                                                            50   1e-06
Scas_695.33                                                            50   2e-06
YHR135C (YCK1) [2422] chr8 complement(372695..374311) Casein kin...    50   2e-06
CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces cer...    49   2e-06
AGR027C [4337] [Homologous to ScYBR059C (AKL1) - SH] (763309..76...    49   3e-06
Scas_673.34*                                                           49   3e-06
KLLA0F22297g complement(2083448..2085547) some similarities with...    49   3e-06
Kwal_27.10004                                                          49   3e-06
Scas_720.24                                                            48   4e-06
CAGL0J05940g 560563..562023 similar to sp|P23291 Saccharomyces c...    48   4e-06
Kwal_33.14596                                                          48   4e-06
Scas_684.28                                                            48   4e-06
CAGL0B03509g complement(349638..351431) similar to sp|P38623 Sac...    48   4e-06
Kwal_47.17314                                                          48   5e-06
KLLA0F26983g 2489326..2490729 some similarities with sp|P32801 S...    48   5e-06
AEL149C [2357] [Homologous to ScYJL187C (SWE1) - SH] (348350..35...    48   6e-06
YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine pro...    48   6e-06
Kwal_56.24064                                                          47   6e-06
CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces c...    47   7e-06
CAGL0H03553g complement(328668..330155) highly similar to sp|P29...    47   1e-05
KLLA0D03168g 265761..267278 some similarities with sp|P29295 Sac...    47   1e-05
CAGL0F03905g complement(377962..380088) similar to sp|Q03656 Sac...    47   1e-05
AFR040W [3232] [Homologous to ScYHR135C (YCK1) - SH; ScYNL154C (...    46   2e-05
Scas_654.17                                                            46   2e-05
CAGL0G02607g complement(240244..242310) similar to sp|P40494 Sac...    46   2e-05
ADL217W [1524] [Homologous to ScYIL095W (PRK1) - SH; ScYNL020C (...    46   3e-05
Kwal_27.9804                                                           45   4e-05
KLLA0E13563g 1193481..1194902 some similarities with sp|P39962 S...    45   5e-05
KLLA0C04345g 397899..399326 similar to sp|P06243 Saccharomyces c...    45   6e-05
Scas_690.12                                                            45   6e-05
YBR059C (AKL1) [250] chr2 complement(356821..360147) Serine/thre...    45   7e-05
Scas_718.72                                                            44   7e-05
KLLA0D11044g complement(942458..944068) gi|730472|sp|P40230|RAG8...    44   9e-05
CAGL0M13541g 1332296..1334164 similar to sp|Q03533 Saccharomyces...    44   1e-04
KLLA0F18612g 1711131..1713575 some similarities with sp|P38080 S...    44   1e-04
CAGL0H10208g complement(996853..999936) similar to sp|P38080 Sac...    44   2e-04
AER216C [2718] [Homologous to ScYDL017W (CDC7) - SH] (1032840..1...    43   2e-04
Kwal_27.11542                                                          43   2e-04
CAGL0K01815g 162144..163658 similar to sp|P06243 Saccharomyces c...    43   2e-04
Kwal_27.10945                                                          43   2e-04
KLLA0C07216g 626227..628278 similar to sp|Q03656 Saccharomyces c...    43   3e-04
Kwal_26.8347                                                           42   3e-04
Kwal_56.24274                                                          42   4e-04
Kwal_26.9032                                                           42   4e-04

>ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH]
           complement(205175..205199,205252..206147) [921 bp, 306
           aa]
          Length = 306

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/300 (100%), Positives = 300/300 (100%)

Query: 1   MTAVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEI 60
           MTAVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEI
Sbjct: 1   MTAVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEI 60

Query: 61  RHANVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCH 120
           RHANVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCH
Sbjct: 61  RHANVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCH 120

Query: 121 RSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARH 180
           RSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARH
Sbjct: 121 RSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARH 180

Query: 181 YTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKI 240
           YTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKI
Sbjct: 181 YTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKI 240

Query: 241 QVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYFVELPEATPPTE 300
           QVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYFVELPEATPPTE
Sbjct: 241 QVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYFVELPEATPPTE 300

>KLLA0E14828g complement(1323743..1324675)
           gi|27526973|emb|CAD36964.1 Kluyveromyces lactis
           serine/threonine-protein kinase KIN28, start by
           similarity
          Length = 310

 Score =  522 bits (1345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 239/299 (79%), Positives = 273/299 (91%)

Query: 2   TAVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIR 61
           T  +YTKEKK GEGTYAVVYLG +++ GR IA+KEIKTSQFKDGLDMSA+REVK+LQE++
Sbjct: 6   TVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLDMSALREVKFLQELK 65

Query: 62  HANVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHR 121
           H NVIELVD+FMA +NLNLVLEFLPADLE++IKD+S++F+ ADIKSW+LMTLRGVHHCHR
Sbjct: 66  HVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCHR 125

Query: 122 SFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHY 181
           +FILHRDLKPNNLLLAPDGQLKIADFGLAR +A+P E +TSNVVTRWYRAPELLFGA+HY
Sbjct: 126 NFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKHY 185

Query: 182 TAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKIQ 241
           T+AVD+WSVGVIFAELMLRIPYLPG+DDVDQI+VTFRALGTPTD DWPEVSSFS YNKIQ
Sbjct: 186 TSAVDIWSVGVIFAELMLRIPYLPGKDDVDQINVTFRALGTPTDADWPEVSSFSNYNKIQ 245

Query: 242 VYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYFVELPEATPPTE 300
           +YPPPSR ELR RFIAATENAL+L+ GM+ M+P KRWD  +CL SQYF ELPE T P +
Sbjct: 246 IYPPPSREELRRRFIAATENALELISGMMIMNPKKRWDAVKCLQSQYFQELPEPTLPQD 304

>Scas_613.13*
          Length = 312

 Score =  511 bits (1317), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 231/300 (77%), Positives = 272/300 (90%)

Query: 1   MTAVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEI 60
           +T   YTK KKVGEGTYAVVYLG +Q+ GRQIA+KEIKTS+FKDGLDMSAIREVKYLQEI
Sbjct: 9   ITQTEYTKGKKVGEGTYAVVYLGTKQSTGRQIAVKEIKTSEFKDGLDMSAIREVKYLQEI 68

Query: 61  RHANVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCH 120
           +H NVIELVD+FMA +NLNLVLEFLP+DLE++IKD S+LFT ADIKSW+LMTLRGVHHCH
Sbjct: 69  QHDNVIELVDIFMAYDNLNLVLEFLPSDLEVIIKDRSILFTPADIKSWMLMTLRGVHHCH 128

Query: 121 RSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARH 180
           R+FILHRDLKPNNLLL+PDG +K+ADFGLAR + +PHE +TSNVVTRWYRAPELLFGA+H
Sbjct: 129 RNFILHRDLKPNNLLLSPDGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKH 188

Query: 181 YTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKI 240
           YT+A+D+WSVGVIFAELMLRIPYLPG++D+DQ++VTFRALGTPTDK+WPEVSSF +YNK+
Sbjct: 189 YTSAIDIWSVGVIFAELMLRIPYLPGQNDIDQMEVTFRALGTPTDKEWPEVSSFGSYNKL 248

Query: 241 QVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYFVELPEATPPTE 300
           Q+YPPPS  ELR RFIAA+ENAL+ MCGMLTM+P KRW+   CL S+YF E+P  + P+E
Sbjct: 249 QIYPPPSIDELRKRFIAASENALNFMCGMLTMNPKKRWNAIECLESEYFKEMPPPSDPSE 308

>YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699)
           Cyclin-dependent serine/threonine protein kinase,
           component of TFIIK subcomplex of transcription factor
           TFIIH, phosphorylates C-terminal domain (CTD) of Rpo21p
           [921 bp, 306 aa]
          Length = 306

 Score =  504 bits (1299), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 229/296 (77%), Positives = 267/296 (90%)

Query: 4   VNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHA 63
           + YTKEKKVGEGTYAVVYLG + + GR+IAIKEIKTS+FKDGLDMSAIREVKYLQE++H 
Sbjct: 5   MEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHP 64

Query: 64  NVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSF 123
           NVIEL+D+FMA +NLNLVLEFLP DLE++IKD S+LFT ADIK+W+LMTLRGV+HCHR+F
Sbjct: 65  NVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNF 124

Query: 124 ILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTA 183
           ILHRDLKPNNLL +PDGQ+K+ADFGLAR + APHE +TSNVVTRWYRAPELLFGA+HYT+
Sbjct: 125 ILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTS 184

Query: 184 AVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKIQVY 243
           A+D+WSVGVIFAELMLRIPYLPG++DVDQ++VTFRALGTPTD+DWPEVSSF  YNK+Q+Y
Sbjct: 185 AIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIY 244

Query: 244 PPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYFVELPEATPPT 299
           PPPSR ELR RFIAA+E ALD MCGMLTM+P KRW   +CL S YF ELP  + P+
Sbjct: 245 PPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPPSDPS 300

>CAGL0H10318g complement(1006299..1007222) highly similar to
           sp|P06242 Saccharomyces cerevisiae YDL108w KIN28
           cyclin-dependent ser/thr protein kinase, hypothetical
           start
          Length = 307

 Score =  499 bits (1286), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 224/298 (75%), Positives = 270/298 (90%)

Query: 1   MTAVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEI 60
           M    YTKEKKVGEGTYAVVY+G +Q+ GR+IA+KEIKTS+FKDGLDMSAIREVKYLQE+
Sbjct: 1   MERAEYTKEKKVGEGTYAVVYVGTKQSTGRRIAVKEIKTSEFKDGLDMSAIREVKYLQEM 60

Query: 61  RHANVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCH 120
           +H NVIELVD+FM+  NLNLVLE+LP DLE++IKD S+LFT ADIKSW+LM++RGVHHCH
Sbjct: 61  QHVNVIELVDIFMSYGNLNLVLEYLPTDLEVVIKDKSILFTPADIKSWMLMSVRGVHHCH 120

Query: 121 RSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARH 180
           R+FILHRDLKPNNLL+APDGQ+K+ADFGLAR + +PHE +TSNVVTRWYRAPELLFGA+H
Sbjct: 121 RNFILHRDLKPNNLLIAPDGQIKVADFGLARAVPSPHEVLTSNVVTRWYRAPELLFGAKH 180

Query: 181 YTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKI 240
           YT+A+D+WS+GVIFAELMLRIPYLPG++D++Q++VTFRALGTPTDKDWPEVSSF++YNK+
Sbjct: 181 YTSAIDVWSLGVIFAELMLRIPYLPGQNDLEQMEVTFRALGTPTDKDWPEVSSFNSYNKL 240

Query: 241 QVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYFVELPEATPP 298
           Q+YPPPSR ELR RFIAATENAL+ M GM+ ++P KRW T +CL S+YF ELP  + P
Sbjct: 241 QMYPPPSRDELRKRFIAATENALNFMNGMMCLNPAKRWSTAQCLESEYFKELPRPSDP 298

>Kwal_23.3471
          Length = 260

 Score =  458 bits (1179), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 209/253 (82%), Positives = 234/253 (92%)

Query: 48  MSAIREVKYLQEIRHANVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKS 107
           MSAIREVKYLQEIRH NVIEL+D++MAQ NLNLVLEFLPADLEM+IKD+S+LFTQADIKS
Sbjct: 1   MSAIREVKYLQEIRHVNVIELIDVYMAQSNLNLVLEFLPADLEMIIKDNSILFTQADIKS 60

Query: 108 WLLMTLRGVHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTR 167
           WLLMTLRGVHHCHR+FILHRDLKPNNLLLAPDGQLK+ADFGLAR + +P + +TSNVVTR
Sbjct: 61  WLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDMLTSNVVTR 120

Query: 168 WYRAPELLFGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKD 227
           WYRAPELLFGA+HYT A+D+WSVGVIFAELMLRIPYLPG+DD+DQIDVTFRALGTPTDKD
Sbjct: 121 WYRAPELLFGAKHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKD 180

Query: 228 WPEVSSFSAYNKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQ 287
           WPE+S+F  YNKIQ YPPPSR E+R RFIAATENAL+LM GMLTM+PHKRWD  +CL S+
Sbjct: 181 WPEISTFGTYNKIQFYPPPSREEMRRRFIAATENALNLMDGMLTMNPHKRWDPIQCLTSE 240

Query: 288 YFVELPEATPPTE 300
           YFVELP  T P+E
Sbjct: 241 YFVELPVPTTPSE 253

>KLLA0D11990g join(complement(1023928..1023944),
           gi|2499590|sp|Q92241|PH85_KLULA Kluyveromyces lactis
           NEGATIVE REGULATOR OF THE PHO SYSTEM, hypothetical start
          Length = 304

 Score =  218 bits (556), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 114/301 (37%), Positives = 174/301 (57%), Gaps = 13/301 (4%)

Query: 6   YTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHANV 65
           + + +KVG GTYA VY G  +T G  +A+KE+K    ++G   +AIRE+  ++E++H N+
Sbjct: 7   FKQLEKVGNGTYATVYKGLNKTTGVYVALKEVKLDS-EEGTPSTAIREISLMKELKHDNI 65

Query: 66  IELVDLFMAQENLNLVLEFLPADLEMLI----KDSSLLFTQAD-IKSWLLMTLRGVHHCH 120
           + L D+   +  L LV EF+  DL+  +    K +S    + D +K +    L+GV  CH
Sbjct: 66  VRLFDVIHTENKLTLVFEFMDNDLKKFMDNRNKGNSHKGLEMDLVKYFQWQLLQGVAFCH 125

Query: 121 RSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARH 180
            + ILHRDLKP NLL+   GQLK+ DFGLAR    P    +S VVT WYRAP++L G+R+
Sbjct: 126 ENRILHRDLKPQNLLINNRGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRN 185

Query: 181 YTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKI 240
           Y  ++D+WS G I AE+++  P  PG +D +Q+ + F  +GTP ++ WP+V+  + YN +
Sbjct: 186 YCTSIDIWSCGCILAEMIMGKPLFPGSNDEEQLKLIFDTMGTPVEQTWPQVTQLAKYNPL 245

Query: 241 QVYPPPSRSELRSRFIAATE-----NALDLMCGMLTMDPHKRWDTTRCLLSQYFVELPEA 295
              PP    +L+      TE     N +DL+ G+L ++P  R      L   +F E   A
Sbjct: 246 --LPPHMPRDLKQLLQNNTEEVLDDNVVDLLHGLLQLNPDARLSAKDALNHPWFAEYNHA 303

Query: 296 T 296
            
Sbjct: 304 N 304

>CAGL0L12474g complement(1345044..1345952) highly similar to
           sp|P17157 Saccharomyces cerevisiae YPL031c
           cyclin-dependent protein kinase, start by similarity
          Length = 302

 Score =  211 bits (536), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 109/303 (35%), Positives = 173/303 (57%), Gaps = 9/303 (2%)

Query: 1   MTAVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEI 60
           M++  + + +K+G GTYA VY G  ++ G  +A+KE+K    ++G   +AIRE+  ++E+
Sbjct: 1   MSSSQFKQLEKLGNGTYATVYKGLNKSTGVYVALKEVKLDS-EEGTPSTAIREISLMKEL 59

Query: 61  RHANVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLL-----FTQADIKSWLLMTLRG 115
           +H N++ L D+   +  L LV E++  DL+  +   ++           +K +    L G
Sbjct: 60  KHDNIVRLYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNAPRGLEMNLVKYFQWQLLEG 119

Query: 116 VHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELL 175
           +  CH + ILHRDLKP NLL+   GQLK+ DFGLAR    P    +S VVT WYRAP++L
Sbjct: 120 LAFCHENKILHRDLKPQNLLITKRGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVL 179

Query: 176 FGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFS 235
            G+R Y+ ++D+WS G I AE++   P  PG +D +Q+ + F  +GTP +  WP V+S  
Sbjct: 180 MGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDKMGTPNETTWPGVTSLP 239

Query: 236 AYNK--IQVYPPPSRSELRSRFIAA-TENALDLMCGMLTMDPHKRWDTTRCLLSQYFVEL 292
            YN    Q  P   ++EL+        +N +DL+ G+L ++P  R    + LL  +F E 
Sbjct: 240 KYNPNFQQRLPKDLKAELQPYVKEPLDDNVIDLLHGLLQLNPDMRLSAKQALLHPWFSEY 299

Query: 293 PEA 295
            E+
Sbjct: 300 YES 302

>KLLA0B09790g complement(855327..856214) highly similar to sp|P00546
           Saccharomyces cerevisiae YBR160w CDC28 cyclin-dependent
           protein kinase, start by similarity
          Length = 295

 Score =  209 bits (531), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 115/296 (38%), Positives = 165/296 (55%), Gaps = 16/296 (5%)

Query: 5   NYTKEKKVGEGTYAVVY----LGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEI 60
           NY + +KVGEGTY VVY    L H+    R +A+K+I+     +G+  +AIRE+  L+E+
Sbjct: 6   NYKRLEKVGEGTYGVVYKAVDLRHQN---RVVAMKKIRLESEDEGVPSTAIREISLLKEL 62

Query: 61  RHANVIELVDLFMAQ-ENLNLVLEFLPADL----EMLIKDSSLLFTQADIKSWLLMTLRG 115
           +  N++ L D+  +    L LV EFL  DL    E + KD  L      IK +++   +G
Sbjct: 63  KDDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMESIPKDQPL--GGNIIKKFMMQLCKG 120

Query: 116 VHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELL 175
           + +CH   I+HRDLKP NLL+  DG LK+ DFGLAR    P    T  +VT WYRAPE+L
Sbjct: 121 IAYCHAHRIIHRDLKPQNLLINRDGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAPEVL 180

Query: 176 FGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFS 235
            G + Y+  VD+WS+G IFAE+  R P   G  ++DQI   FR LGTP ++ WP++    
Sbjct: 181 LGGKQYSTGVDVWSIGCIFAEMCNRKPLFSGDSEIDQIFKIFRVLGTPNERTWPDIIYLP 240

Query: 236 AYNKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYFVE 291
            +     +P  +R  L     +   N +DL+  ++T DP  R    R +   YF E
Sbjct: 241 DFK--TTFPKWNRRNLSEVIPSLDANGIDLLDKLITYDPIHRISAKRAVQHPYFKE 294

>ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH]
           (810941..811828) [888 bp, 295 aa]
          Length = 295

 Score =  206 bits (524), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 115/294 (39%), Positives = 164/294 (55%), Gaps = 16/294 (5%)

Query: 5   NYTKEKKVGEGTYAVVY----LGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEI 60
           NY + +KVGEGTY VVY    L H Q   R +A+K+I+     +G+  +AIRE+  L+E+
Sbjct: 6   NYKRLEKVGEGTYGVVYKAVDLRHGQ---RIVALKKIRLESEDEGVPSTAIREISLLKEL 62

Query: 61  RHANVIELVDLFMAQ-ENLNLVLEFLPADL----EMLIKDSSLLFTQADIKSWLLMTLRG 115
           +  N++ L D+  +    L LV EFL  DL    E + KD  L      IK +++   +G
Sbjct: 63  KDDNIVRLYDIVHSDAHKLYLVFEFLELDLKRYMESVPKDQPL--GDKIIKKFMMQLCKG 120

Query: 116 VHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELL 175
           + +CH   I+HRDLKP NLL+  +G LK+ DFGLAR    P    T  +VT WYRAPE+L
Sbjct: 121 IAYCHAHRIIHRDLKPQNLLINRNGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAPEVL 180

Query: 176 FGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFS 235
            G + Y+  VD+WS+G IFAE+  R P   G  ++DQI   FR LGTP +  WP++    
Sbjct: 181 LGGKQYSTGVDVWSIGCIFAEMCNRKPLFSGDSEIDQIFKIFRLLGTPNESVWPDIVYLP 240

Query: 236 AYNKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYF 289
            +     +P   R +L     +  E+ LDL+  ++T DP  R    R +   YF
Sbjct: 241 DFK--PTFPKWQRRDLAQVVPSLNEHGLDLLDKLVTYDPIHRISAKRAVTHPYF 292

>YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent
           protein kinase essential for completion of START and for
           mitosis, associates with Cks1p and cyclins [897 bp, 298
           aa]
          Length = 298

 Score =  205 bits (522), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 118/296 (39%), Positives = 163/296 (55%), Gaps = 14/296 (4%)

Query: 5   NYTKEKKVGEGTYAVVY--LGHRQTDG-RQIAIKEIKTSQFKDGLDMSAIREVKYLQEIR 61
           NY + +KVGEGTY VVY  L  R   G R +A+K+I+     +G+  +AIRE+  L+E++
Sbjct: 7   NYKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRLESEDEGVPSTAIREISLLKELK 66

Query: 62  HANVIELVDLFMAQ-ENLNLVLEFLPADL----EMLIKDSSLLFTQADI-KSWLLMTLRG 115
             N++ L D+  +    L LV EFL  DL    E + KD  L    ADI K +++   +G
Sbjct: 67  DDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEGIPKDQPL---GADIVKKFMMQLCKG 123

Query: 116 VHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELL 175
           + +CH   ILHRDLKP NLL+  DG LK+ DFGLAR    P    T  +VT WYRAPE+L
Sbjct: 124 IAYCHSHRILHRDLKPQNLLINKDGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAPEVL 183

Query: 176 FGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFS 235
            G + Y+  VD WS+G IFAE+  R P   G  ++DQI   FR LGTP +  WP++    
Sbjct: 184 LGGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRVLGTPNEAIWPDIVYLP 243

Query: 236 AYNKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYFVE 291
            +     +P   R +L     +     +DL+  +L  DP  R    R  +  YF E
Sbjct: 244 DFKP--SFPQWRRKDLSQVVPSLDPRGIDLLDKLLAYDPINRISARRAAIHPYFQE 297

>Scas_721.46
          Length = 296

 Score =  204 bits (520), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 115/292 (39%), Positives = 162/292 (55%), Gaps = 12/292 (4%)

Query: 5   NYTKEKKVGEGTYAVVY--LGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRH 62
           NY + +KVGEGTY VVY  L  RQ   R +A+K+I+     +G+  +AIRE+  L+E++ 
Sbjct: 7   NYKRLEKVGEGTYGVVYKALDMRQGQ-RVVALKKIRLESEDEGVPSTAIREISLLKELKD 65

Query: 63  ANVIELVDLFMAQ-ENLNLVLEFLPADL----EMLIKDSSLLFTQADIKSWLLMTLRGVH 117
            N++ L D+  +    L LV EFL  DL    E + KD SL      IK ++    +G+ 
Sbjct: 66  DNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMESIPKDQSL--GSDIIKKFMRQLCKGIA 123

Query: 118 HCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFG 177
           +CH   ILHRDLKP NLL+  +G LK+ DFGLAR    P    T  +VT WYRAPE+L G
Sbjct: 124 YCHAHRILHRDLKPQNLLINKEGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAPEVLLG 183

Query: 178 ARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAY 237
            + Y+  VD WS+G IFAE+  R P   G  ++DQI   FR LGTP +  WP++     +
Sbjct: 184 GKQYSTGVDTWSIGCIFAEMCNRSPIFSGDSEIDQIFKIFRILGTPNESVWPDIVYLPDF 243

Query: 238 NKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYF 289
                +P   R +L+    +     +DL+  +L  DP  R    R ++  YF
Sbjct: 244 KP--NFPQWRRKDLKQVVPSLDPQGIDLLDKLLAYDPINRISARRAVVHPYF 293

>Scas_568.9*
          Length = 306

 Score =  204 bits (520), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 107/294 (36%), Positives = 166/294 (56%), Gaps = 9/294 (3%)

Query: 6   YTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHANV 65
           + + +K+G GTYA VY G  +T G  +A+KE+K    ++G   +AIRE+  ++E++H N+
Sbjct: 2   FKQLEKLGNGTYATVYKGLNKTTGAYVALKEVKLDS-EEGTPSTAIREISLMKELKHENI 60

Query: 66  IELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQAD-----IKSWLLMTLRGVHHCH 120
           + L D+   +  L LV E++  DL+  +   ++  +        +K +    L G+  CH
Sbjct: 61  VRLYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNSPRGLELNLVKYFQWQLLEGLAFCH 120

Query: 121 RSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARH 180
            + ILHRDLKP NLL+   G LK+ DFGLAR    P    +S VVT WYRAP++L G+R 
Sbjct: 121 ENKILHRDLKPQNLLINKKGALKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRT 180

Query: 181 YTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNK- 239
           Y+ ++D+WS G I AE++   P  PG +D +Q+ + F  +GTPT+  WP VS+   YN  
Sbjct: 181 YSTSIDIWSCGCILAEMITGKPLFPGSNDEEQLKLIFETMGTPTEATWPGVSALPKYNPN 240

Query: 240 -IQVYPPPSRSELRSRFIAA-TENALDLMCGMLTMDPHKRWDTTRCLLSQYFVE 291
             Q  P   R  L+        +N +DL+ G+L ++P  R    + L   +F E
Sbjct: 241 FPQRLPKDLRMVLQPYCKEPLDDNVIDLLHGLLQLNPDMRLSAKQALHHPWFAE 294

>AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH]
           (246896..247790,247838..247854) [912 bp, 303 aa]
          Length = 303

 Score =  203 bits (517), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 109/300 (36%), Positives = 171/300 (57%), Gaps = 17/300 (5%)

Query: 4   VNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHA 63
           + + + +++G GTYA VY G  +T G  +A+KE+K    ++G   +AIRE+  ++E++H 
Sbjct: 7   IRFKQLERLGNGTYATVYKGLNKTTGLYVALKEVKLDS-EEGTPSTAIREISLMKELKHE 65

Query: 64  NVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSL------LFTQADIKSWLLMTLRGVH 117
           N++ L D+   +  L LV EF+  DL+  + DS L          + +K +    L+GV 
Sbjct: 66  NIVRLYDVIHTENKLTLVFEFMDNDLKKFM-DSRLDREMPRGLELSLVKYFQWQLLQGVA 124

Query: 118 HCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFG 177
            CH + ILHRDLKP NLL+   GQLK+ DFGLAR    P    +S VVT WYRAP++L G
Sbjct: 125 FCHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMG 184

Query: 178 ARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAY 237
           +R Y  ++D+WS G I AE+++     PG +D +Q+ + F  +GTPT++ W  VS    Y
Sbjct: 185 SRTYCTSIDIWSCGCILAEMIMGKALFPGTNDDEQLKLIFETMGTPTEQTWVGVSQLPKY 244

Query: 238 N-KIQVYPPPSRSELRSRFIAATENAL-----DLMCGMLTMDPHKRWDTTRCLLSQYFVE 291
           N +I +YP     +++    A T+  +     +L+ G+L ++P  R    + L    F E
Sbjct: 245 NPQIPLYP---NKDIKQLLQATTKEQISDVLVNLIQGLLQLNPSMRLSAQQALSHPLFEE 301

>CAGL0H07535g 736241..737137 highly similar to sp|P00546
           Saccharomyces cerevisiae YBR160w CDC28, start by
           similarity
          Length = 298

 Score =  201 bits (511), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 116/295 (39%), Positives = 163/295 (55%), Gaps = 12/295 (4%)

Query: 5   NYTKEKKVGEGTYAVVY--LGHRQTDG-RQIAIKEIKTSQFKDGLDMSAIREVKYLQEIR 61
           NY + +KVGEGTY VVY  L  R   G R +A+K+I+     +G+  +AIRE+  L+E++
Sbjct: 7   NYKRLEKVGEGTYGVVYKALDLRPGKGQRVVALKKIRLESEDEGVPSTAIREISLLKELK 66

Query: 62  HANVIELVDLFMAQ-ENLNLVLEFLPADL----EMLIKDSSLLFTQADIKSWLLMTLRGV 116
             N++ L D+  +    L LVLEFL  DL    E + KD  L      IK +++   +G+
Sbjct: 67  DDNIVRLYDIVHSDAHKLYLVLEFLDLDLKRYMESIPKDQPLGVNI--IKKFMVQLCKGI 124

Query: 117 HHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLF 176
            +CH   ILHRDLKP NLL+  +G LK+ DFGLAR    P    T  +VT WYRAPE+L 
Sbjct: 125 AYCHAHRILHRDLKPQNLLIDKEGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAPEVLL 184

Query: 177 GARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSA 236
           G + Y+  VD WS+G IFAE+  R P   G  ++DQI   FR LGTP++  WP++     
Sbjct: 185 GGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRILGTPSEAVWPDIVYLPD 244

Query: 237 YNKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYFVE 291
           +     +P   R +L     +   + +DL+  +L  DP  R    R     YF E
Sbjct: 245 FK--PSFPQWRRKDLAEVVPSLDPHGIDLLDKLLAYDPINRISARRAANHPYFHE 297

>AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH]
           (805583..806956) [1374 bp, 457 aa]
          Length = 457

 Score =  191 bits (484), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 101/297 (34%), Positives = 163/297 (54%), Gaps = 5/297 (1%)

Query: 5   NYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHAN 64
           +Y +  +VGEGTY  VY        + +A+K+++    +DG  +++IRE+K LQ  +H N
Sbjct: 121 SYQRITQVGEGTYGKVYKCRNIYTNKLVALKKLRLETERDGFPITSIREIKLLQHCQHEN 180

Query: 65  VIELVDLFM-AQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSF 123
           V  + ++   AQ+ + ++ E+   DL  L+ +  + F+ A+ K      L+G+ + H   
Sbjct: 181 VSTIAEIMCEAQKTVYMIFEYADNDLSGLLMNKEIHFSDANCKHLFRQLLKGMEYLHECR 240

Query: 124 ILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTA 183
           ILHRD+K +N+L+   G LKI DFGLAR +    ++ T+ V+T WYR PELL G   Y  
Sbjct: 241 ILHRDIKGSNILIDNRGNLKITDFGLARKMKQEPDY-TNRVITLWYRPPELLLGTTRYGT 299

Query: 184 AVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKI--- 240
            VD+W  G +  EL L+  +  G ++++Q+   F+ LGTPT + WP +     +  +   
Sbjct: 300 EVDMWGCGCLLVELFLKAAFFQGTNELEQLRCIFQVLGTPTIEQWPGLFDMPWWFMMIPQ 359

Query: 241 QVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYFVELPEATP 297
           Q    PSR + +   +  T++  DL  G+L  D  KR+  +  L S YF ELP   P
Sbjct: 360 QKENYPSRFDEKVSGVLPTQSCRDLARGLLLYDQKKRFSASEALKSAYFYELPRPEP 416

>Kwal_26.7552
          Length = 461

 Score =  189 bits (479), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 101/298 (33%), Positives = 165/298 (55%), Gaps = 9/298 (3%)

Query: 6   YTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHANV 65
           Y + ++VGEGTY  VY       G+ +A+K ++    ++G  +++IRE+K LQ   H N+
Sbjct: 131 YERIQQVGEGTYGKVYKARNTVTGQLVALKRLRLEGEREGFPITSIREIKLLQSFDHRNI 190

Query: 66  IELVDLFM-AQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFI 124
             L ++ + +Q+ + ++ E+   DL  L+ +  +  + A+ K      L G+H+ H + I
Sbjct: 191 STLSEIMVESQKTVYMIFEYADNDLSGLLMNEQITLSNANCKHLFKSLLEGIHYLHDNGI 250

Query: 125 LHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAA 184
           LHRD+K +N+L+   GQLKI DFGLAR +    ++ T+ V+T WYR PELL G+ +Y  A
Sbjct: 251 LHRDIKGSNILIDNKGQLKITDFGLARKMRDDSDY-TNRVITLWYRPPELLMGSTNYGTA 309

Query: 185 VDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKIQVYP 244
           VD+W  G +  EL  +     G ++V+Q++  F  +GTPT + WP +     +    + P
Sbjct: 310 VDMWGCGCLLVELFKKTAIFQGTNEVEQLNAIFSIMGTPTVEQWPNLFEMPWF--FMMIP 367

Query: 245 PPSR---SELRSRF--IAATENALDLMCGMLTMDPHKRWDTTRCLLSQYFVELPEATP 297
             +R   S+   +F  I  +  A DL  G+L  D  +R+  +  L  QYF E PE  P
Sbjct: 368 QQTRKHESKFDEKFGPILPSSAAADLAKGLLLYDEKRRFSASDALKHQYFREEPEPQP 425

>Scas_610.7
          Length = 668

 Score =  192 bits (488), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 114/337 (33%), Positives = 176/337 (52%), Gaps = 56/337 (16%)

Query: 3   AVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRH 62
           A NY ++KK+G+GT+  VY G      RQIA+K+I  +  KD   ++A RE+  L+ + H
Sbjct: 69  ANNYREDKKLGQGTFGEVYKGVHLATQRQIAMKKILVNVEKDLFPITAQREIVILKRLNH 128

Query: 63  ANVIELVDLFM--------------------------AQENLNLVLEFLPADLEMLIKDS 96
            N+I+L+++                              ++  ++L ++ ADL  ++ + 
Sbjct: 129 KNIIKLIEMVYDYAPDSSSSRAAEVKSLSTAAGPPASPSKHFYMILPYMVADLSGILHNP 188

Query: 97  SLLFTQADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTL--- 153
            +     DIK+ +L  L GV++ H    +HRD+K  N+L+  +G LK+ADFGLART    
Sbjct: 189 RITLEMPDIKNIMLQVLEGVNYIHCQKFMHRDIKAANILIDHNGILKLADFGLARTYYGS 248

Query: 154 ---------AAPHEFMTSNVVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELMLRIPYL 204
                    A      TS VVTRWYRAPEL+ G +HYT AVD+W VG +FAEL  + P L
Sbjct: 249 PPNLKYPGGAGSGAKYTSVVVTRWYRAPELVLGDKHYTTAVDIWGVGCVFAELFEKKPIL 308

Query: 205 PGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKIQVYPPPS-------RSELRSRFIA 257
            G  D+DQ  + F+ +GTPT+++W          K+  Y P S       +S +  RF  
Sbjct: 309 QGSSDIDQGHIIFKLMGTPTEEEW----------KLAHYLPGSELTRTNYKSTIDERFGK 358

Query: 258 -ATENALDLMCGMLTMDPHKRWDTTRCLLSQYFVELP 293
              ++ LD + G+L +DP+KR      +  ++F E P
Sbjct: 359 WLDKSGLDFLKGLLALDPYKRLTAMSAVKHEFFKEEP 395

>Kwal_27.11803
          Length = 246

 Score =  174 bits (442), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 91/243 (37%), Positives = 140/243 (57%), Gaps = 8/243 (3%)

Query: 57  LQEIRHANVIELVDLFMAQENLNLVLEFLPADLEM-----LIKDSSLLFTQADIKSWLLM 111
           ++E++H N++ L D+   +  L LV EF+  DL+      ++ ++   F  + +K +   
Sbjct: 1   MKELKHENIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRIVGNTPYGFEMSLVKYFEWQ 60

Query: 112 TLRGVHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRA 171
            L+GV  CH + ILHRDLKP NLL+   GQLK+ DFGLAR    P    +S VVT WYRA
Sbjct: 61  LLQGVAFCHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRA 120

Query: 172 PELLFGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEV 231
           P++L G+R Y+ ++D+WS G I AE++   P  PG +D +Q+ + F  +GTPT++ WP V
Sbjct: 121 PDVLMGSRTYSTSIDIWSCGCILAEMITGRPLFPGTNDEEQLKLIFETMGTPTERTWPGV 180

Query: 232 SSFSAYNKI--QVYPPPSRSELRSRFIAATENAL-DLMCGMLTMDPHKRWDTTRCLLSQY 288
           S+   YN    Q  P    + L+S+     +  L DL+ G+L  +P +R    + L   +
Sbjct: 181 STLPKYNPQLPQHLPKDLGALLQSQTREKMDLTLIDLLYGLLQPNPDRRLSAKQALNHPW 240

Query: 289 FVE 291
           F E
Sbjct: 241 FAE 243

>CAGL0I08349g complement(813728..815731) similar to sp|P23293
           Saccharomyces cerevisiae YPR161c SGV1 ser/thr protein
           kinase, hypothetical start
          Length = 667

 Score =  184 bits (468), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 115/331 (34%), Positives = 175/331 (52%), Gaps = 49/331 (14%)

Query: 5   NYTKEKKVGEGTYAVVYLG-HRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHA 63
           NY +E+K+G+GT+  VY G H QT  R++A+K I  +Q  D   ++A RE+  L+ + H 
Sbjct: 59  NYKEEEKLGQGTFGEVYKGLHLQTQ-RKVAMKRIIVNQENDLFPITAQREITILKRLNHK 117

Query: 64  NVIELVDLFM-----------AQENLN--------------LVLEFLPADLEMLIKDSSL 98
           N+I+L+++             AQ N N              ++L ++ ADL  ++ +  +
Sbjct: 118 NIIKLLEMVYDFPPESNNKDYAQFNQNNSANPPAVPKKFFYMILPYMVADLSGILHNPRI 177

Query: 99  LFTQADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTL----- 153
               ADIK+ +   L GV+  H S  +HRD+K  NLL+  +G LK+ADFGLAR       
Sbjct: 178 ELKMADIKNMMKQILEGVNFIHCSKFMHRDIKTANLLIDHNGVLKLADFGLARQYYGSPP 237

Query: 154 -------AAPHEFMTSNVVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELMLRIPYLPG 206
                  A      TS VVTRWYRAPEL+ G ++YT AVD+W VG +FAE   + P L G
Sbjct: 238 NIKFPGSAGSGAKYTSVVVTRWYRAPELVLGDKYYTTAVDIWGVGCVFAEFFEKKPILQG 297

Query: 207 RDDVDQIDVTFRALGTPTDKDWPEVSSF---SAYNKIQVYPPPSRSELRSRFIAA-TENA 262
           + D+DQ  V F+ +GTP ++ W E++ +   +   K +      +S +  RF    T   
Sbjct: 298 KTDIDQGHVIFKLMGTPDERTW-ELAKYLPGAELTKTEY-----KSTIDERFGKHLTPTG 351

Query: 263 LDLMCGMLTMDPHKRWDTTRCLLSQYFVELP 293
           L  + G+L +DP+KR      +   +F E P
Sbjct: 352 LSFLKGLLALDPYKRLTAMSAMKHPFFQEEP 382

>KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1
           Kluyveromyces lactis CTD kinase largest subunit,
           hypothetical start
          Length = 455

 Score =  178 bits (451), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 159/294 (54%), Gaps = 10/294 (3%)

Query: 11  KVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHANVIELVD 70
           +VGEGTY  VY       G+ IA+K ++  Q +DG  +++IRE+K LQ++ H N+  + +
Sbjct: 134 QVGEGTYGKVYKAENVHTGKLIALKRLRLEQERDGFPITSIREIKLLQQLNHPNISLIHE 193

Query: 71  LFMAQEN-LNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFILHRDL 129
           + ++ +N +++  +++  DL  ++ D S+ F+ ++IK  +     G+ + H+  I+HRD+
Sbjct: 194 IIVSDKNTISMGFQYMENDLSGMLMDKSIQFSDSNIKHLMKQLFVGLQYLHQQQIVHRDI 253

Query: 130 KPNNLLLAPDGQLKIADFGLARTL---AAPHEFMTSNVVTRWYRAPELLFGARHYTAAVD 186
           K +NLL+   G LKI DFGLA+ L   ++P    T+ V+T WYR PELL GA  Y   VD
Sbjct: 254 KGSNLLIDNRGNLKITDFGLAKKLTDVSSPAS-NTNRVITLWYRPPELLLGATDYKYEVD 312

Query: 187 LWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKIQVYPPP 246
            W  G +  EL       PG ++VDQ       +G+PT + WP++     +    + P  
Sbjct: 313 CWGCGCLLVELFAGAAIFPGSNEVDQFQRILSIMGSPTLEQWPKMLDMPWW--FMLVPQI 370

Query: 247 SRSELR---SRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYFVELPEATP 297
           S++        F    ++ALDL   +L  D   R+ TT  L   YF   P+  P
Sbjct: 371 SKTYKNVFFDEFSKVPQDALDLASKLLRYDQDTRFTTTEALQHHYFTNEPKPQP 424

>Scas_721.110
          Length = 520

 Score =  177 bits (450), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 99/305 (32%), Positives = 157/305 (51%), Gaps = 9/305 (2%)

Query: 2   TAVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIR 61
           T+  Y +  +VGEGTY  VY    +     +A+K+++ +  KDG  +++IRE+K LQ   
Sbjct: 181 TSSIYERIVQVGEGTYGKVYKARNEVTSHLVALKKLRLNNEKDGFPITSIREIKLLQTFH 240

Query: 62  HANVIELVDLFMAQENL-NLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCH 120
           H N+  LV++ +    +  ++ E+   DL  L+ D +++ +    K      LRGV + H
Sbjct: 241 HPNIATLVEIMVESSKMVYMIFEYADNDLTGLLGDKNVVMSLGQRKHLFQQLLRGVKYLH 300

Query: 121 RSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSN-----VVTRWYRAPELL 175
            S ILHRD+K +N+L+   G LKI DFGLAR +    +   SN     V+T WYR PELL
Sbjct: 301 DSLILHRDIKGSNILIDNKGNLKITDFGLARKMHVKSDSDGSNDYTNRVITLWYRPPELL 360

Query: 176 FGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWP---EVS 232
            G  +Y+  VD+W  G I  EL   +    G+++++Q+   F+ +G+P   +WP   E+ 
Sbjct: 361 MGTTNYSTEVDMWGCGCILMELFNNVSIFQGQNEIEQLLSIFKIMGSPNLDNWPNFFEMP 420

Query: 233 SFSAYNKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYFVEL 292
            F     +     P   E + + +  +    +L  G+L  D  KR      L S YF E 
Sbjct: 421 WFFMIIPMLTEKYPDLFEEKYKNLLPSSECFNLAKGLLLYDQKKRLSAEEALKSPYFTED 480

Query: 293 PEATP 297
           P+  P
Sbjct: 481 PQPEP 485

>AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH]
           complement(471481..472560) [1080 bp, 359 aa]
          Length = 359

 Score =  172 bits (436), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 108/304 (35%), Positives = 152/304 (50%), Gaps = 21/304 (6%)

Query: 12  VGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHANVIELVDL 71
           +GEG Y +V     +  G  +AIK+I+  + +    +  +RE+K L+  +H N+I + D+
Sbjct: 19  LGEGAYGIVCSAVHKPSGEVVAIKKIEPFE-RTLFSLRTLREIKILKHFQHENIISIYDI 77

Query: 72  -----FMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFILH 126
                F     + ++ E +  DL  +I    L  +   I+ ++  TLRG+   H S I+H
Sbjct: 78  QKPASFDTFNEVYIIQELMQTDLHRVIATQPL--SDDHIQYFIYQTLRGLKALHGSGIIH 135

Query: 127 RDLKPNNLLLAPDGQLKIADFGLART-------LAAPHEFMTSNVVTRWYRAPELLFGAR 179
           RDLKP+NLLL  +  LKI DFGLAR        L  P   MT  V TRWYRAPE++  A 
Sbjct: 136 RDLKPSNLLLNANCDLKICDFGLARIEHGGAADLEHPQAGMTEYVATRWYRAPEVMLTAA 195

Query: 180 HYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNK 239
            YT A+D+WS G I AEL ++ P   G+D   Q+ + F  LGTP   D   V S  A   
Sbjct: 196 QYTKAIDIWSSGCILAELFMKRPLFAGKDYKHQLMLIFELLGTPQGDDLAAVKSRRAREY 255

Query: 240 IQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYFV------ELP 293
           I   P   R+ LR+    A    LDL+  ML  DP +R      L   Y        + P
Sbjct: 256 IATLPRYRRASLRAVIPHANPLGLDLLQRMLVFDPRRRITAADALRHPYLATYHDPRDEP 315

Query: 294 EATP 297
           + TP
Sbjct: 316 DGTP 319

>ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH]
           (735828..738089) [2262 bp, 753 aa]
          Length = 753

 Score =  178 bits (451), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 112/324 (34%), Positives = 171/324 (52%), Gaps = 37/324 (11%)

Query: 5   NYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHAN 64
           NY +EKK+G+GT+  VY G      RQ+A+K+I      D   ++A RE+  L+ + H N
Sbjct: 55  NYKEEKKLGQGTFGEVYRGVHLATQRQVAMKKILVKTENDLFPITAQREITILKRLNHRN 114

Query: 65  VIELVDLFM----AQ-------------------ENLNLVLEFLPADLEMLIKDSSLLFT 101
           V++L+++      AQ                   ++  ++L ++ ADL  ++ +  +   
Sbjct: 115 VVQLIEMVYDYPPAQNGAAYGQDSSQASASADTMKSFYMILPYMVADLSGILHNPRVTLE 174

Query: 102 QADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTL-AAPHEF- 159
            ADIK+ +L  L G+++ H    +HRD+K  N+LL   G LKIADFGLAR    AP    
Sbjct: 175 MADIKNMMLQILEGINYIHCKKFMHRDIKTANILLDHKGILKIADFGLARNYYGAPPNLK 234

Query: 160 ----------MTSNVVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDD 209
                      TS VVTRWYRAPEL+ G ++YT AVD+W +G +FAE   + P L G+ D
Sbjct: 235 YPGGAGTDAKYTSVVVTRWYRAPELVLGDKNYTTAVDIWGIGCVFAEFFEKRPILQGKTD 294

Query: 210 VDQIDVTFRALGTPTDKDWPEVSSFSAYNKIQVYPPPSRSELRSRFIAATENALDLMCGM 269
           +DQ  V F+ +GTP+D DW            +    P+  E   +++  TE  LDL+  +
Sbjct: 295 IDQGHVIFKLMGTPSDSDWQLARYLPGAELTRTSYEPTYKERFGKYL--TEKGLDLLSTL 352

Query: 270 LTMDPHKRWDTTRCLLSQYFVELP 293
           L++DP+KR      +   +F E P
Sbjct: 353 LSLDPYKRLTAMAAMQHPFFSEDP 376

>Kwal_55.21900
          Length = 625

 Score =  176 bits (446), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 114/329 (34%), Positives = 169/329 (51%), Gaps = 40/329 (12%)

Query: 5   NYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHAN 64
           +Y ++KK+G+GT+  VY G      RQ+A+K       KD   ++A RE+  L+++ H N
Sbjct: 56  HYKEDKKLGQGTFGEVYRGVHLETQRQVAMKRTIVKAEKDLFPITAQREITILRKLNHKN 115

Query: 65  VIELVDLFM----------------------AQENLNLVLEFLPADLEMLIKDSSLLFTQ 102
           VI+L+++                        + ++  ++L ++ ADL  ++ +  +    
Sbjct: 116 VIKLIEMVYDYPPTSSNGSSNTTTLPNPNTPSTKSFYMILPYMIADLSGILHNPRIKLGM 175

Query: 103 ADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTL-AAPHEFM- 160
             IK+ LL  L G+++ H    +HRD+K  NLLL   G LKIADFGLAR    AP     
Sbjct: 176 EGIKNILLQILEGINYIHCQKFMHRDIKAANLLLDHKGVLKIADFGLARNYYGAPPNLKY 235

Query: 161 ----------TSNVVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDV 210
                     TS VVTRWYRAPEL+ G +HYT AVD+W VG +F EL  + P L G+ D+
Sbjct: 236 PGGAGVDAKYTSVVVTRWYRAPELVLGDKHYTTAVDMWGVGCVFGELFEKKPILQGQTDI 295

Query: 211 DQIDVTFRALGTPTDKDWPEVSSFSAYNKIQV-YPPPSRSELRSRFIAA-TENALDLMCG 268
           DQ  V F+ LGTP++++WP           +  Y P     +R RF    T+  LDL+  
Sbjct: 296 DQGHVIFKLLGTPSEEEWPLARFLPGAELTRTKYSP----NIRERFGEYLTDTGLDLLSQ 351

Query: 269 MLTMDPHKRWDTTRCLLSQYFVELPEATP 297
           +L +DP+KR          +F E P   P
Sbjct: 352 LLCLDPYKRLTAMAAKKHPFFTEEPLPEP 380

>CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces
           cerevisiae YKL139w CTK1 carboxy-terminal domain kinase,
           hypothetical start
          Length = 553

 Score =  174 bits (442), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 93/294 (31%), Positives = 156/294 (53%), Gaps = 7/294 (2%)

Query: 11  KVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHANVIELVD 70
           +VGEGTY  VY          +A+K+++    ++G  +++IRE+K LQ   H NV  + +
Sbjct: 226 QVGEGTYGKVYKARNTVTKELVALKKLRLQGEREGFPITSIREIKLLQSFNHENVSTIKE 285

Query: 71  LFM-AQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFILHRDL 129
           + + +Q+ + ++ E+   DL  L+ +  +    A  K      L G+ + H + ILHRD+
Sbjct: 286 IMVESQKIIYMIFEYADNDLGGLLLNKQININAAQSKHIFKQILHGIEYLHDNNILHRDI 345

Query: 130 KPNNLLLAPDGQLKIADFGLARTLAAPHEFM---TSNVVTRWYRAPELLFGARHYTAAVD 186
           K +N+L+   G LK+ DFGLAR +    + +   T+ V+T WYR PELL G  +Y   VD
Sbjct: 346 KGSNILIDNQGSLKLTDFGLARKIDCNRDAIRDYTNRVITIWYRPPELLLGTTNYGPEVD 405

Query: 187 LWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKI---QVY 243
           +W  G I  EL  ++    G ++++Q++  F+ +G+P+ + WP +     +  I   Q  
Sbjct: 406 MWGCGCILVELFNKMAIFQGTNELEQLEAIFKVMGSPSIEQWPNIFDMPWFFMIMPQQAT 465

Query: 244 PPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYFVELPEATP 297
             P+  E + R +  T+N   L  G+L  D  KR   +  L S+YF E P+  P
Sbjct: 466 KYPNVFEEKFRAVLETDNCFKLAQGLLRYDQEKRLTASEALQSEYFKEDPQPQP 519

>Kwal_27.11919
          Length = 209

 Score =  165 bits (418), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 125/207 (60%), Gaps = 14/207 (6%)

Query: 5   NYTKEKKVGEGTYAVVY----LGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEI 60
           NY + +KVGEGTY VVY    L H Q   R +A+K+I+     +G+  +AIRE+  L+E+
Sbjct: 6   NYKRLEKVGEGTYGVVYKALDLRHGQ---RVVALKKIRLESEDEGVPSTAIREISLLKEL 62

Query: 61  RHANVIELVDLFMAQ-ENLNLVLEFLPADL----EMLIKDSSLLFTQADIKSWLLMTLRG 115
           +  N++ L D+  +    L LV EFL  DL    E + K+  L      IK +++   +G
Sbjct: 63  KDDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEAIPKEQPL--GDNIIKKFMMQLCKG 120

Query: 116 VHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELL 175
           + +CH   ILHRDLKP NLL+  DG +K+ADFGLAR    P    T  +VT WYRAPE+L
Sbjct: 121 IAYCHSHRILHRDLKPQNLLINRDGNMKLADFGLARAFGVPLRAYTHEIVTLWYRAPEVL 180

Query: 176 FGARHYTAAVDLWSVGVIFAELMLRIP 202
            G + Y+  VD+WS+G IFAE+  R P
Sbjct: 181 LGGKQYSTGVDIWSIGCIFAEMCNRKP 207

>KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces
           cerevisiae YBL016w FUS3 mitogen-activated protein kinase
           (MAP kinase), start by similarity
          Length = 371

 Score =  167 bits (422), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 110/326 (33%), Positives = 163/326 (50%), Gaps = 43/326 (13%)

Query: 12  VGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHANVIELVDL 71
           +GEG Y VV     +  G  +AIK+I+  + K    +  +RE+K L+  +H N+I + D+
Sbjct: 19  LGEGAYGVVCSAKHKPSGEIVAIKKIEPFE-KPLFSIRTLREIKILKHFQHENIISIFDV 77

Query: 72  -----FMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFILH 126
                F     + ++ E +  DL  +I    L  ++  ++ ++  TLR +   H S ++H
Sbjct: 78  QKPSSFEQFNEVYIIQELMQTDLHRVIVTQEL--SEDHVQYFVYQTLRALKVLHGSNVIH 135

Query: 127 RDLKPNNLLLAPDGQLKIADFGLARTLA------------------APHEF--------- 159
           RDLKP+NLLL  +  LKI DFGLAR ++                  +P            
Sbjct: 136 RDLKPSNLLLNSNCDLKICDFGLARIVSERATDGDAHVDADDTDDNSPSSAANDGDPAIS 195

Query: 160 -MTSNVVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFR 218
            MT  V TRWYRAPE++  A  Y+ ++D+WS G I AEL+ + P  PG+D  DQ+ + F+
Sbjct: 196 GMTEYVATRWYRAPEVMLTAAQYSKSMDVWSCGCILAELLGKQPLFPGKDYRDQLILIFQ 255

Query: 219 ALGTPTDKDWPE-VSSFSAYNKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKR 277
            LGTPT+++  E V +  A   I+  P   +   R RF  A+  ALDL+  ML  DP  R
Sbjct: 256 TLGTPTEQELVELVENRRAREYIRSLPKHPKINWRRRFPNASAAALDLLDRMLQFDPRLR 315

Query: 278 WDTTRCLLSQYFVEL------PEATP 297
              T  L   Y V        PE TP
Sbjct: 316 ITATEALSHPYLVSYHDPDDEPEGTP 341

>KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces
           cerevisiae YPR161c SGV1 ser/thr protein kinase,
           hypothetical start
          Length = 645

 Score =  172 bits (435), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 107/333 (32%), Positives = 169/333 (50%), Gaps = 47/333 (14%)

Query: 5   NYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHAN 64
           NY +E+K+G+GT+  V+ G      R++AIK I     KD   ++A RE+  L+ + H N
Sbjct: 54  NYREEEKLGQGTFGEVFKGIHLGTNRKVAIKRILVRAEKDLFPITAQREITILKRMNHKN 113

Query: 65  VIELVDL-------------------------------FMAQENLNLVLEFLPADLEMLI 93
           +++L+++                                +  ++  ++L ++ +DL  L+
Sbjct: 114 IVKLIEIVYDESPTPKTDSTSPRPVGNYHGNNTANQQKLITGKHFFMILPYMVSDLTGLL 173

Query: 94  KDSSLLFTQADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTL 153
            +  + F  AD+K+ +L  L G+++ H +  LHRD+K  N+L+   G +KIADFGLAR  
Sbjct: 174 HNPRVEFGMADVKNIMLQLLEGINYIHCNKFLHRDIKTANILIDHKGVVKIADFGLARNY 233

Query: 154 ------------AAPHEFMTSNVVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELMLRI 201
                       A      TS VVTRWYRAPE++ G RHYT AVD+W +G +FAE   + 
Sbjct: 234 YGSPPNLKYPGGAGSGAKYTSVVVTRWYRAPEIVLGDRHYTTAVDIWGIGCVFAEFFEKK 293

Query: 202 PYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKIQVYPPPSRSELRSRFIAA-TE 260
           P L G+ D+DQ  V F+ +GTP+  +W            +      +S L+ RF  A  E
Sbjct: 294 PILQGQTDIDQGHVIFKLMGTPSMDEWGLAYHLPGSELTKTN---YKSTLQERFSKALNE 350

Query: 261 NALDLMCGMLTMDPHKRWDTTRCLLSQYFVELP 293
             LDL+  +L +DP+KR    +     +F E P
Sbjct: 351 TGLDLLSKLLALDPYKRVTAMKAKKHPFFFEEP 383

>CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomyces
           cerevisiae YHR030c SLT2, hypothetical start
          Length = 488

 Score =  168 bits (426), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 109/295 (36%), Positives = 154/295 (52%), Gaps = 16/295 (5%)

Query: 10  KKVGEGTYAVVYLGHRQTDGRQ---IAIKEIKTSQFKDGLDMSAIREVKYLQEIR-HANV 65
           K++G G Y +V    R T+  +   +AIK++     K  L   ++RE+K L+  R H N+
Sbjct: 25  KEIGHGAYGIV-CSARFTEASEETTVAIKKVTNIFSKTLLCKRSLRELKLLRHFRGHKNI 83

Query: 66  IELVDL---FMAQENLN---LVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHC 119
             L D+   F    ++N   L  E +  D+  +IK    L T A  +S+    L G+ + 
Sbjct: 84  TCLYDMDIVFYPDGSINGLYLYEELMECDMHQIIKSGQAL-TDAHYQSFTYQILCGLKYI 142

Query: 120 HRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAA-PHE---FMTSNVVTRWYRAPELL 175
           H + +LHRDLKP NLL+  D QLKI DFGLAR  +  P E   F+T  V TRWYRAPE++
Sbjct: 143 HSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPEENNQFLTEYVATRWYRAPEIM 202

Query: 176 FGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFS 235
              + YT A+D+WS G I AE +   P   G+D VDQ++   + LGTP D+    V S +
Sbjct: 203 LSYQGYTKAIDIWSTGCILAEFLGGKPLFKGKDYVDQLNRILQVLGTPPDETLRRVGSKN 262

Query: 236 AYNKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYFV 290
             + I       +      F  A E+ALDL+ GML  DP KR    + L   Y  
Sbjct: 263 VQDYIHQLGYIQKIPFSELFPNANEDALDLLEGMLAFDPQKRITVDKALEHPYLT 317

>YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine protein
           kinase required for cell cycle arrest and for cell
           fusion during mating, member of the MAP kinase family of
           protein kinases [1062 bp, 353 aa]
          Length = 353

 Score =  160 bits (406), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 102/294 (34%), Positives = 148/294 (50%), Gaps = 19/294 (6%)

Query: 12  VGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHANVIELVDL 71
           +GEG Y VV     +  G  +AIK+I+    K    +  +RE+K L+  +H N+I + ++
Sbjct: 19  LGEGAYGVVCSATHKPTGEIVAIKKIEPFD-KPLFALRTLREIKILKHFKHENIITIFNI 77

Query: 72  FMAQ--ENLN---LVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFILH 126
                 EN N   ++ E +  DL  +I  S+ + +   I+ ++  TLR V   H S ++H
Sbjct: 78  QRPDSFENFNEVYIIQELMQTDLHRVI--STQMLSDDHIQYFIYQTLRAVKVLHGSNVIH 135

Query: 127 RDLKPNNLLLAPDGQLKIADFGLARTL----------AAPHEFMTSNVVTRWYRAPELLF 176
           RDLKP+NLL+  +  LK+ DFGLAR +                MT  V TRWYRAPE++ 
Sbjct: 136 RDLKPSNLLINSNCDLKVCDFGLARIIDESAADNSEPTGQQSGMTEYVATRWYRAPEVML 195

Query: 177 GARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTP-TDKDWPEVSSFS 235
            +  Y+ A+D+WS G I AEL LR P  PGRD   Q+ + F  +GTP +D D   + S  
Sbjct: 196 TSAKYSRAMDVWSCGCILAELFLRRPIFPGRDYRHQLLLIFGIIGTPHSDNDLRCIESPR 255

Query: 236 AYNKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYF 289
           A   I+  P    + L   F       +DL+  ML  DP KR      L   Y 
Sbjct: 256 AREYIKSLPMYPAAPLEKMFPRVNPKGIDLLQRMLVFDPAKRITAKEALEHPYL 309

>Scas_710.28
          Length = 352

 Score =  159 bits (402), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 145/293 (49%), Gaps = 18/293 (6%)

Query: 12  VGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHANVIELVDL 71
           +GEG Y VV     +  G  +AIK+I+    K    +  +RE+K L+  +H N+I + D+
Sbjct: 19  LGEGAYGVVCSAVHKPTGEIVAIKKIEPFD-KPLFALRTLREIKILKHFQHENIISIFDI 77

Query: 72  FMAQ--ENLN---LVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFILH 126
              +  EN N   ++ E +  DL  +I   +L  T   I+ ++  TLR V   H S ++H
Sbjct: 78  QRPESFENFNEVYIIQELMQTDLHRVISTQNL--TDDHIQYFIYQTLRAVKVLHGSNVIH 135

Query: 127 RDLKPNNLLLAPDGQLKIADFGLARTL----------AAPHEFMTSNVVTRWYRAPELLF 176
           RDLKP+NLL+  +  LKI DFGLAR +          A     MT  V TRWYRAPE++ 
Sbjct: 136 RDLKPSNLLINSNCDLKICDFGLARIIEEDTGDDEPNAQLQNGMTEYVATRWYRAPEVML 195

Query: 177 GARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSA 236
            A  Y+ A+D+WS G I AEL ++ P  PG+D   Q+ + F  +GTP+ +D   + S  A
Sbjct: 196 TAARYSKAMDIWSCGCILAELFMKRPIFPGKDYRHQLMLIFGLIGTPSGRDLLCIESRRA 255

Query: 237 YNKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYF 289
              I   P          F       +DL+  ML  DP  R      L   Y 
Sbjct: 256 REYITTLPKYEPVPWEKVFPNVNPLGIDLLQRMLIFDPRSRITAEEALAHPYL 308

>Kwal_17.2687
          Length = 362

 Score =  159 bits (402), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 100/302 (33%), Positives = 153/302 (50%), Gaps = 20/302 (6%)

Query: 5   NYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHAN 64
            +  ++ +GEG Y VV        G+ +AIK+I+    +    +  +RE+K L+  +H N
Sbjct: 12  EFQLQQLLGEGAYGVVCSARHLPTGQMVAIKKIEPFD-RPLFCLRTLREIKLLRCFQHEN 70

Query: 65  VIELVDL-----FMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHC 119
           +I + D+     F     + ++ E +  DL  +I   +L  +   I+ ++   LR +   
Sbjct: 71  IISIFDIQRPASFETFNEVYIIQELMDTDLHRVIATQTL--SDDHIQYFVYQILRALKCL 128

Query: 120 HRSFILHRDLKPNNLLLAPDGQLKIADFGLARTL-----------AAPHEFMTSNVVTRW 168
           H + ++HRDLKP NLL+  +  +K+ DFGLAR             A     MT  V TRW
Sbjct: 129 HGAEVIHRDLKPANLLVNANCDVKLCDFGLARCAGMGPGASNTGKAGEAGQMTEYVATRW 188

Query: 169 YRAPELLFGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDW 228
           YRAPE++  A  YT A+D+WS G I AEL+LR P  PG+D   Q+ + F+ +G+PT+ D 
Sbjct: 189 YRAPEVMLTAAEYTFAMDVWSCGCILAELLLRRPLFPGKDYHHQLLLIFQVIGSPTEADL 248

Query: 229 PEVSSFSAYNKIQVYPP-PSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQ 287
             V S  A   +   P   +R  LR     A+  ALDL+  ML  DP +R    + L   
Sbjct: 249 ECVRSRRARQYLGTLPRYAAREGLRQLLPQASAEALDLLKRMLVFDPRRRISAAQALRHP 308

Query: 288 YF 289
           Y 
Sbjct: 309 YL 310

>KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA61157.1
           Kluyveromyces lactis protein kinase, start by similarity
          Length = 415

 Score =  160 bits (404), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 96/297 (32%), Positives = 165/297 (55%), Gaps = 24/297 (8%)

Query: 12  VGEGTYAVVYLGHRQTDGRQIAIKEI-KTSQFKDGLDMSAIREVKYLQEIRHANVIELVD 70
           VG G++ VV+    +  G  + IK++ +  +FK+       RE++ ++ I H N+I+L  
Sbjct: 93  VGNGSFGVVFRTKVKETGEDVVIKKVLQDRRFKN-------RELEIMKLISHPNLIDLKY 145

Query: 71  LFMAQEN----LNLVLEFLPADLEMLIKDSSLLFTQAD---IKSWLLMTLRGVHHCHRSF 123
            F+ Q +    LNL+++++P  L   +K+   L    D   IK ++    + +++ H+  
Sbjct: 146 YFLEQSDQELYLNLIVDYMPMSLYQRLKEFISLHQPMDRYEIKIYMFQLFKSLNYLHQVV 205

Query: 124 -ILHRDLKPNNLLLAPDGQL-KIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHY 181
            + HRD+KP N+L+ PD  L KI D G A+ L  P+E   S + +R+YRAPEL+FGA +Y
Sbjct: 206 NVCHRDIKPQNILVDPDTLLLKICDLGSAKQLK-PNEPNVSYICSRYYRAPELIFGATNY 264

Query: 182 TAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVS-SFSAYNKI 240
           T  +D+WS G + AEL+L  P  PG   +DQ+    + LGTPT ++   ++ ++S +   
Sbjct: 265 TTKIDIWSAGCVMAELLLGQPIFPGESKIDQLVEIIKVLGTPTREEICSMNENYSEHKFP 324

Query: 241 QVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLL-SQYFVELPEAT 296
           Q+ P P    L   F   T+  +DL+  ++  DP+ R+   +C+  S YF ++   T
Sbjct: 325 QIRPIP----LNRIFKKETQETIDLLYHIMKYDPNIRYSALQCMFNSTYFTDIVSNT 377

>Scas_688.14
          Length = 479

 Score =  160 bits (406), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 103/292 (35%), Positives = 148/292 (50%), Gaps = 14/292 (4%)

Query: 10  KKVGEGTYAVVYLGH--RQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIR-HANVI 66
           K++G G Y +V         +   +AIK++     K  L   ++RE+K L+  R H N+ 
Sbjct: 27  KEIGHGAYGIVCSARFAEAVEDTTVAIKKVTNVFSKSLLCKRSLRELKLLRHFRGHKNIT 86

Query: 67  ELVDL---FMAQENLN---LVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCH 120
            L D+   F      N   L  E +  D+  +IK S  L T A  +S++   L G+ + H
Sbjct: 87  CLYDMDIVFYPDGTFNGLYLYEELMECDMHQIIKSSQPL-TDAHYQSFIYQILCGLKYIH 145

Query: 121 RSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAP----HEFMTSNVVTRWYRAPELLF 176
            + +LHRDLKP NLL+  D QLKI DFGLAR  +      ++F+T  V TRWYRAPE++ 
Sbjct: 146 SADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVENNQFLTEYVATRWYRAPEIML 205

Query: 177 GARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSA 236
             + YT A+D+WS G I AE +   P   G+D VDQ+    + LGTP D+    + S + 
Sbjct: 206 SYQGYTKAIDIWSTGCILAEFLGGKPIFKGKDYVDQLTRILQVLGTPPDETLRRIGSKNV 265

Query: 237 YNKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQY 288
            + I       +    + +  A   ALDL+  ML  DP KR  T   L   Y
Sbjct: 266 QDYIHQLGYIPKVPFVNLYPDANPQALDLLEKMLAFDPQKRITTDEALEHPY 317

>CAGL0L12650g 1357789..1359492 similar to sp|P39073 Saccharomyces
           cerevisiae YPL042c cyclin-dependent CTD kinase,
           hypothetical start
          Length = 567

 Score =  161 bits (408), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 102/287 (35%), Positives = 155/287 (54%), Gaps = 32/287 (11%)

Query: 33  AIKEIKTSQFKDGLDM--------SAIREVKYLQEIRHANVIELVDLFMAQENLNLVLEF 84
           AIK+ KT   KDG++         SA RE+   +E+ + ++ +LV++F+ ++++ +V EF
Sbjct: 188 AIKKFKTE--KDGIEQLHYTGISQSACREMALCRELDNNHLTKLVEIFLQKKSIYMVYEF 245

Query: 85  LPADLEMLIKDSS----LLFTQADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAPDG 140
              DL  +I   S     +     I+S +   L GV + H++++LHRDLKP N+++  DG
Sbjct: 246 AEHDLLQIIHFHSHPEKRMIPPRMIRSIMWQILDGVSYLHQNWVLHRDLKPANIMVTMDG 305

Query: 141 QLKIADFGLARTLAAPHEFMTSN---VVTRWYRAPELLFGARHYTAAVDLWSVGVIFAEL 197
            +KI D GLAR  +   + M +    VVT WYRAPELL GARHYT A+DLW+VG IFAEL
Sbjct: 306 VVKIGDLGLARKFSNMLQTMYTGDKVVVTIWYRAPELLLGARHYTPAIDLWAVGCIFAEL 365

Query: 198 MLRIPYLPGRD-----------DVDQIDVTFRALGTPTDKDWPEVSSFSAYNKIQVYPPP 246
           +   P   G +             +Q+    + LGTPT K WP +  +  Y ++  + P 
Sbjct: 366 IGLQPIFKGEEAKMDSKKTVPFQANQLQRILKILGTPTPKSWPHLQKYPEYEQLSKF-PK 424

Query: 247 SRSELRSRFIAAT---ENALDLMCGMLTMDPHKRWDTTRCLLSQYFV 290
            R  L   F +A    ++AL L+  +L  +P +R D    L   YF 
Sbjct: 425 YRDNLPGWFHSAGGRDKHALSLLYHLLNYNPIERIDAINALDHSYFT 471

>Kwal_27.12559
          Length = 414

 Score =  158 bits (400), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 108/309 (34%), Positives = 164/309 (53%), Gaps = 28/309 (9%)

Query: 2   TAVNYTKEKKVGEGTYAVVYLG-HRQTDG--RQIAIKEIKTSQFKDGLDMSAIREVKYLQ 58
           T  NY   + +G+G+Y VV     +  DG  R++AIK++     ++ L   AIRE+K+L 
Sbjct: 62  TPGNYEIIQVLGKGSYGVVVSAIDKGEDGKPRRLAIKKVTNIFNREILLKRAIRELKFLN 121

Query: 59  EIR-HANVIELVDLFMAQE----NLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTL 113
             + H N++ LVDL +  E     L    E +  DL  +I  S++ F++  IK +L   L
Sbjct: 122 FFKGHKNIVSLVDLEIVSEKPYDGLYCYQELVDYDLARVIH-STVQFSEFHIKHFLYQIL 180

Query: 114 RGVHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEF--------MTSNVV 165
            G+ + H + ++HRDLKP N+L +  G LKI DFGLAR +A P  F        +TS V 
Sbjct: 181 CGLKYIHSADVIHRDLKPGNILCSIGGNLKICDFGLARGIA-PQYFEQKSDEIHITSYVA 239

Query: 166 TRWYRAPELLFGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTD 225
           TRWYRAPEL+   R YT A+D+W+VG I AE   R P   G D + Q+    + LG+P  
Sbjct: 240 TRWYRAPELILSHRRYTKAIDIWAVGCILAEFYGRKPIFMGHDSLHQVSEILKVLGSPCR 299

Query: 226 KDWPEVSSFSAYNKIQVYPPPSRSELR-----SRFIAATENALDLMCGMLTMDPHKRWDT 280
           +    V+ + +    +++    RSE++     S +  +  +A  L+  +LT DP KR   
Sbjct: 300 ET---VAKYCSARSWEIF--SGRSEVKKMPWSSVYPKSCSDAQALLDMLLTWDPDKRPGV 354

Query: 281 TRCLLSQYF 289
              L   +F
Sbjct: 355 EVALCHPFF 363

>Kwal_27.11830
          Length = 575

 Score =  161 bits (408), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 103/286 (36%), Positives = 150/286 (52%), Gaps = 28/286 (9%)

Query: 33  AIKEIKTSQ------FKDGLDMSAIREVKYLQEIRHANVIELVDLFMAQENLNLVLEFLP 86
           AIK+ KT +         G+  SA RE+   +E+R+ ++  LV++F+  +++ +V EF  
Sbjct: 190 AIKKFKTEREGVEQLHYTGISQSACREMSLCRELRNKHLTHLVEIFLEHKSIYMVSEFAE 249

Query: 87  ADLEMLIKDSS----LLFTQADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAPDGQL 142
            DL  +I   S     L     +KS +   L GV + H+++ILHRDLKP N+++  DG +
Sbjct: 250 HDLLQIIHFHSHPEKRLIPPRMLKSIIWQILDGVSYLHQNWILHRDLKPANIMVTVDGCV 309

Query: 143 KIADFGLARTLAAPHEFMTSN---VVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELML 199
           KI D GLAR      + + +    VVT WYRAPELL GARHYT A+DLW+VG IFAEL+ 
Sbjct: 310 KIGDLGLARKFHNMVQTLYAGDKVVVTIWYRAPELLLGARHYTPAIDLWAVGCIFAELIG 369

Query: 200 RIPYLPGRD-----------DVDQIDVTFRALGTPTDKDWPEVSSFSAYNKIQVYPPPSR 248
             P   G +             +Q+      LG+PT+K WP +  +  Y +I  + P  R
Sbjct: 370 LRPIFKGEEAKMDSKKSVPFQANQLQRILEVLGSPTEKSWPNIFKYPEYEQITKF-PRYR 428

Query: 249 SELRSRFIAA---TENALDLMCGMLTMDPHKRWDTTRCLLSQYFVE 291
             L   + +A    + ALDL+  +L  DP  R D    L   YF  
Sbjct: 429 DNLPVWYHSAGGRNKEALDLLYQLLRYDPITRIDAVDALEHPYFTN 474

>KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_1
           Kluyveromyces lactis MAP kinase, start by similarity
          Length = 495

 Score =  159 bits (402), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 97/281 (34%), Positives = 150/281 (53%), Gaps = 14/281 (4%)

Query: 10  KKVGEGTYAVVYLGH--RQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIR-HANVI 66
           K++G G+Y +V         D   +AIK++     K  L   ++RE+K L+  R H N+ 
Sbjct: 29  KEIGHGSYGIVCSARFTEAADETTVAIKKVTNVFSKTLLCKRSLRELKLLRHFRGHKNIT 88

Query: 67  ELVDLFMAQE------NLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCH 120
            L D+ +  +       L L  E +  D+  ++K    L T A  +S++   L G+ + H
Sbjct: 89  CLYDMDIVFQPDGMFNGLYLYEELMECDMHQIVKSGQPL-TDAHYQSFIYQILCGLKYIH 147

Query: 121 RSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAP----HEFMTSNVVTRWYRAPELLF 176
            + +LHRDLKP NLL+  D QLKI DFGLAR  +      ++F+T  V TRWYRAPE++ 
Sbjct: 148 SADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVENNQFLTEYVATRWYRAPEIML 207

Query: 177 GARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSA 236
             + YT A+D+WS G I AEL+   P   G+D VDQ++   + LGTP ++    + S + 
Sbjct: 208 SYQGYTKAIDVWSCGCILAELLGGKPIFKGKDYVDQLNRILQVLGTPPEETLKRIGSKNV 267

Query: 237 YNKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKR 277
            + I       +    + +  A  +AL+L+ GML+ DP  R
Sbjct: 268 QDYIHQLGYIPKIPFSTLYPNANPDALNLLEGMLSFDPQLR 308

>Kwal_14.1416
          Length = 365

 Score =  155 bits (392), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 100/295 (33%), Positives = 152/295 (51%), Gaps = 20/295 (6%)

Query: 12  VGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIR-HANVIELVD 70
           VGEG Y  V     +  G ++AIK+I+    K+      +RE+K L+    H N+I ++D
Sbjct: 19  VGEGAYGTVCSAVHKPSGTKVAIKKIQPFS-KEMFVTRTLRELKLLKLFHSHENIISVLD 77

Query: 71  LFMAQ-----ENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFIL 125
           +         + + LV E +  DL  +I       +   I+ +    LR +   H + ++
Sbjct: 78  VVRPTSMDKFQAVYLVQELMETDLHKVISSGGASLSDDHIQYFTYQILRALKAIHSAQVI 137

Query: 126 HRDLKPNNLLLAPDGQLKIADFGLARTL-AAPHE------FMTSNVVTRWYRAPELLFGA 178
           HRD+KP+NLLL  +  LK+ DFGLAR L ++ H       FMT  V TRWYRAPE++   
Sbjct: 138 HRDIKPSNLLLNSNCDLKVCDFGLARCLISSTHSRQNLVGFMTEYVATRWYRAPEIMLTF 197

Query: 179 RHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYN 238
           + YT A+D+WS G I AE++   P  PGRD   Q+ +   ALGTP+ +D+  ++S  A  
Sbjct: 198 QQYTVAMDIWSCGCILAEMITGKPLFPGRDYHHQLWLILEALGTPSYEDFENINSKRAKE 257

Query: 239 KIQVYPPPSRSELRSRFIAATEN----ALDLMCGMLTMDPHKRWDTTRCLLSQYF 289
            I     P R +L  + +   ++    A+DL+  MLT +P KR      L   Y 
Sbjct: 258 YIANL--PLRQKLPWQVVLQKQDINPQAVDLLDKMLTFNPDKRISAAEALAHPYL 310

>ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..27572)
           [1098 bp, 365 aa]
          Length = 365

 Score =  155 bits (392), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 98/295 (33%), Positives = 152/295 (51%), Gaps = 20/295 (6%)

Query: 12  VGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIR-HANVIELVD 70
           +GEG Y +V     +  G ++AIK+I+    +       +RE+K L+    H N+I ++D
Sbjct: 19  IGEGAYGIVCSAIHKPTGTKVAIKKIQPFT-RPMFVTRTLRELKLLKFFHSHENIISVLD 77

Query: 71  L-----FMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFIL 125
           +     +   E + LV E +  DL+ +I   +   +   I+ +    LR +   H + ++
Sbjct: 78  IVRPTSYQDFEAVYLVQELMETDLQRIISQPNSFLSDDHIQYFTYQILRALKSLHSAQVI 137

Query: 126 HRDLKPNNLLLAPDGQLKIADFGLARTLAAPHE-------FMTSNVVTRWYRAPELLFGA 178
           HRDLKP+NLLL     LK+ DFGL+R LA+          FMT  V TRWYRAPE++   
Sbjct: 138 HRDLKPSNLLLNSSCDLKLCDFGLSRCLASSDRSRENMVGFMTEYVATRWYRAPEIMLSF 197

Query: 179 RHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYN 238
           + YT A+D+WS G I AE++   P  PGRD   Q+ +    LGTP+ +D+ ++ S  A  
Sbjct: 198 QEYTTAMDIWSCGCILAEMISGKPLFPGRDYHHQLWIILEILGTPSFEDFEQIKSKRA-- 255

Query: 239 KIQVYPPPSRSELRSRFIAATEN----ALDLMCGMLTMDPHKRWDTTRCLLSQYF 289
           K  +   P R ++      +T +    A+DL+  MLT +P KR      L   Y 
Sbjct: 256 KAYIANLPMRPKIPWNVALSTNDINPLAMDLLDKMLTFNPDKRISAADALKHPYL 310

>CAGL0J04290g complement(400939..402012) similar to sp|P16892
           Saccharomyces cerevisiae YBL016w FUS3 or sp|P14681
           Saccharomyces cerevisiae YGR040w KSS1, start by
           similarity
          Length = 357

 Score =  155 bits (391), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 103/309 (33%), Positives = 151/309 (48%), Gaps = 25/309 (8%)

Query: 12  VGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHANVIELVDL 71
           +GEG Y VV     +  G  +AIK+I     K    +  +RE+K L+  +H N+I + D+
Sbjct: 19  LGEGAYGVVCSAVHKPTGEIVAIKKIVPFD-KPLFALRTLREIKILRRFQHENIISIFDI 77

Query: 72  -----FMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFILH 126
                F     + ++ E +  DL  +I   +L  T   I+ ++  TLR +   H S ++H
Sbjct: 78  QKPESFEKFNEVYIIQELMQTDLHRVIATQTL--TDDHIQYFIYQTLRAIKTLHGSNVIH 135

Query: 127 RDLKPNNLLLAPDGQLKIADFGLARTLAAPHEF--------MTSNVVTRWYRAPELLFGA 178
           RDLKP+N+L+  +  LK+ DFGLAR + +            MT  V TRWYRAPE++   
Sbjct: 136 RDLKPSNILINSNCDLKVCDFGLARIIDSGENGDNEVDKIGMTEYVATRWYRAPEVMLTN 195

Query: 179 RHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTP--TDKDWPEVSSFSA 236
             Y+ A+D+WS G I  EL L+ P  PG+D   Q+ + F  +GTP  +DK    + S  A
Sbjct: 196 AKYSRAMDIWSCGCILGELFLKRPLFPGKDYRHQLLLIFGLIGTPDSSDKSMECIESRRA 255

Query: 237 YNKI---QVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYF--VE 291
              I   Q YPP     L+  F       +DL+  ML  DP +R      L   Y     
Sbjct: 256 RQYIASLQKYPP--VRPLQKAFPGVNPVGVDLLSRMLVFDPRERISADDALAHPYLSTYH 313

Query: 292 LPEATPPTE 300
           +PE  P  E
Sbjct: 314 VPEDEPAGE 322

>Kwal_23.5576
          Length = 504

 Score =  157 bits (397), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 100/293 (34%), Positives = 148/293 (50%), Gaps = 14/293 (4%)

Query: 10  KKVGEGTYAVVYLGH--RQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIR-HANVI 66
           K++G G Y +V         +   +AIK++     K  L   ++RE+K L+  R H N+ 
Sbjct: 27  KEIGHGAYGIVCSARFIEAAEETNVAIKKVTNVFSKTLLCKRSLRELKLLRHFRGHKNIT 86

Query: 67  ELVDL---FMAQENLN---LVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCH 120
            L D+   F      N   L  E +  D+  +IK    L T A  +S++   L  + + H
Sbjct: 87  CLYDMDIVFSPNNTFNGLYLYEELMECDIHQIIKSGQPL-TDAHYQSFIYQLLCALKYIH 145

Query: 121 RSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAP----HEFMTSNVVTRWYRAPELLF 176
            + +LHRDLKP NLL+  D QLK+ DFGLAR  +      ++F+T  V TRWYRAPE++ 
Sbjct: 146 SADVLHRDLKPGNLLVNADCQLKVCDFGLARGYSENPVENNQFLTEYVATRWYRAPEIML 205

Query: 177 GARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSA 236
             + YT A+D+WS G I AEL+   P   G+D VDQ++   + LGTP ++    + S + 
Sbjct: 206 SYQGYTKAIDIWSCGCILAELLGGKPIFKGKDYVDQLNRILQVLGTPPEETLERIGSKNV 265

Query: 237 YNKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYF 289
            + I       +    + +  A   ALDL+  MLT DP KR      L   Y 
Sbjct: 266 QDYIHQLGYIPKVPFVTLYPQANVQALDLLEKMLTFDPQKRITVEEALEHPYL 318

>KLLA0A02497g 218592..219680 highly similar to sp|P14681
           Saccharomyces cerevisiae YGR040w KSS1 ser/thr protein
           kinase of the MAP kinase family, start by similarity
          Length = 362

 Score =  154 bits (388), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 99/294 (33%), Positives = 155/294 (52%), Gaps = 21/294 (7%)

Query: 12  VGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMS-AIREVKYLQEIR-HANVIELV 69
           VGEG Y  V     +    ++AIK+I+   F   + ++  +RE+K L+    H N+I ++
Sbjct: 19  VGEGAYGTVCSAIHKPTNTKVAIKKIQP--FSRSMFVTRTLRELKLLKFFHSHENIISVL 76

Query: 70  DLFMAQ-----ENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFI 124
           D+         E + LV E +  DL+ +I   +L  ++  I+ ++   LR +   H + +
Sbjct: 77  DIVRPTSWHKFEAVYLVQELMETDLQKIINQQNL--SEDHIQYFVYQILRALKSLHSAQV 134

Query: 125 LHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHE-------FMTSNVVTRWYRAPELLFG 177
           +HRDLKP+NLLL  +  LK+ DFGLAR LA+  +       FMT  V TRWYRAPE++  
Sbjct: 135 IHRDLKPSNLLLNSNCDLKVCDFGLARCLASSDQSRENMVGFMTEYVATRWYRAPEIMLS 194

Query: 178 ARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAY 237
            + YT A+D+WS G I AE+++  P  PG+D   Q+ +    LG+PT +D+ ++ S  A 
Sbjct: 195 FQEYTTAMDIWSCGCILAEMIMGKPLFPGKDYHHQLWIILEVLGSPTLEDFEQIKSKRAK 254

Query: 238 NKIQVYPPPSRSELRSRFIAATEN--ALDLMCGMLTMDPHKRWDTTRCLLSQYF 289
             I    P  +    +  +    N  A+DL+  MLT +P KR      L   Y 
Sbjct: 255 EYISQL-PMKKGIPWANVLNKEVNPLAIDLLSKMLTFNPDKRISAVEALEHPYL 307

>Kwal_56.23841
          Length = 432

 Score =  155 bits (392), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 97/292 (33%), Positives = 147/292 (50%), Gaps = 6/292 (2%)

Query: 6   YTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHANV 65
           YT    VG G + +V   +     + +AIK+I        L     RE+K L+ +RH N+
Sbjct: 23  YTDLNPVGMGAFGLVCSANDTYTNQSVAIKKIMKPFSTAVLAKRTYRELKLLKHLRHENL 82

Query: 66  IELVDLFMAQ-ENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFI 124
           I L D+F++  E++  V E    DL  L++   L   +  ++ +L   LRG+ + H + +
Sbjct: 83  ICLEDIFLSPLEDIYFVTELQGTDLHRLLQTRPL--EKQFVQYFLYQILRGLKYVHSAGV 140

Query: 125 LHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAA 184
           +HRDLKP+N+L+  +  LKI DFGLAR +  P   MT  V TR+YRAPE++   + Y   
Sbjct: 141 IHRDLKPSNILINENCDLKICDFGLAR-IQDPQ--MTGYVSTRYYRAPEIMLTWQKYNVE 197

Query: 185 VDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKIQVYP 244
           VD+WS G IFAE++   P  PG+D V Q  +    LG+P +     + S +    +   P
Sbjct: 198 VDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPEDVINTICSVNTLKFVTSLP 257

Query: 245 PPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYFVELPEAT 296
                    RF     +A+DL+  ML  DP+KR      L   Y     + T
Sbjct: 258 HRDPVPFSERFKNVEPDAVDLLEKMLVFDPNKRITAADALSHPYLAPYHDPT 309

>Scas_680.20
          Length = 482

 Score =  156 bits (394), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 101/295 (34%), Positives = 156/295 (52%), Gaps = 26/295 (8%)

Query: 13  GEGTYAVVYLGHRQTDGRQIAIKEI-KTSQFKDGLDMSAIREVKYLQEIRHANVIELVDL 71
           G G++ +V       +G  +A+K+I +  +FK+       RE+  L+ + H N+I L   
Sbjct: 174 GSGSFGLVLKAKTLHNGEIVALKKIIQNKKFKN-------RELHMLRLLDHPNIISLKYF 226

Query: 72  FMA-----QENLNLVLEFLPADLEMLIKDSSLLFTQA------DIKSWLLMTLRGVHHCH 120
           F+      +  LNL+ EF+P  L   I+  +   +        + K ++    + + + H
Sbjct: 227 FVEPIDNDESYLNLIFEFVPLSLYQRIRQVATTTSSVQPSHKLEFKCYMWQIFKALDYLH 286

Query: 121 RSF-ILHRDLKPNNLLLAP-DGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGA 178
               I HRD+KP N+L+ P D  LKI DFG A+ L  PH+   S + +R+YRAPEL+ GA
Sbjct: 287 NEVNICHRDIKPQNILIDPMDWSLKICDFGSAKRLN-PHDKNVSFICSRFYRAPELILGA 345

Query: 179 RHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYN 238
             YT ++DLWS G +FAEL+L  P+  G+ D DQI    R LGTPT KD   + S +   
Sbjct: 346 IQYTNSIDLWSTGCVFAELLLLKPFFAGKSDTDQIVEIIRILGTPTLKD---IISMNENY 402

Query: 239 KIQVYPPPSRSELRSRFIAATE-NALDLMCGMLTMDPHKRWDTTRCLLSQYFVEL 292
           K   +P          F    E +A+DL+  +L  DP +R D+++CL+  YF +L
Sbjct: 403 KDYRFPRIHGISWSRLFSDKVEKSAIDLLDKILRYDPTERIDSSKCLIHPYFDDL 457

>Scas_683.6
          Length = 377

 Score =  153 bits (387), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 99/296 (33%), Positives = 156/296 (52%), Gaps = 20/296 (6%)

Query: 12  VGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMS-AIREVKYLQEIR-HANVIELV 69
           +GEG Y  V     +  G ++AIK+I+   F   + ++  +RE+K L     H N+I ++
Sbjct: 19  IGEGAYGTVCSAIHKPSGIKVAIKKIQP--FSKAMFVTRTLREIKLLTYFNNHENIISIL 76

Query: 70  D----LFMAQ-ENLNLVLEFLPADLEMLIKDSSL--LFTQADIKSWLLMTLRGVHHCHRS 122
           D    + M + + + LV E +  DL+ +I +++     T   I+ +    LR +   H +
Sbjct: 77  DKIKPISMDKFQAVYLVQELMETDLQRVISNNNTNKSLTDDHIQYFTYQILRALKSIHSA 136

Query: 123 FILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHE-------FMTSNVVTRWYRAPELL 175
            ++HRDLKP+NLLL  +  LKI DFGL+R L + ++       FMT  V TRWYRAPE++
Sbjct: 137 KVIHRDLKPSNLLLNSNCDLKICDFGLSRCLTSSNDSKKTLVGFMTEYVATRWYRAPEIM 196

Query: 176 FGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFS 235
              + YT A+D+WSVG I AE++   P  PGRD   Q+ +    LGTP+ +D+ ++ S  
Sbjct: 197 LTFQEYTTAMDIWSVGCILAEMVTGRPLFPGRDYHHQLWLILEVLGTPSLEDFEQIKSKR 256

Query: 236 AYNKIQVYP--PPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYF 289
           A   I   P  PP   ++         + +DL+  ML  +P+KR      L   Y 
Sbjct: 257 AREYIANLPLKPPMAWDIVLSNTNLNPDLIDLLTKMLMFNPNKRISAAEALQHPYL 312

>ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C
           (MRK1) - SH] complement(1141943..1143085) [1143 bp, 380
           aa]
          Length = 380

 Score =  153 bits (387), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 100/317 (31%), Positives = 170/317 (53%), Gaps = 31/317 (9%)

Query: 1   MTAVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEI-KTSQFKDGLDMSAIREVKYLQE 59
           +  + Y   + VG G++ VV+    +  G ++AIK++ +  +FK+       RE++ ++ 
Sbjct: 27  VVEITYPATEVVGHGSFGVVFTTVIEQTGEKVAIKKVLQDRRFKN-------RELEIMKL 79

Query: 60  IRHANVIELVDLFMAQE------NLNLVLEFLPADLEMLIKD---SSLLFTQADIKSWLL 110
           ++H NV++L   F   E       LNL+LE++P  L   ++      LL  + +IK ++ 
Sbjct: 80  LQHPNVVDLRYHFYESEPQTNEVYLNLILEYMPQSLYQRLRHFVTGRLLMPRDEIKVYMF 139

Query: 111 MTLRGVHHCHR-SFILHRDLKPNNLLL-APDGQLKIADFGLARTLAAPHEFMTSNVVTRW 168
              + +++ HR + + HRD+KP NLL+ A   QLK+ DFG A+ L  P E   S + +R+
Sbjct: 140 QLFKSLNYLHRVARVCHRDIKPQNLLVDAGTLQLKLCDFGSAKQLR-PTEPNVSYICSRY 198

Query: 169 YRAPELLFGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDW 228
           YRAPEL+FGA +YT  +D+WS G + AEL+L  P  PG   + Q+    + LGTPT ++ 
Sbjct: 199 YRAPELIFGATNYTTQIDIWSTGCVMAELLLGQPMFPGEFVIVQLAEIIKILGTPTRQEI 258

Query: 229 PEVS-SFSAYNKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQ 287
             ++ ++S +   Q+ P P    L   F     + + L+  +L  DP +R++    + S 
Sbjct: 259 CAMNENYSDHKFPQIKPIP----LSKVFKREDAHTVQLLSDVLQYDPTRRFNALMAMCSS 314

Query: 288 YFVEL------PEATPP 298
           YF E+      PE   P
Sbjct: 315 YFDEITGHNTEPETVAP 331

>YHR030C (SLT2) [2317] chr8 complement(168882..170336)
           Serine/threonine protein kinase of MAP kinase family
           involved in the cell wall integrity (low-osmolarity)
           pathway and in G2 phase cell-cycle checkpoint control
           [1455 bp, 484 aa]
          Length = 484

 Score =  155 bits (393), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 100/293 (34%), Positives = 147/293 (50%), Gaps = 14/293 (4%)

Query: 10  KKVGEGTYAVVYLGH--RQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIR-HANVI 66
           K++G G Y +V         +   +AIK++     K  L   ++RE+K L+  R H N+ 
Sbjct: 27  KEIGHGAYGIVCSARFAEAAEDTTVAIKKVTNVFSKTLLCKRSLRELKLLRHFRGHKNIT 86

Query: 67  ELVDL---FMAQENLN---LVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCH 120
            L D+   F    ++N   L  E +  D+  +IK    L T A  +S+    L G+ + H
Sbjct: 87  CLYDMDIVFYPDGSINGLYLYEELMECDMHQIIKSGQPL-TDAHYQSFTYQILCGLKYIH 145

Query: 121 RSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAP----HEFMTSNVVTRWYRAPELLF 176
            + +LHRDLKP NLL+  D QLKI DFGLAR  +       +F+T  V TRWYRAPE++ 
Sbjct: 146 SADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVENSQFLTEYVATRWYRAPEIML 205

Query: 177 GARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSA 236
             + YT A+D+WS G I AE +   P   G+D V+Q++   + LGTP D+    + S + 
Sbjct: 206 SYQGYTKAIDVWSAGCILAEFLGGKPIFKGKDYVNQLNQILQVLGTPPDETLRRIGSKNV 265

Query: 237 YNKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYF 289
            + I       +    + +  A   ALDL+  ML  DP KR      L   Y 
Sbjct: 266 QDYIHQLGFIPKVPFVNLYPNANSQALDLLEQMLAFDPQKRITVDEALEHPYL 318

>KLLA0F20053g 1867209..1868543 highly similar to sp|P32485
           Saccharomyces cerevisiae YLR113w HOG1 ser/thr protein
           kinase of MAP kinase (MAPK) family, start by similarity
          Length = 444

 Score =  154 bits (390), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 97/285 (34%), Positives = 143/285 (50%), Gaps = 6/285 (2%)

Query: 6   YTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHANV 65
           YT    VG G + +V         + +AIK+I        L     RE+K L+ +RH N+
Sbjct: 22  YTNLNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTSVLAKRTYRELKLLKHLRHENL 81

Query: 66  IELVDLFMAQ-ENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFI 124
           I L D+F++  E++  V E    DL  L++   L   +  ++ +L   LRG+ + H + +
Sbjct: 82  ICLEDIFLSPLEDIYFVTELQGTDLHRLLQTRPL--EKQFVQYFLYQILRGLKYVHSAGV 139

Query: 125 LHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAA 184
           +HRDLKP+N+L+  +  LKI DFGLAR +  P   MT  V TR+YRAPE++   + Y   
Sbjct: 140 IHRDLKPSNILINENCDLKICDFGLAR-IQDPQ--MTGYVSTRYYRAPEIMLTWQKYNVE 196

Query: 185 VDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKIQVYP 244
           VD+WS G IFAE++   P  PG+D V Q  +    LG+P       + S +    +   P
Sbjct: 197 VDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVIDTICSENTLKFVTSLP 256

Query: 245 PPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYF 289
                   SRF     +A+DL+  ML  DP KR      L   Y 
Sbjct: 257 HRDPVPFSSRFQNLEPDAIDLLEKMLVFDPKKRITAADALAHPYL 301

>Kwal_47.17868
          Length = 365

 Score =  152 bits (383), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 92/302 (30%), Positives = 164/302 (54%), Gaps = 24/302 (7%)

Query: 3   AVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEI-KTSQFKDGLDMSAIREVKYLQEIR 61
           +++Y   + VG G++ VV+    +  G ++AIK++ +  +FK+       RE++ +++++
Sbjct: 33  SISYPATEVVGHGSFGVVFTTQVRETGDRVAIKKVLQDRRFKN-------RELEIMKQLQ 85

Query: 62  HANVIELVDLF-----MAQENLNLVLEFLPADLEMLIK---DSSLLFTQADIKSWLLMTL 113
           H  V++L   F       +  LNL+LE++P  L   ++          + +IK ++    
Sbjct: 86  HPQVVDLKYYFYETDPQGEVYLNLILEYMPQSLYQRLRHFVSQRSNMPRIEIKLYMYQLA 145

Query: 114 RGVHHCH-RSFILHRDLKPNNLLLAPDG-QLKIADFGLARTLAAPHEFMTSNVVTRWYRA 171
           + +++ H  + + HRD+KP NLL+ P    LK+ DFG A+ L  P E   S + +R+YRA
Sbjct: 146 KSLNYLHTNARVCHRDIKPQNLLVDPQTFALKLCDFGSAKQLK-PSEPNVSYICSRYYRA 204

Query: 172 PELLFGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEV 231
           PEL+FGA +YT  +D+WS G + AEL+L  P  PG   +DQ+    + LGTPT ++   +
Sbjct: 205 PELIFGASNYTVQIDIWSSGCVMAELILGQPMFPGESGIDQLVEIIKILGTPTKQEICSM 264

Query: 232 S-SFSAYNKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYFV 290
           + ++  +   Q+ P P    L   F    +  +  +  +L  DP +R+   +CL + YF 
Sbjct: 265 NPNYMEHKFPQIRPIP----LAKVFKREDDETIRFLFDVLRYDPTERYTALQCLCAPYFD 320

Query: 291 EL 292
           EL
Sbjct: 321 EL 322

>YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine
           protein kinase involved in the filamentous and invasive
           growth pathway, member of the MAP kinase family [1107
           bp, 368 aa]
          Length = 368

 Score =  152 bits (383), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 101/297 (34%), Positives = 154/297 (51%), Gaps = 21/297 (7%)

Query: 12  VGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMS-AIREVKYLQEI-RHANVIELV 69
           +GEG Y  V     +  G ++AIK+I+   F   L ++  IRE+K L+    H N+I ++
Sbjct: 19  IGEGAYGTVCSAIHKPSGIKVAIKKIQP--FSKKLFVTRTIREIKLLRYFHEHENIISIL 76

Query: 70  DLF--MAQENLN---LVLEFLPADLEMLIKDSSLLFTQAD---IKSWLLMTLRGVHHCHR 121
           D    ++ + LN   LV E +  DL+ +I + +  F+      ++ +    LR +   H 
Sbjct: 77  DKVRPVSIDKLNAVYLVEELMETDLQKVINNQNSGFSTLSDDHVQYFTYQILRALKSIHS 136

Query: 122 SFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHE-------FMTSNVVTRWYRAPEL 174
           + ++HRD+KP+NLLL  +  LK+ DFGLAR LA+  +       FMT  V TRWYRAPE+
Sbjct: 137 AQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSSDSRETLVGFMTEYVATRWYRAPEI 196

Query: 175 LFGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSF 234
           +   + YT A+D+WS G I AE++   P  PGRD   Q+ +    LGTP+ +D+ ++ S 
Sbjct: 197 MLTFQEYTTAMDIWSCGCILAEMVSGKPLFPGRDYHHQLWLILEVLGTPSFEDFNQIKSK 256

Query: 235 SAYNKIQVYP--PPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYF 289
            A   I   P  PP   E          + +DL+  ML  +P KR      L   Y 
Sbjct: 257 RAKEYIANLPMRPPLPWETVWSKTDLNPDMIDLLDKMLQFNPDKRISAAEALRHPYL 313

>Scas_713.38
          Length = 432

 Score =  152 bits (385), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 97/292 (33%), Positives = 144/292 (49%), Gaps = 6/292 (2%)

Query: 6   YTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHANV 65
           YT    VG G + +V         + +AIK+I        L     RE+K L+ +RH N+
Sbjct: 23  YTDLNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTAVLAKRTYRELKLLKHLRHENL 82

Query: 66  IELVDLFMAQ-ENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFI 124
           I L D+F++  E++  V E    DL  L++   L   +  ++ +L   LRG+ + H   +
Sbjct: 83  ICLQDIFLSPLEDIYFVTELQGTDLHRLLQTRPL--EKQFVQYFLYQILRGLKYVHSVGV 140

Query: 125 LHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAA 184
           +HRDLKP+N+L+  +  LKI DFGLAR +  P   MT  V TR+YRAPE++   + Y   
Sbjct: 141 IHRDLKPSNILINENCDLKICDFGLAR-IQDPQ--MTGYVSTRYYRAPEIMLTWQKYDVE 197

Query: 185 VDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKIQVYP 244
           VD+WS G IFAE++   P  PG+D V Q  +    LG+P +     + S +    +   P
Sbjct: 198 VDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPEDVINTICSENTLKFVTSLP 257

Query: 245 PPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYFVELPEAT 296
                    RF     +A+DL+  ML  DP KR      L   Y     + T
Sbjct: 258 HRDPIPFSERFKTVEPDAVDLLGKMLVFDPKKRVTAAEALAHPYLAPYHDPT 309

>CAGL0D01694g complement(176981..178279) similar to sp|P41808
           Saccharomyces cerevisiae YPR054w SMK1
           sporulation-specific MAP kinase, hypothetical start
          Length = 432

 Score =  152 bits (383), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 101/312 (32%), Positives = 159/312 (50%), Gaps = 28/312 (8%)

Query: 12  VGEGTYAVVYLGHRQTDGRQ-----IAIKEIKTSQFKDGLDMSAIREVKYLQEIR-HANV 65
           +G+G+Y VV     + D        +AIK+I    ++  L   AIRE+K++   + H ++
Sbjct: 75  LGKGSYGVVCSAKHKLDNEDQEQFTVAIKKITNIFYRKILLKRAIREIKFMNYFKGHKHI 134

Query: 66  IELVDLFMAQE----NLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHR 121
           + L+D+ + Q+     L    E +  DL  +I  SS+  ++  I+ ++   L GV + H 
Sbjct: 135 VNLIDIEIVQDKPYDGLYCYQELIDYDLARVIH-SSVQLSEFHIQHFIYQILCGVKYIHS 193

Query: 122 SFILHRDLKPNNLLLAPDGQLKIADFGLARTLAA--------PHEFMTSNVVTRWYRAPE 173
           + ++HRDLKP N+L   +G LKI DFGLAR +A         P+E +T+ V TRWYRAPE
Sbjct: 194 ADVIHRDLKPGNILCTVNGCLKICDFGLARGVAKQFVNKNSKPNE-ITNYVATRWYRAPE 252

Query: 174 LLFGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSS 233
           L+     YT +VD+WSVG I AE   R P   G+D + Q+    + LGTP+     +  +
Sbjct: 253 LILSNNEYTKSVDMWSVGCILAEFYGRRPIFMGKDSIHQVYEIKKILGTPSRSLLVKYGT 312

Query: 234 FSAYNKIQVYPPPSRSELRSR------FIAATENALDLMCGMLTMDPHKRWDTTRCLLSQ 287
             A+N        +   L+S       +  A+  ALDL+  +L  +P  R +  + L  Q
Sbjct: 313 LKAWNLFGHNSNHNLDNLKSGMPWSTVYPMASATALDLIDKLLQWEPESRLNVLQSLEHQ 372

Query: 288 YF--VELPEATP 297
           +   V  P   P
Sbjct: 373 FVQSVRKPNDEP 384

>Scas_623.11
          Length = 378

 Score =  150 bits (378), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 90/293 (30%), Positives = 162/293 (55%), Gaps = 24/293 (8%)

Query: 12  VGEGTYAVVYLGHRQTDGRQIAIKEI-KTSQFKDGLDMSAIREVKYLQEIRHANVIELVD 70
           +G+G++ +V+    +     +AIK++ +  +FK+       RE++ ++ I+H NVI L  
Sbjct: 53  IGKGSFGLVFCTTIRETDEVVAIKKVLQDRRFKN-------RELEIMKLIQHPNVINLKY 105

Query: 71  LFMAQE-----NLNLVLEFLPADLEMLIKD---SSLLFTQADIKSWLLMTLRGVHHCHRS 122
            F  ++      LNL+L+++P  L   ++         ++ +IK ++    + +++ H +
Sbjct: 106 YFYEKDVDDEVYLNLILDYMPQSLYQRLRHFVHQRQSMSRLEIKFYMFQLFKSLNYLHNA 165

Query: 123 -FILHRDLKPNNLLLAPDG-QLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARH 180
             + HRD+KP N+L+ P+   LK+ DFG A+ L  P E   S + +R+YRAPEL+FGA +
Sbjct: 166 KNVCHRDIKPQNILVDPNSWNLKLCDFGSAKQLK-PTEPNVSYICSRYYRAPELIFGATN 224

Query: 181 YTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVS-SFSAYNK 239
           Y+  +D+WS G + AEL+L  P  PG   +DQ+    + LGTP+ ++   ++ ++  +  
Sbjct: 225 YSNQIDIWSSGCVMAELLLGQPMFPGESGIDQLVEIIKILGTPSKQEICAMNPNYMEHKF 284

Query: 240 IQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYFVEL 292
            Q+ P P    L   F    E  +D +   L  DP +R+++ +CL S YF EL
Sbjct: 285 PQIKPIP----LAKVFKKEDELTVDFLINTLKYDPMERFNSLQCLCSTYFDEL 333

>Scas_667.18
          Length = 437

 Score =  151 bits (382), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 101/312 (32%), Positives = 163/312 (52%), Gaps = 34/312 (10%)

Query: 10  KKVGEGTYAVVYLG---HRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIR-HANV 65
           K +G+G+Y VV          +   +AIK++     K+ L   AIRE+K++   + H N+
Sbjct: 82  KVLGKGSYGVVCSAMDNKNPANAYPVAIKKVTNIFQKEILLKRAIRELKFMNFFQGHKNI 141

Query: 66  IELVDLFMAQEN-----LNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCH 120
           + L+DL +  EN     L    E +  DL  +I  SS+  T+  I+ ++   L G+ + H
Sbjct: 142 VNLIDLEIINENSPYDGLYCYQELIDYDLAKVIH-SSIKLTEFHIQYFMYQILSGLKYIH 200

Query: 121 RSFILHRDLKPNNLLLAPDGQLKIADFGLAR-----------TLAAP--HEFMTSNVVTR 167
            + ++HRDLKP N+L   +G LKI DFGLAR            LA+P  H+ +T+ V TR
Sbjct: 201 SADVIHRDLKPGNILCTLNGNLKICDFGLARGINPKFYNDNGNLASPKLHD-ITNYVATR 259

Query: 168 WYRAPELLFGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKD 227
           WYRAPEL+   + YT A+DLWSVG I AE   R P   G D + Q+    + LG P+ + 
Sbjct: 260 WYRAPELILSHKMYTKAIDLWSVGCILAEFYGRRPIFMGHDTLHQVYEIVKILGPPSQRL 319

Query: 228 WPEVSSFSAYN-------KIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDT 280
             + +S  AYN       K+    P    + ++ +  A+ +++ L+  +L  +P +R+D 
Sbjct: 320 LSQFASVKAYNIFNNNLAKLHWNSP---IDWKTLYPEASNSSIHLLQNLLKWNPRERFDV 376

Query: 281 TRCLLSQYFVEL 292
            + +   +  E+
Sbjct: 377 EQAITHPFLNEV 388

>CAGL0L06820g 767038..768138 highly similar to sp|P38615
           Saccharomyces cerevisiae YMR139w MDS1
           Serine/threonine-protein kinase, start by similarity
          Length = 366

 Score =  149 bits (375), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 90/302 (29%), Positives = 163/302 (53%), Gaps = 24/302 (7%)

Query: 3   AVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEI-KTSQFKDGLDMSAIREVKYLQEIR 61
            +++   + VG G++ VV+    Q    ++AIK++ +  +FK+       RE++ ++ ++
Sbjct: 34  TISFPATEVVGHGSFGVVFTTVIQETNEKVAIKKVLQDKRFKN-------RELEIMKMLQ 86

Query: 62  HANVIELVDLFMAQEN-----LNLVLEFLPADLEMLIKD---SSLLFTQADIKSWLLMTL 113
           H N+I+L   F   +      LNL+L+++P  L   ++          + +IK ++    
Sbjct: 87  HRNIIDLKYYFYEIDEREDVFLNLILDYMPQSLYQRLRHFVHQRTPMPRLEIKIYMYQLF 146

Query: 114 RGVHHCHRSF-ILHRDLKPNNLLLAPDG-QLKIADFGLARTLAAPHEFMTSNVVTRWYRA 171
           + +++ H +  + HRD+KP NLL+ P+   L++ DFG A+ L  P E   S + +R+YRA
Sbjct: 147 KALNYLHHTANVCHRDIKPQNLLVDPNSWCLRLCDFGSAKQLK-PTEPNVSYICSRYYRA 205

Query: 172 PELLFGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEV 231
           PEL+FGA +YT  +D+WS G + AEL+L  P  PG   +DQ+    + LGTPT ++   +
Sbjct: 206 PELIFGATNYTNQIDIWSSGCVMAELLLGQPMFPGESGIDQLVEIIKILGTPTKQEICVM 265

Query: 232 S-SFSAYNKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYFV 290
           + ++  +   Q+ P P    L   F    E  +D +      DP +R+ + +CL + YF 
Sbjct: 266 NPNYMEHKFPQIKPIP----LAKVFKKEDEVTVDFLSNTFKYDPTQRYHSLQCLCTPYFD 321

Query: 291 EL 292
           E+
Sbjct: 322 EI 323

>KLLA0D11814g complement(1007240..1009021) similar to sp|P39073
           Saccharomyces cerevisiae YPL042c SSN3 cyclin-dependent
           CTD kinase, start by similarity
          Length = 593

 Score =  153 bits (386), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 100/291 (34%), Positives = 151/291 (51%), Gaps = 29/291 (9%)

Query: 33  AIKEIKTS----QFKDGLDMSAIREVKYLQEIRHANVIELVDLFMAQENLNLVLEFLPAD 88
           AIK+ KT     +   G+  SA RE+   +E+ + ++ +LV++F+ ++++ +V EF   D
Sbjct: 209 AIKKFKTEREGVEHYTGISQSACREMSLCRELDNNHLTKLVEIFLEKKSIYMVSEFAEHD 268

Query: 89  LEMLIKDSS----LLFTQADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAPDGQLKI 144
           L  +I   S     L     +KS +   L GV + H+++ILHRDLKP N+++  DG +KI
Sbjct: 269 LLQIIHFHSHPEKRLIPPRMLKSIMWQILDGVSYLHQNWILHRDLKPANIMVTVDGCVKI 328

Query: 145 ADFGLARTLAAPHEFMTSN---VVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELMLRI 201
            D GLAR      + + +    +VT WYRAPEL+ GARHYT A+DLW+VG IFAEL+   
Sbjct: 329 GDLGLARKFNNMVQTLYTGDKVIVTIWYRAPELILGARHYTPAIDLWAVGCIFAELIGLR 388

Query: 202 PYLPGRD-----------DVDQIDVTFRALGTPTDKDWPEVSSFSAYNKIQVYPPPSRSE 250
           P   G +             +Q       +G+P  K WP + S+  Y ++    P  R  
Sbjct: 389 PIFKGEEAKMESKKSVLFQANQFQKILEVMGSPDHKIWPNIDSYPEYLQLAKM-PKYRDN 447

Query: 251 LRSRFIAAT---ENALDLMCGMLTMDPHKRWDTTRCLLSQYFVELPEATPP 298
           L + +  A    + ALD++  +L  DP KR D    L   YF       PP
Sbjct: 448 LTAWYQTAGGKDKTALDILYRLLQYDPIKRIDAIDALDHVYFT---NGDPP 495

>CAGL0M11748g 1167306..1168649 highly similar to sp|P32485
           Saccharomyces cerevisiae YLR113w HOG1, start by
           similarity
          Length = 447

 Score =  150 bits (379), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 95/285 (33%), Positives = 142/285 (49%), Gaps = 6/285 (2%)

Query: 6   YTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHANV 65
           Y+    VG G + +V         +Q+AIK+I        L     RE+K L+ +RH N+
Sbjct: 23  YSDLNPVGMGAFGLVCSATDTLTNQQVAIKKIMKPFATAVLAKRTYRELKLLKHLRHENL 82

Query: 66  IELVDLFMAQ-ENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFI 124
           I L D+F++  E++  V E    DL  L++   L   +  ++ +    LRG+ + H + +
Sbjct: 83  ICLQDIFLSPLEDIYFVTELQGTDLHRLLQTRPL--EKQFVQYFHYQILRGLKYVHSAGV 140

Query: 125 LHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAA 184
           +HRDLKP+N+L+  +  LKI DFGLAR +  P   MT  V TR+YRAPE++   + Y   
Sbjct: 141 VHRDLKPSNILINENCDLKICDFGLAR-IQDPQ--MTGYVSTRYYRAPEIMLTWQKYDVE 197

Query: 185 VDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKIQVYP 244
           VD+WS G IFAE++   P  PG+D V Q  +    LG+P       + S +    +   P
Sbjct: 198 VDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPSDVIDTICSENTLKFVTSLP 257

Query: 245 PPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYF 289
                    RF     +A+DL+  ML  DP KR      L   Y 
Sbjct: 258 HRDPIPFSERFKTVEPDAVDLLEKMLVFDPKKRITAADALAHPYL 302

>AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -
           SH] (1066272..1067981) [1710 bp, 569 aa]
          Length = 569

 Score =  150 bits (379), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 97/293 (33%), Positives = 148/293 (50%), Gaps = 14/293 (4%)

Query: 10  KKVGEGTYAVVYLGH--RQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIR-HANVI 66
           K++G G Y +V         +   +AIK++     K  L   ++RE+K L+  R H N+ 
Sbjct: 27  KEIGYGAYGIVCSARFMESVEDTTVAIKKVTNVFSKALLCKRSLRELKLLRHFRGHKNIT 86

Query: 67  ELVDLFM------AQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCH 120
            L D+ +      +   L+L  E +  D+  +IK    L T A  +S++   L G+ + H
Sbjct: 87  CLYDMDIVLLPDGSFNGLDLYEELMEWDMHQIIKSGQPL-TDAHYQSFVYQILCGLKYIH 145

Query: 121 RSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAP----HEFMTSNVVTRWYRAPELLF 176
            + +LHRDLKP NLL+  D QLKI DFGLAR  +       +F+T  V TRWYRAPE++ 
Sbjct: 146 SADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPIENDQFLTEYVATRWYRAPEIML 205

Query: 177 GARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSA 236
             + YT A+D+WS G + AEL+   P   G+D VDQ++   + LGTP ++    + S + 
Sbjct: 206 SYQGYTRAIDVWSCGCVLAELLGGRPIFKGKDYVDQLNRILQVLGTPPEETLKRIGSKNV 265

Query: 237 YNKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYF 289
            + I       +      +  A  +A DL+  ML +DP  R      L   Y 
Sbjct: 266 QDYIHQLGYIPKVPFERLYPNANPDAADLLERMLALDPKTRITVDEALEHPYL 318

>ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH]
           (146098..147402) [1305 bp, 434 aa]
          Length = 434

 Score =  147 bits (371), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 95/282 (33%), Positives = 150/282 (53%), Gaps = 18/282 (6%)

Query: 12  VGEGTYAVVYLGHRQTDGR---QIAIKEIKTSQFKDGLDMSAIREVKYLQEIR-HANVIE 67
           +G+G+Y  V       +     +IAIK+I     ++ L   AIRE+K++   + H N++ 
Sbjct: 79  LGKGSYGTVVSAIDNLNANYPIRIAIKKITNIFQREVLLKRAIRELKFMHYFKGHKNIVS 138

Query: 68  LVDLFMAQE----NLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSF 123
           L++L +  E     L    E +  DL  +I  S++ F++  IK +    L GV + H + 
Sbjct: 139 LINLEIVNEKPYDGLYCYQELIDYDLARVIH-SNVQFSEFHIKHFTYQILCGVKYIHSAD 197

Query: 124 ILHRDLKPNNLLLAPDGQLKIADFGLARTLA------APHEFMTSNVVTRWYRAPELLFG 177
           ++HRDLKP N+L +  GQLKI DFGLAR ++           +T+ V TRWYRAPEL+  
Sbjct: 198 VIHRDLKPGNILCSISGQLKICDFGLARGISPLFTNTKTSNHITNYVATRWYRAPELILS 257

Query: 178 ARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAY 237
            + Y  ++D+W++G I AE   R P   G+D + QI    + LGTP+     +  S  AY
Sbjct: 258 HKRYNKSIDMWAIGCILAEFYGRKPIFMGQDSMHQISEIVKVLGTPSRDTIIKYGSSRAY 317

Query: 238 NKIQVYPPPSRSEL--RSRFIAATENALDLMCGMLTMDPHKR 277
           + I   P P  +++     +  A  +ALDL+  +L  DP +R
Sbjct: 318 D-IFCPPKPQYAKIPWAEIYPFAGPDALDLIERLLDWDPDRR 358

>AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH]
           (807470..808831) [1362 bp, 453 aa]
          Length = 453

 Score =  147 bits (371), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 96/292 (32%), Positives = 143/292 (48%), Gaps = 6/292 (2%)

Query: 6   YTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHANV 65
           Y     VG G + +V         + +AIK+I        L     RE+K L+ +RH N+
Sbjct: 29  YADLNPVGMGAFGLVCSAVDTYTQQPVAIKKIMKPFSTAVLAKRTYRELKLLKHLRHENL 88

Query: 66  IELVDLFMAQ-ENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFI 124
           I L D+F++  E++  V E    DL  L++   L   +  ++ +L   LRG+ + H + +
Sbjct: 89  ICLEDIFLSPLEDIYFVTELQGTDLHRLLQTRPL--EKQFLQYFLYQILRGLKYVHSAGV 146

Query: 125 LHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAA 184
           +HRDLKP+N+L+  +  LKI DFGLAR +  P   MT  V TR+YRAPE++   + Y   
Sbjct: 147 IHRDLKPSNILINENCDLKICDFGLAR-IQDPQ--MTGYVSTRYYRAPEIMLTWQKYNVE 203

Query: 185 VDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKIQVYP 244
           VD+WS G IFAE++   P  PG+D V Q  +    LG+P       + S +    +   P
Sbjct: 204 VDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVIDTICSENTLKFVTSLP 263

Query: 245 PPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYFVELPEAT 296
                    RF     +A+DL+  ML  DP KR      L   Y     + T
Sbjct: 264 HRDPVPFTERFKNLKPDAVDLLEKMLVFDPKKRITAGDALTHPYLAPYHDPT 315

>KLLA0B11946g complement(1048033..1049352) similar to sp|P41808
           Saccharomyces cerevisiae YPR054w SMK1
           sporulation-specific MAP kinase, start by similarity
          Length = 439

 Score =  145 bits (365), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 98/304 (32%), Positives = 153/304 (50%), Gaps = 19/304 (6%)

Query: 12  VGEGTYAVVYLG---HRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIR-HANVIE 67
           +G+G+Y  V         T   Q+AIK++ +   ++ L   AIRE+K++   + H N++ 
Sbjct: 79  LGKGSYGTVVSAVDKGNPTHEVQLAIKKVTSIFTREILLKRAIRELKFMSYFKGHRNIVS 138

Query: 68  LVDLFMAQE----NLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSF 123
           L+DL +  E     L    E +  DL  +I  S++LF++  IK +L   L G+ + H + 
Sbjct: 139 LIDLEIVNEEPYSGLYCYQELVDYDLARVIH-SNVLFSEFHIKHFLYQILCGMKYIHSAD 197

Query: 124 ILHRDLKPNNLLLAPDGQLKIADFGLARTLAAP-------HEFMTSNVVTRWYRAPELLF 176
           ++HRDLKP N+L +  G++KI DFGLAR ++            +T+ V TRWYRAPEL+ 
Sbjct: 198 VIHRDLKPGNILCSITGEIKICDFGLARGISPSFTVAGGISNHITNYVATRWYRAPELIL 257

Query: 177 GARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSA 236
             + Y+ +VD+W+VG I AE   R P   G D + Q+    + LGTP         S   
Sbjct: 258 SHKRYSKSVDMWAVGCILAEFYGRKPVFMGNDSLHQVMEIQKILGTPKQIVIRTYGSSRC 317

Query: 237 YNKIQVYPPP-SRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYF--VELP 293
           Y+      P   ++     F  A+  A+DLM  ++  +P  R      L   +   V  P
Sbjct: 318 YDIFSTSKPQYKKTPWCEIFPYASSEAVDLMERLIDWNPEARLTVEEALDHPFLQQVRNP 377

Query: 294 EATP 297
           EA P
Sbjct: 378 EAEP 381

>CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces
           cerevisiae YGR040w KSS1, start by similarity
          Length = 398

 Score =  141 bits (356), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 97/321 (30%), Positives = 151/321 (47%), Gaps = 42/321 (13%)

Query: 5   NYTKEKK----VGEGTYAVVYLGHRQTDGRQIAIKEIK---TSQFKDGLD---------- 47
           N  KE K    VGEG+Y +V        G ++AIK I+   +    DG            
Sbjct: 8   NIPKEYKLVDLVGEGSYGIVCSATHLPTGNKVAIKRIRFPDSPPSDDGQGVPRLEEDDEH 67

Query: 48  --------MSAIREVKYLQEIR-HANVIELVDLFMAQENLN-----LVLEFLPADLEMLI 93
                   +  IRE+K L     H N+I + +     +++N     LV E +  DL  ++
Sbjct: 68  DNIAKVALIRTIREIKILSHFNNHENIITIFEKIKPMQSINFKEIYLVQELMETDLSRIL 127

Query: 94  KDSSLLFTQADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTL 153
             S+ L T   I+ +L   LR +   H + ++HRDLKP+N+LL  +  LKI DFGLART 
Sbjct: 128 ASSNTL-TVDHIQYFLYQILRALKAIHSAKVIHRDLKPSNILLNSNCDLKICDFGLARTY 186

Query: 154 AAPHE----------FMTSNVVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELMLRIPY 203
               +          F+T  V TRWYRAPE++   + Y+ A+D+WS G + AE++ R P 
Sbjct: 187 DPDDDASTMNGNNVGFLTEYVATRWYRAPEIMLNFQDYSTAIDIWSCGCVLAEMLFRKPI 246

Query: 204 LPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKIQVYPPPSRSELRSRFIAATENAL 263
            PG+D   Q+ +    LGTP+ +D   ++   A   I   P   + +         E  L
Sbjct: 247 FPGKDYHHQLLLILDTLGTPSPEDIEAINYGRAKEYILSLPHFPKKDWSQLLGTDNEMLL 306

Query: 264 DLMCGMLTMDPHKRWDTTRCL 284
           D++  ++  +P +R    + L
Sbjct: 307 DILDKLMIFNPKRRITAEQAL 327

>AGL249C [4063] [Homologous to ScYPL042C (SSN3) - SH]
           (234347..236092) [1746 bp, 581 aa]
          Length = 581

 Score =  141 bits (355), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 83/235 (35%), Positives = 128/235 (54%), Gaps = 24/235 (10%)

Query: 33  AIKEIKTSQ------FKDGLDMSAIREVKYLQEIRHANVIELVDLFMAQENLNLVLEFLP 86
           AIK+ KT +         G+  SA RE+   +E+ + ++ +LV++F+ ++++ +V EF  
Sbjct: 193 AIKKFKTEREGVEQLHYTGISQSACREMSLCRELDNKHLTKLVEIFLERKSIYMVSEFAE 252

Query: 87  ADLEMLIKDSS----LLFTQADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAPDGQL 142
            DL  +I   S     L     +KS +   L GV + H+++ILHRDLKP N+++  DG +
Sbjct: 253 HDLLQIIHFHSHPEKRLIAPRMLKSIMWQILDGVSYLHQNWILHRDLKPANIMVTVDGCV 312

Query: 143 KIADFGLARTLAAPHEFMTSN---VVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELML 199
           KI D GLAR      + + +    VVT WYRAPELL GARHY+ A+DLW+VG IF+EL+ 
Sbjct: 313 KIGDLGLARKFYNLVQTLYTGDKVVVTIWYRAPELLLGARHYSPAIDLWAVGCIFSELIG 372

Query: 200 RIPYLPGRD-----------DVDQIDVTFRALGTPTDKDWPEVSSFSAYNKIQVY 243
             P   G +             +Q+      LGTPT   WP +  +  Y ++  +
Sbjct: 373 LRPIFKGEEAKMDSKKSVPFQGNQLQRILEVLGTPTHHTWPNIHKYPEYEQLSKF 427

>YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..314748)
           Member of the GSK-3 subfamily of protein kinases [1506
           bp, 501 aa]
          Length = 501

 Score =  135 bits (339), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 93/299 (31%), Positives = 154/299 (51%), Gaps = 22/299 (7%)

Query: 4   VNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEI-KTSQFKDGLDMSAIREVKYLQEIRH 62
           ++Y   + VG G++ VV         +++AIK++ +  ++K+       RE++ ++ + H
Sbjct: 162 ISYPTTEVVGHGSFGVVVTTVIIETNQKVAIKKVLQDRRYKN-------RELETMKMLCH 214

Query: 63  ANVIELVDLFMAQEN-----LNLVLEFLPADLEMLIK---DSSLLFTQADIKSWLLMTLR 114
            N + L   F  ++      LNLVL+++P  L   ++   +  +   + +IK +     +
Sbjct: 215 PNTVGLQYYFYEKDEEDEVYLNLVLDYMPQSLYQRLRHFVNLKMQMPRVEIKFYAYQLFK 274

Query: 115 GVHHCHR-SFILHRDLKPNNLLLAPDG-QLKIADFGLARTLAAPHEFMTSNVVTRWYRAP 172
            +++ H    I HRD+KP NLL+ P     KI DFG A+ L  P +   S + +R+YRAP
Sbjct: 275 ALNYLHNVPRICHRDIKPQNLLVDPTTFSFKICDFGSAKCLK-PDQPNVSYICSRYYRAP 333

Query: 173 ELLFGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVS 232
           EL+FGA +Y+  VD+WS   + AEL+L  P   G   +DQ+    + +G PT KD  E+S
Sbjct: 334 ELMFGATNYSNQVDVWSSACVIAELLLGKPLFSGESGIDQLVEIIKIMGIPT-KD--EIS 390

Query: 233 SFSAYNKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYFVE 291
             +   +  V+P      L   F A   + LDL+   L   P +R    +CLLS YF E
Sbjct: 391 GMNPNYEDHVFPNIKPITLAEIFKAEDPDTLDLLTKTLKYHPCERLVPLQCLLSSYFDE 449

>Scas_678.13
          Length = 462

 Score =  128 bits (321), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 87/292 (29%), Positives = 141/292 (48%), Gaps = 14/292 (4%)

Query: 11  KVGEGTYAVVYLGH--RQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIR-HANVIE 67
           ++  G+Y +V        ++   IAIK+I            A+RE+K LQ    H N+I 
Sbjct: 28  EISRGSYGIVLSASYSHSSENIVIAIKKISNIFGSTQSSKRALRELKLLQAFNGHKNIIS 87

Query: 68  LVDL---FMAQENLNLVL---EFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHR 121
           L D+   F     LN +    E +  D+E +IK    L T+   + ++   L G+ + H 
Sbjct: 88  LYDMDIVFYPTGILNGIYIYEELMECDMEQIIKSRQPL-TEYHYQFFIYQILCGLRYIHS 146

Query: 122 SFILHRDLKPNNLLLAPDGQLKIADFGLART----LAAPHEFMTSNVVTRWYRAPELLFG 177
           + I+ R+++P+NLL+  D +LKI  F LA+     +A  ++F    + TRWY APELL  
Sbjct: 147 ADIIMRNVRPSNLLINSDCKLKICGFSLAQKASNGVANNNQFSPEYLTTRWYHAPELLLN 206

Query: 178 ARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAY 237
              YT ++D+WS G +  EL+ + P     D V+Q++  F+ LGT + +    + S +  
Sbjct: 207 HHIYTTSIDVWSTGCVLGELITKEPIFHENDFVNQLNKIFQILGTHSKEALDNIGSKTIK 266

Query: 238 NKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYF 289
           N +   P   +  + + F  AT    DL+  ML  D  +R      L   YF
Sbjct: 267 NHVSQLPYIPKPPMENIFPGATTECQDLLNKMLKFDSEQRITVDMALRHPYF 318

>Scas_22.1
          Length = 248

 Score =  114 bits (286), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 74/223 (33%), Positives = 116/223 (52%), Gaps = 26/223 (11%)

Query: 78  LNLVLEFLPADLEMLIKD-----SSLLFTQADIKSW-LLMTLRGVHHCHRSFILHRDLKP 131
           LNLVLE++P+ L   ++      S++   +  +  + L  +L  +H C R  + HRD+KP
Sbjct: 26  LNLVLEYMPSSLYQRLRHFVTHRSNMPAIEVKLYMYQLFKSLNYLHTCAR--VCHRDIKP 83

Query: 132 NNLLLAPDG-QLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAAVDLWSV 190
            NLL+ P    LK+ DFG A+ L  P E   S + +R+YRAPEL+FGA +YT  +D+WS 
Sbjct: 84  QNLLVDPTTFSLKLCDFGSAKQLK-PTEPNVSYICSRYYRAPELIFGATNYTTQIDVWSS 142

Query: 191 GVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVS-SFSAYNKIQVYPPPSRS 249
           G + AEL+L  P  PG   +DQ+    + LGTP  ++   ++ ++  +   Q+ P P   
Sbjct: 143 GCVMAELILGQPMFPGESGIDQLVEIIKILGTPNKREICAMNPNYMDHKFPQIVPIP--- 199

Query: 250 ELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYFVEL 292
            L   F    E  +             ++   +CL + YF EL
Sbjct: 200 -LNKVFKREQEETV-----------QSKFTALQCLCASYFDEL 230

>Kwal_26.7276
          Length = 646

 Score =  117 bits (293), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 81/281 (28%), Positives = 134/281 (47%), Gaps = 39/281 (13%)

Query: 47  DMSAIREVKYLQEI-RHANVIELVDLFMAQEN--LNLVLEFLPADLEMLIK-DSSLLFTQ 102
           D + +REVK++  +  H N++++ +LF+   N  L++V+E +  +L  L++     +F+ 
Sbjct: 123 DYTRVREVKFILSMPAHRNLVQIWELFIDDVNYQLHIVMECMEQNLYQLMRARRKRVFSL 182

Query: 103 ADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAPDGQ-----------------LKIA 145
             +KS L   + G+ H H     HRDLKP N+L++P                    +KIA
Sbjct: 183 PSLKSILTQLITGIRHIHSHNFFHRDLKPENILISPSNHYFSKDWILNGNYSDNYVVKIA 242

Query: 146 DFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELMLRIPYLP 205
           D+GLAR +     + T+ V TRWYR+PE+L     Y+  +D+W+ G +  E+    P  P
Sbjct: 243 DYGLARHVTNKSPY-TAYVSTRWYRSPEILLRKGSYSRPLDIWAFGCVVVEVATFRPLFP 301

Query: 206 GRDDVDQIDVTFRALGTPTDKDWPEVSSF----SAYNKIQVYPPPSRSELRSRFIAAT-- 259
           G D++DQI      LGTP       +S +     ++ K +V    SR  L+  ++  T  
Sbjct: 302 GSDEMDQIWKILEVLGTPHTMSESAISGYQPHGGSWEKAEVL--ASRLNLKFPYVEGTSI 359

Query: 260 ---------ENALDLMCGMLTMDPHKRWDTTRCLLSQYFVE 291
                    +   +++   LT DP KR          YF E
Sbjct: 360 ESIVANPHLQELCEVVKECLTWDPKKRATVDEICAMPYFAE 400

>YJL106W (IME2) [2809] chr10 (221307..223244) Serine/threonine
           protein kinase and positive regulator of early, middle,
           and late meiotic genes, may act as a meiosis-specific
           regulator of the anaphase promoting complex [1938 bp,
           645 aa]
          Length = 645

 Score =  115 bits (289), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 127/246 (51%), Gaps = 29/246 (11%)

Query: 23  GHRQTDGRQIAIKEIKT--SQFKDGLDMSAIREVKYLQEI-RHANVIELVDLFMAQEN-- 77
           GH+    +   +  IKT  ++     D + +RE+K++  I  + ++I++ ++F+  EN  
Sbjct: 82  GHQNYITKTQGVVAIKTMMTKLHTLQDYTRVREIKFILAIPANDHLIQIFEVFIDSENYQ 141

Query: 78  LNLVLEFLPADL-EMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLL 136
           L++V+E +  +L +M+      +F+   +KS L   L G+ H H     HRDLKP N+L+
Sbjct: 142 LHIVMECMEQNLYQMMKHRRRRVFSIPSLKSILSQILAGLKHIHEHNFFHRDLKPENILI 201

Query: 137 APDGQ-----------------LKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGAR 179
            P  Q                 +K+ADFGLAR +   + + T+ V TRWYR+PE+L  + 
Sbjct: 202 TPSTQYFEKEYMNQIGYQDNYVIKLADFGLARHVENKNPY-TAYVSTRWYRSPEILLRSG 260

Query: 180 HYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNK 239
           +Y+  +D+W+ G +  E+ +     PG +++DQI      LGTP  +     S F   N 
Sbjct: 261 YYSKPLDIWAFGCVAVEVTVFRALFPGANEIDQIWKILEVLGTPIKR-----SDFVNTNH 315

Query: 240 IQVYPP 245
           I   PP
Sbjct: 316 ITAPPP 321

>CAGL0M08910g complement(887703..889541) highly similar to sp|Q00372
           Saccharomyces cerevisiae YDR477w carbon catabolite
           derepressing ser/thr protein kinase, hypothetical start
          Length = 612

 Score =  114 bits (285), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 85/300 (28%), Positives = 152/300 (50%), Gaps = 39/300 (13%)

Query: 5   NYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEI-KTSQFKDGLDMSAIREVKYLQEIRHA 63
           NY   K +GEG++  V L +  T G+++A+K I K    K  +     RE+ YL+ +RH 
Sbjct: 38  NYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHP 97

Query: 64  NVIELVDLFMAQENLNLVLEFLPADL-EMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRS 122
           ++I+L D+  +++ + +V+E+   +L + +++ + +  ++ + + +    +  V +CHR 
Sbjct: 98  HIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRNKM--SEQEARRFFQQIISAVEYCHRH 155

Query: 123 FILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYT 182
            I+HRDLKP NLLL     +KIADFGL+  +   + F+ ++  +  Y APE++ G  +  
Sbjct: 156 KIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN-FLKTSCGSPNYAAPEVISGKLYAG 214

Query: 183 AAVDLWSVGVI-FAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKIQ 241
             VD+WS GVI +  L  R+P+     D + I V F+ +                     
Sbjct: 215 PEVDVWSCGVILYVMLCRRLPF-----DDESIPVLFKNISNG------------------ 251

Query: 242 VYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYF-VELPEATPPTE 300
           VY  P       +F++    A DL+  ML ++P  R      +  ++F V+L E   P +
Sbjct: 252 VYTLP-------KFLSP--GASDLIKRMLIVNPLNRISIHEIMQDEWFKVDLAEYLVPQD 302

>YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine
           protein kinase essential for derepression of
           glucose-repressed genes, acts in concert with Snf4p,
           involved in aging [1902 bp, 633 aa]
          Length = 633

 Score =  114 bits (285), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 69/221 (31%), Positives = 124/221 (56%), Gaps = 11/221 (4%)

Query: 5   NYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEI-KTSQFKDGLDMSAIREVKYLQEIRHA 63
           NY   K +GEG++  V L +  T G+++A+K I K    K  +     RE+ YL+ +RH 
Sbjct: 54  NYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHP 113

Query: 64  NVIELVDLFMAQENLNLVLEFLPADL-EMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRS 122
           ++I+L D+  +++ + +V+E+   +L + +++   +  ++ + + +    +  V +CHR 
Sbjct: 114 HIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRDKM--SEQEARRFFQQIISAVEYCHRH 171

Query: 123 FILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYT 182
            I+HRDLKP NLLL     +KIADFGL+  +   + F+ ++  +  Y APE++ G  +  
Sbjct: 172 KIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN-FLKTSCGSPNYAAPEVISGKLYAG 230

Query: 183 AAVDLWSVGVI-FAELMLRIPYLPGRDDVDQIDVTFRALGT 222
             VD+WS GVI +  L  R+P+     D + I V F+ +  
Sbjct: 231 PEVDVWSCGVILYVMLCRRLPF-----DDESIPVLFKNISN 266

>CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces
           cerevisiae YJL106w IME2 ser/thr protein kinase,
           hypothetical start
          Length = 751

 Score =  114 bits (285), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 63/198 (31%), Positives = 110/198 (55%), Gaps = 22/198 (11%)

Query: 47  DMSAIREVKY-LQEIRHANVIELVDLFMAQE--NLNLVLEFLPADL-EMLIKDSSLLFTQ 102
           D + +REVK+ L    + ++I++ ++F+  E   L++ +E++  +L +M+ +    +F+ 
Sbjct: 122 DYTRVREVKFILSMTANKHLIQVYEIFVDSEKYQLHIAMEYMEQNLYQMMRRRKKRVFSI 181

Query: 103 ADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAPDGQ-----------------LKIA 145
             +KS L   L G+ H H     HRDLKP N+L+ P  +                 +K+A
Sbjct: 182 PSLKSILAQVLAGLRHIHDQNFFHRDLKPENILITPSTRYFDSSWLEKGNYPDNYVVKLA 241

Query: 146 DFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELMLRIPYLP 205
           DFGLAR +   + + T+ V TRWYR+PE+L  + +Y+  +D+W+ G +  E+ +  P  P
Sbjct: 242 DFGLARHVENKNPY-TAYVSTRWYRSPEILLRSGYYSKPLDIWAFGCVAMEVTVFKPLFP 300

Query: 206 GRDDVDQIDVTFRALGTP 223
           G +++DQI      LGTP
Sbjct: 301 GSNEIDQIWKILEVLGTP 318

>Scas_660.28
          Length = 623

 Score =  114 bits (284), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 69/221 (31%), Positives = 124/221 (56%), Gaps = 11/221 (4%)

Query: 5   NYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEI-KTSQFKDGLDMSAIREVKYLQEIRHA 63
           NY   K +GEG++  V L +  T G+++A+K I K    K  +     RE+ YL+ +RH 
Sbjct: 45  NYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHP 104

Query: 64  NVIELVDLFMAQENLNLVLEFLPADL-EMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRS 122
           ++I+L D+  +++ + +V+E+   +L + +++   +  ++ + + +    +  V +CHR 
Sbjct: 105 HIIKLYDVIKSKDEIIMVMEYAGNELFDYIVQRDKM--SEDEARRFFQQIISAVEYCHRH 162

Query: 123 FILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYT 182
            I+HRDLKP NLLL     +KIADFGL+  +   + F+ ++  +  Y APE++ G  +  
Sbjct: 163 KIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN-FLKTSCGSPNYAAPEVISGKLYAG 221

Query: 183 AAVDLWSVGVI-FAELMLRIPYLPGRDDVDQIDVTFRALGT 222
             VD+WS GVI +  L  R+P+     D + I V F+ +  
Sbjct: 222 PEVDVWSCGVILYVMLCRRLPF-----DDESIPVLFKNINN 257

>AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH]
           complement(198401..200227) [1827 bp, 608 aa]
          Length = 608

 Score =  112 bits (281), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 83/299 (27%), Positives = 152/299 (50%), Gaps = 39/299 (13%)

Query: 6   YTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEI-KTSQFKDGLDMSAIREVKYLQEIRHAN 64
           Y   K +GEG++  V L H  + G+++A+K I K    K  +     RE+ YL+ +RH +
Sbjct: 39  YQVIKTLGEGSFGKVKLAHHVSTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPH 98

Query: 65  VIELVDLFMAQENLNLVLEFLPADL-EMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSF 123
           +I+L D+  +++ + +V+E+   +L + +++   +  ++ + + +    +  V +CHR  
Sbjct: 99  IIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRDKM--SENEARRFFQQIISAVEYCHRHK 156

Query: 124 ILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTA 183
           I+HRDLKP NLLL     +KIADFGL+  +   + F+ ++  +  Y APE++ G  +   
Sbjct: 157 IVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN-FLKTSCGSPNYAAPEVISGKLYAGP 215

Query: 184 AVDLWSVGVI-FAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKIQV 242
            VD+WS GVI +  L  R+P+     D + I V F+ +                     V
Sbjct: 216 EVDVWSSGVILYVMLCRRLPF-----DDESIPVLFKNISN------------------GV 252

Query: 243 YPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYF-VELPEATPPTE 300
           Y  P       +F+  ++ A +L+  ML ++P  R      +  ++F V+LP+   P +
Sbjct: 253 YSIP-------KFL--SQGAANLIKRMLIVNPLNRITIHEIMEDEWFKVDLPDYLVPVD 302

>Kwal_55.22001
          Length = 363

 Score =  110 bits (275), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 87/302 (28%), Positives = 146/302 (48%), Gaps = 29/302 (9%)

Query: 10  KKVGEGTYAVVYLGHRQTDGRQ----IAIKEIKT-SQFKDGLDMSAIREVKYLQEIRHAN 64
           KK+G G +  V       D  +     AIK++   +++K        RE++ L+   H N
Sbjct: 30  KKIGHGAFGTVVQAFLTPDNNKWYGPFAIKKVPAQTEYKS-------RELEILRIADHPN 82

Query: 65  VIELVDLFM---AQEN---LNLVLEFLPADLEMLIK---DSSLLFTQADIKSWLLMTLRG 115
           V++L   F     Q+N    +L +E LP  L++ I     + L       K +     RG
Sbjct: 83  VVKLEYFFTHTSPQDNKLYQHLAMECLPETLQLEIHRYASNKLELPLKHTKLYTYQIARG 142

Query: 116 VHHCHRSFILHRDLKPNNLLLAPD-GQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPEL 174
           + + H   I HRD+KP+N+L+ P+ G LKI DFG A+ L   ++   S + +R+YRAPEL
Sbjct: 143 MLYLHALGICHRDIKPSNVLVDPNTGVLKICDFGSAKKLEQ-NQPSISYICSRFYRAPEL 201

Query: 175 LFGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSF 234
           + G   YT  +D+W +G +  E+++      G++ + Q+    + LG P DK +   S+ 
Sbjct: 202 IVGCTQYTTQIDIWGLGCVMGEMLIGKAVFQGQEPLLQLREISKLLG-PPDKKFLFFSN- 259

Query: 235 SAYNKIQVYPPPSRSELRSRFIA----ATENALDLMCGMLTMDPHKRWDTTRCLLSQYFV 290
            +Y+      P     ++ RF      A    +DL+  +LT +P +R    R L   +F 
Sbjct: 260 PSYDGPLFSKPLFTGSVQERFEKHFGQAGPEGIDLLMKILTYEPERRLSPRRILAHPFFE 319

Query: 291 EL 292
           +L
Sbjct: 320 DL 321

>Scas_711.15
          Length = 727

 Score =  112 bits (280), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 83/298 (27%), Positives = 146/298 (48%), Gaps = 42/298 (14%)

Query: 30  RQIAIKEIKTSQFKDGLDMSAIREVKYLQEI-RHANVIELVDLFMAQEN--LNLVLEFLP 86
           R +AIK + T  +    D + +REVK++  +  + ++I++ ++F    N  L++V+E + 
Sbjct: 92  RLVAIKTMLTKLYT-LHDYTRVREVKFILALPTNKHLIQIFEIFADTSNYQLHIVMECME 150

Query: 87  ADL-EMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAPDGQ---- 141
            +L +M++     +F+   +KS L   L G+ H H     HRD+KP N+L++P+ +    
Sbjct: 151 QNLYQMMLHRKKRVFSIPSLKSILAQILAGIKHIHDHNFFHRDIKPENILVSPNKRYFDK 210

Query: 142 -------------LKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAAVDLW 188
                        +K+ADFGLAR +   + + T+ V TRWYR+PE+L    +Y+  +D+W
Sbjct: 211 ERLELGFYPDNYVVKLADFGLARHVENKNTY-TAYVSTRWYRSPEILLRNGYYSTPLDIW 269

Query: 189 SVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKD---------------WPEVSS 233
           + G +  E  +  P  PG +++DQI      LGTP +                 W  V+ 
Sbjct: 270 AFGCVAVEATIFKPLFPGSNELDQIWRILEVLGTPYNNKNDSTVPNNFKPYGGTWNHVAE 329

Query: 234 FSAYNKIQVYPPPSRSELRSRFIAATE--NALDLMCGMLTMDPHKRWDTTRCLLSQYF 289
            ++  K+ +  P        RFI   E  + LD++   L  +P +R       L +YF
Sbjct: 330 LAS--KLNLEFPFVEGISLDRFIPLPELYDLLDVIKKCLRWNPLERASANDLCLMEYF 385

>CAGL0E01683g complement(166584..167711) highly similar to sp|P21965
           Saccharomyces cerevisiae YNL307c MCK1 or sp|Q12222
           Saccharomyces cerevisiae YOL128c, start by similarity
          Length = 375

 Score =  109 bits (273), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 84/303 (27%), Positives = 148/303 (48%), Gaps = 27/303 (8%)

Query: 8   KEKKVGEGTYAVVYLGHRQTDGRQ----IAIKEIKT-SQFKDGLDMSAIREVKYLQEIRH 62
           + +K+G G +  V   +   D +      AIK++   +++K        RE++ L+   H
Sbjct: 37  EHRKIGRGAFGTVVQAYLTQDEQTWYGPFAIKKVPAQTEYKS-------RELQILRLTDH 89

Query: 63  ANVIELVDLFM---AQEN---LNLVLEFLPADLEMLIK---DSSLLFTQADIKSWLLMTL 113
            N+++L   F     ++N    +L +E LP  L++ I     ++L      +K +     
Sbjct: 90  PNIVKLEYFFTHTSPKDNKVYQHLAMECLPETLQIEINRYTSNNLQLAIKHVKLYSYQIA 149

Query: 114 RGVHHCHRSFILHRDLKPNNLLLAPD-GQLKIADFGLARTLAAPHEFMTSNVVTRWYRAP 172
           RG+ + H   I HRD+KP+N+L+ P  G LKI DFG A+ L  P++   S + +R+YRAP
Sbjct: 150 RGMLYLHALGICHRDIKPSNILVDPKTGVLKICDFGSAKRLE-PNQPSISYICSRFYRAP 208

Query: 173 ELLFGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVS 232
           EL+ G+  YT  VD+W +G +  E+++      G+D + Q+    + LG P DK +   S
Sbjct: 209 ELILGSTQYTTQVDIWGLGCVIGEMLIGRAIFQGQDPLLQLREIAKLLG-PPDKKFIFFS 267

Query: 233 SFSAYNKIQVYP---PPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYF 289
           +      +   P     S    +  F  A  + +DL+  +L  +P  R+   R +   +F
Sbjct: 268 NPRYTGPLYSTPLFNGTSLERFQKYFGHAGPDGIDLLMKVLKYEPELRFSPRRIMAHPFF 327

Query: 290 VEL 292
            +L
Sbjct: 328 DDL 330

>KLLA0E07414g complement(672690..673787) highly similar to sp|P21965
           Saccharomyces cerevisiae YNL307c MCK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 365

 Score =  108 bits (271), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 85/302 (28%), Positives = 147/302 (48%), Gaps = 29/302 (9%)

Query: 10  KKVGEGTYAVVYLGHRQTDGRQ----IAIKEIKT-SQFKDGLDMSAIREVKYLQEIRHAN 64
           K++G+G +  V   +   D ++     AIK++   +++K        RE++ L+   H N
Sbjct: 31  KRIGQGAFGTVVQAYLTPDNQKWLGPFAIKKVPAQTEYKS-------RELEILRIADHPN 83

Query: 65  VIELVDLFMA------QENLNLVLEFLPADLEMLI---KDSSLLFTQADIKSWLLMTLRG 115
           V++L   +        +   +L +E LP  L+  I   K ++L      +K +     RG
Sbjct: 84  VVKLEYFYTHISPTDHKLYQHLAMECLPEMLQNEILRYKKNNLELPLKHVKLYAYQIARG 143

Query: 116 VHHCHRSFILHRDLKPNNLLLAPD-GQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPEL 174
           + + H   I HRD+KP+N+L+ P  G LKI DFG A+ L + ++   S + +R+YRAPEL
Sbjct: 144 MLYLHALGICHRDIKPSNVLVDPQTGILKICDFGSAKKLES-NQPSISYICSRYYRAPEL 202

Query: 175 LFGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSF 234
           + G   YT  +D+W +G +  E++L      G   + Q+    + LG P DK +   S+ 
Sbjct: 203 IVGCTQYTTKIDIWGLGCVLGEMLLGKAVFQGHQPLLQLHEITKLLG-PPDKRFIFFSN- 260

Query: 235 SAYNKIQVYPPPSRSELRSRFIA----ATENALDLMCGMLTMDPHKRWDTTRCLLSQYFV 290
            +YN      P      ++RF      A  + +DL+  +L  +P +R    R L   +F 
Sbjct: 261 PSYNGPLFSKPLFEGAPKARFEKYFGYAGPDGVDLLMSVLVYEPERRASPRRILAHPFFD 320

Query: 291 EL 292
           +L
Sbjct: 321 DL 322

>AFR076W [3268] [Homologous to ScYJL106W (IME2) - SH]
           complement(564252..566714) [2463 bp, 820 aa]
          Length = 820

 Score =  110 bits (274), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 64/209 (30%), Positives = 112/209 (53%), Gaps = 22/209 (10%)

Query: 47  DMSAIREVKYLQEI-RHANVIELVDLFMAQE--NLNLVLEFLPADLEMLIK-DSSLLFTQ 102
           D + +RE+K++ +I  HA+++++ +LF+      L++V+E +  ++  L+K     +F+ 
Sbjct: 107 DYTRVREIKFILQIPAHAHLVQIYELFIDDSLYQLHIVMECMEQNIYQLMKCRKRRVFSL 166

Query: 103 ADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAPDGQ-----------------LKIA 145
             ++S L   L G+ H H     HRD+KP N+L++P  +                 +KIA
Sbjct: 167 PTLRSILSQILSGIRHIHAHNFYHRDIKPENILISPANRYYSKEWISAGHYPDNYVVKIA 226

Query: 146 DFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELMLRIPYLP 205
           D+GLAR +     + T+ V TRWYR+PE+L     Y+  +D+W+ G +  E+    P  P
Sbjct: 227 DYGLARHVTNKSPY-TAYVSTRWYRSPEILLRQGSYSRPLDIWAFGCVAVEVATFKPLFP 285

Query: 206 GRDDVDQIDVTFRALGTPTDKDWPEVSSF 234
           G D++DQI      LGTP      ++S +
Sbjct: 286 GADEMDQIWKILELLGTPHPCHESKISGY 314

>Kwal_47.18233
          Length = 598

 Score =  109 bits (273), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 67/216 (31%), Positives = 122/216 (56%), Gaps = 11/216 (5%)

Query: 10  KKVGEGTYAVVYLGHRQTDGRQIAIKEI-KTSQFKDGLDMSAIREVKYLQEIRHANVIEL 68
           K +GEG++  V L +  T G+++A+K I K    K  +     RE+ YL+ +RH ++I+L
Sbjct: 35  KTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKL 94

Query: 69  VDLFMAQENLNLVLEFLPADL-EMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFILHR 127
            D+  +++ + +V+E+   +L + +++   +  ++ + + +    +  V +CHR  I+HR
Sbjct: 95  YDVVKSKDEIVMVIEYAGNELFDYIVQRDKM--SENEARRFFQQIISAVEYCHRHKIVHR 152

Query: 128 DLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAAVDL 187
           DLKP NLLL     +KIADFGL+  +   + F+ ++  +  Y APE++ G  +    VD+
Sbjct: 153 DLKPENLLLDEHLNVKIADFGLSNIMTDGN-FLRTSCGSPNYAAPEVISGKLYAGPEVDV 211

Query: 188 WSVGVI-FAELMLRIPYLPGRDDVDQIDVTFRALGT 222
           WS GVI +  L  R+P+     D + I V F+ +  
Sbjct: 212 WSSGVILYVMLCRRLPF-----DDESIPVLFKNISN 242

>KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235.1
           Kluyveromyces lactis putative kinase, start by
           similarity
          Length = 602

 Score =  109 bits (272), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 84/294 (28%), Positives = 146/294 (49%), Gaps = 37/294 (12%)

Query: 10  KKVGEGTYAVVYLGHRQTDGRQIAIKEI-KTSQFKDGLDMSAIREVKYLQEIRHANVIEL 68
           K +GEG++  V L +  + G+++A+K I K    K  +     RE+ YL+ +RH ++I+L
Sbjct: 39  KTLGEGSFGKVKLAYHISTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKL 98

Query: 69  VDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFILHRD 128
            D+  +++ + +V+E+   +L   I     +  Q + + +    +  V +CHR  I+HRD
Sbjct: 99  YDVIKSKDEIIMVIEYAGNELFDYIVQRDKMPEQ-EARRFFQQIISAVDYCHRHKIVHRD 157

Query: 129 LKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAAVDLW 188
           LKP NLLL     +KIADFGL+  +   + F+ ++  +  Y APE++ G  +    VD+W
Sbjct: 158 LKPENLLLDEHLNVKIADFGLSNIMTDGN-FLKTSCGSPNYAAPEVISGKLYAGPEVDVW 216

Query: 189 SVGVI-FAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKIQVYPPPS 247
           S GVI +  L  R+P+     D + I V F+ +                     VY  P+
Sbjct: 217 SSGVILYVMLCRRLPF-----DDESIPVLFKNISN------------------GVYTIPN 253

Query: 248 RSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYF-VELPEATPPTE 300
                  F+  ++ A  L+  ML ++P  R      +  ++F V+LP+   P E
Sbjct: 254 -------FL--SQGAASLIKKMLIVNPVNRITVHEIMQDEWFKVDLPDYLVPAE 298

>KLLA0F02838g 264329..266596 some similarities with sp|P32581
           Saccharomyces cerevisiae YJL106w IME2 ser/thr protein
           kinase, hypothetical start
          Length = 755

 Score =  108 bits (271), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 61/198 (30%), Positives = 107/198 (54%), Gaps = 22/198 (11%)

Query: 47  DMSAIREVKYLQEI-RHANVIELVDLFMAQE--NLNLVLEFLPADLEMLIKDSSL-LFTQ 102
           D + +RE+K++ +I  H N++ + ++F+     +L++V+E +  ++  L+K     +F+ 
Sbjct: 107 DYTRVREIKFILQIPAHKNLVTIYEMFIDDSLYHLHIVMECMEQNIYQLMKHRKRRVFSL 166

Query: 103 ADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAPDGQ-----------------LKIA 145
             ++S L   L G+ H H     HRD+KP N+L++P  +                 +K+A
Sbjct: 167 PTLRSILFQILAGIKHIHDHDFFHRDIKPENILISPSHRYFSKKWLEDDNYSDNYVVKLA 226

Query: 146 DFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELMLRIPYLP 205
           D+GLAR +     + T+ V TRWYR+PE+L    +Y+  +D+W+ G +  EL    P  P
Sbjct: 227 DYGLARHVNNRSPY-TTYVSTRWYRSPEILLRKGYYSKPLDIWAYGCVVVELATFSPLFP 285

Query: 206 GRDDVDQIDVTFRALGTP 223
           G D+ DQI      LG+P
Sbjct: 286 GSDETDQIWRILDLLGSP 303

>ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -
           SH] (398519..399607) [1089 bp, 362 aa]
          Length = 362

 Score =  106 bits (264), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 86/303 (28%), Positives = 139/303 (45%), Gaps = 31/303 (10%)

Query: 10  KKVGEGTYAVVYLGHRQTDGRQ----IAIKEIKT-SQFKDGLDMSAIREVKYLQEIRHAN 64
           K++G G +  V   +   D  +     AIK++   +++K        RE+  L+   H N
Sbjct: 29  KRIGHGAFGTVVQAYLTPDNEKWYGPFAIKKVPAQTEYKS-------RELAILRIADHPN 81

Query: 65  VIELVDLFM------AQENLNLVLEFLPADLEMLI---KDSSLLFTQADIKSWLLMTLRG 115
           V++L   F        +   +L +E LP  L+  I     + L      IK +     RG
Sbjct: 82  VVKLEYFFTHVSPSDGKVYQHLAMECLPETLQHEILRYTQNKLELPLKHIKMYTYQIARG 141

Query: 116 VHHCHRSFILHRDLKPNNLLLAP-DGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPEL 174
           + + H   I HRD+KP+N+L+ P  G LKI DFG A+ L   ++   S + +R+YRAPEL
Sbjct: 142 MLYLHALGICHRDIKPSNILVDPKSGVLKICDFGSAKKLEQ-NQPSISYICSRFYRAPEL 200

Query: 175 LFGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSF 234
           + G   YT  +D+W +G +  E+++      G++ + Q+    + LG P DK +   S+ 
Sbjct: 201 IVGCTQYTTQIDIWGLGCVIGEMLIGKAVFQGQEPLLQLHEIAKLLG-PPDKKFIFFSNP 259

Query: 235 SAYNKIQVYP-----PPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYF 289
           S    +   P     P  R E    F  A    +DL+  +L   P +R    R L   + 
Sbjct: 260 SYGGPLFSKPLFNGTPQQRFE--KYFGHAGPEGIDLLMKVLCYSPERRLSPRRVLCHAFL 317

Query: 290 VEL 292
            EL
Sbjct: 318 DEL 320

>Scas_635.1
          Length = 378

 Score =  105 bits (261), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 87/303 (28%), Positives = 148/303 (48%), Gaps = 31/303 (10%)

Query: 10  KKVGEGTYAVV---YLGHRQTD-GRQIAIKEIKT-SQFKDGLDMSAIREVKYLQEIRHAN 64
           +K+G G +  V   Y+   + D     AIK++   +++K        RE++ L+   H N
Sbjct: 43  RKIGRGAFGTVVQAYITPNKEDWYGPFAIKKVPAQTEYKS-------RELEILRITNHPN 95

Query: 65  VIELVDLFM---AQEN---LNLVLEFLPADLEMLIK---DSSLLFTQADIKSWLLMTLRG 115
           +++L   F     Q++    +L +E LP  L++ I     + +      +K +     RG
Sbjct: 96  IVKLEYFFTHVSPQDHKVYQHLAMECLPETLQIEISRYAHNKMELALKHVKLYSYQIARG 155

Query: 116 VHHCHRSFILHRDLKPNNLLLAPD-GQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPEL 174
           + + H   I HRD+KP+N+L+ P+ G LKI DFG A+ L   ++   S + +R+YRAPEL
Sbjct: 156 MLYLHALGICHRDIKPSNILVDPNTGVLKICDFGSAKRLEI-NQPSISYICSRFYRAPEL 214

Query: 175 LFGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSF 234
           + G   YT  VD+W +G +  E++L      G++ + Q+    + LG P DK +   S+ 
Sbjct: 215 ILGCTQYTTQVDIWGLGCVIGEMLLGKAIFQGQEPLLQLREIAKLLG-PPDKKFIFFSN- 272

Query: 235 SAYNKIQVYPPP-----SRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYF 289
             Y+   +Y  P     S+S     F  A    +DL+  +L  +P  R    R L   +F
Sbjct: 273 PGYDG-PLYSKPLFSGTSQSRFEKYFGHAGVEGIDLLMKVLVYEPEIRLSPRRILAHPFF 331

Query: 290 VEL 292
            +L
Sbjct: 332 DDL 334

>YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine
           protein kinase involved in induction of autophagy after
           nutrient limitation [2694 bp, 897 aa]
          Length = 897

 Score = 99.0 bits (245), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 89/324 (27%), Positives = 147/324 (45%), Gaps = 78/324 (24%)

Query: 2   TAVNYTKEKKVGEGTYAVVYLGHRQTDGRQ-IAIKEIKTSQFKDGLDMSAIR-EVKYLQE 59
           +A NYT EK++G+G++A VY GH  +D  Q +AIKE+  ++ K+   +  +  E+  L++
Sbjct: 20  SAGNYTAEKEIGKGSFATVYRGHLTSDKSQHVAIKEVSRAKLKNKKLLENLEIEIAILKK 79

Query: 60  IRHANVIELVDLFMAQENLNLVLEFLP-ADLEMLIK-------DSSLLFT---------- 101
           I+H +++ L+D      +  L++E+    DL  L+K       +  LL T          
Sbjct: 80  IKHPHIVGLIDCERTSTDFYLIMEYCALGDLTFLLKRRKELMENHPLLRTVFEKYPPPSE 139

Query: 102 ------QADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAP------DGQ-------- 141
                 +A + S+L      +       ++HRD+KP NLLL+       D +        
Sbjct: 140 NHNGLHRAFVLSYLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLIGYHDSKSFHELGFV 199

Query: 142 -------LKIADFGLARTLAAPHEFMTSNVV-TRWYRAPELLFGARHYTAAVDLWSVGVI 193
                  LKIADFG AR L  P+  +   +  +  Y APE+L   + Y A  DLWSVG +
Sbjct: 200 GIYNLPILKIADFGFARFL--PNTSLAETLCGSPLYMAPEIL-NYQKYNAKADLWSVGTV 256

Query: 194 FAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKIQVYPPPSRSELRS 253
             E+    P     + ++     F+ +    D     V +F +Y  I+        EL+ 
Sbjct: 257 VFEMCCGTPPFRASNHLE----LFKKIKRAND-----VITFPSYCNIE-------PELK- 299

Query: 254 RFIAATENALDLMCGMLTMDPHKR 277
                     +L+C +LT DP +R
Sbjct: 300 ----------ELICSLLTFDPAQR 313

>Scas_493.2
          Length = 1117

 Score = 99.0 bits (245), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 85/293 (29%), Positives = 132/293 (45%), Gaps = 49/293 (16%)

Query: 10  KKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFK---------------DGLDMSAIREV 54
           + +G G+   V L   +T  +Q AIK I  S F                D L     RE+
Sbjct: 26  ETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIEREI 85

Query: 55  KYLQEIRHANVIELVDLFMAQENLNLVLEFLPAD--LEMLIKDSSLLFTQADIKSWLLMT 112
             ++ +RHANV+ L D++    NL ++LE+        +L++   L   + +   +    
Sbjct: 86  IIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPL--PEKEAVRFFRQI 143

Query: 113 LRGVHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAP 172
           + G+ +CH   I+HRDLKP NLLL     +KIADFG+A  L    + + ++  +  Y AP
Sbjct: 144 IIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMA-ALETEDKLLETSCGSPHYAAP 202

Query: 173 ELLFGARHYTAAVDLWSVGVI-FAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEV 231
           E++ G  ++    D+WS GVI FA L  R+P+       D+ D   R L         E+
Sbjct: 203 EIVSGIPYHGFESDVWSCGVILFALLTGRLPF-------DEEDGNIRNLLLKVQSGQFEM 255

Query: 232 SSFSAYNKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCL 284
                         P   E+       + +A DL+  +LT+DP KR  T   L
Sbjct: 256 --------------PDDDEM-------SRDAQDLISRILTVDPTKRIKTREIL 287

>CAGL0K05709g complement(555903..559214) similar to sp|Q12263
           Saccharomyces cerevisiae YDR507c GIN4, start by
           similarity
          Length = 1103

 Score = 98.6 bits (244), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 81/281 (28%), Positives = 135/281 (48%), Gaps = 46/281 (16%)

Query: 12  VGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFK------------DGLDMSAIREVKYLQE 59
           +G G+   V L   +T  +Q A+K I  + F+            + L  +  +E+  ++ 
Sbjct: 26  LGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIIIMKL 85

Query: 60  IRHANVIELVDLFMAQENLNLVLEFLPAD--LEMLIKDSSLLFTQADIKSWLLMTLRGVH 117
           + H NV+ L D++    +L LVLE+        ML++   L   +A ++++  + + G+ 
Sbjct: 86  LNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEA-VRAFRQIII-GIS 143

Query: 118 HCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFG 177
           +CH   ++HRDLKP NLLL     +KIADFG+A  L +  + + ++  +  Y APE++ G
Sbjct: 144 YCHSLGVVHRDLKPENLLLDNKLNIKIADFGMA-ALESEDKLLETSCGSPHYAAPEIISG 202

Query: 178 ARHYTAAVDLWSVGVI-FAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSA 236
             +   + D+WS GVI FA L  R+P+       D+ D   R L     K   E+     
Sbjct: 203 LPYEGFSSDVWSCGVILFALLTGRLPF-------DEEDGNIRNLLLKVQKGEFEM----- 250

Query: 237 YNKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKR 277
                    P   E+       T+ A DL+  +LT+DP KR
Sbjct: 251 ---------PDDDEI-------TKEAQDLLARLLTVDPSKR 275

>CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces
           cerevisiae YDL101c DUN1 protein kinase, start by
           similarity
          Length = 506

 Score = 97.8 bits (242), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 89/297 (29%), Positives = 132/297 (44%), Gaps = 57/297 (19%)

Query: 10  KKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIRE-VKYLQEIRHANVIEL 68
           K +G G YA+V     +T G  +A+K     Q  D       RE    L +I H N++ L
Sbjct: 197 KDLGSGHYAIVKEAKNKTTGETVAVKIFHPQQNDDQKKNKQFREETTILMKIHHPNIVNL 256

Query: 69  VDLFM-----AQENLNLVLEFLPAD--LEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHR 121
           +D F+      Q    LVLE +      + ++K +SL   Q + K+     L G+ + H 
Sbjct: 257 LDSFVEPISKTQIQKYLVLEKIDDGELFDRIVKKTSL--PQEESKAIFKQILTGLKYLHS 314

Query: 122 SFILHRDLKPNNLLL------APDG-------------QLKIADFGLARTLAAPHEFMTS 162
             I+HRD+KP N+LL      +PD              Q+KIADFGLA+      +F  +
Sbjct: 315 QNIIHRDIKPENILLNIRRRQSPDERQLGPWDEDEIDIQVKIADFGLAK-FTGEMQFTNT 373

Query: 163 NVVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGT 222
              T  Y APE+L   + YT+ VDLWS GVI    +   P  P  D           LG 
Sbjct: 374 LCGTPSYVAPEVLV-KKGYTSKVDLWSAGVILYVCLCGFP--PFSD----------QLGP 420

Query: 223 PTDKDWPEVSSFSAYNKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWD 279
           P+ K+    + ++ Y+       P   E+        + AL L+  +L +DP  R+D
Sbjct: 421 PSLKEQIMSAKYAFYS-------PYWDEI-------DDAALHLISNLLVLDPENRYD 463

>CAGL0G02035g 179911..180930 highly similar to sp|P19454
           Saccharomyces cerevisiae YOR061w CKA2 casein kinase II
           alpha chain, start by similarity
          Length = 339

 Score = 95.9 bits (237), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 69/224 (30%), Positives = 108/224 (48%), Gaps = 16/224 (7%)

Query: 5   NYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHA- 63
           NY    K+G G Y+ V+ G   T+ +   IK +K  + K        RE+K L  +    
Sbjct: 49  NYEIVTKIGRGKYSEVFSGKCITNDQPCVIKVLKPVKMK-----KIYRELKILTNLTGGP 103

Query: 64  NVIELVDLFMAQENLNLVL---EFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCH 120
           NVI L+D+   Q +    L   E   AD   L       FT  D++ +    L  + +CH
Sbjct: 104 NVIGLLDIVQDQASKIPALIFEEVKNADFRTLYPS----FTLQDLQYYFTQLLIALDYCH 159

Query: 121 RSFILHRDLKPNNLLLAP-DGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGAR 179
              I+HRD+KP N+++ P   +L++ D+GLA     P       V +R+++ PELL    
Sbjct: 160 SMGIMHRDVKPQNVMIDPAQKKLRLIDWGLAE-FYHPGVDYNVRVASRYHKGPELLVNLN 218

Query: 180 HYTAAVDLWSVGVIFAELMLRI-PYLPGRDDVDQIDVTFRALGT 222
            Y  ++DLWSVG + A ++ +  P+  G  + DQ+      LGT
Sbjct: 219 QYDYSLDLWSVGCMLAAIIFKKEPFFKGSSNADQLVKIADVLGT 262

>KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces
           cerevisiae YDR507c GIN4 ser/thr protein kinase, start by
           similarity
          Length = 1112

 Score = 97.1 bits (240), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 82/290 (28%), Positives = 135/290 (46%), Gaps = 50/290 (17%)

Query: 12  VGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFK------------DGLDMSAIREVKYLQE 59
           +G G+   V + + +T G+Q A+K I  S F             D L     RE+  ++ 
Sbjct: 23  LGVGSTGKVVMAYNETKGQQAAVKIISKSIFNAQGSTMIGGNDPDVLPYGIEREIIIMKL 82

Query: 60  IRHANVIELVDLFMAQENLNLVLEFLPAD--LEMLIKDSSLLFTQADIKSWLLMTLRGVH 117
           + H NV+ L D++   ++L +VLE++       +L++   L   +A    +    + G+ 
Sbjct: 83  LNHPNVLRLYDVWETSKDLYMVLEYVEKGELFNLLVERGPLPENEA--VRFFRQIIIGIS 140

Query: 118 HCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFG 177
           +CH   I+HRDLKP NLLL     +K+ADFG+A  L +  + + ++  +  Y APE++ G
Sbjct: 141 YCHALGIVHRDLKPENLLLDHKFNVKLADFGMA-ALESKDKLLETSCGSPHYAAPEIVSG 199

Query: 178 ARHYTAAVDLWSVGVI-FAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSA 236
             ++    D+WS GVI +A L  R+P+       D+ D   R L                
Sbjct: 200 LPYHGFESDVWSCGVILYALLTGRLPF-------DEEDGNIRNL---------------- 236

Query: 237 YNKIQV--YPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCL 284
             K+Q   +  P   E+ S        A DL+  +LT+DP +R  T   L
Sbjct: 237 LLKVQSGKFEMPGDDEISSE-------AQDLIARILTVDPEQRIKTREIL 279

>ABR014W [605] [Homologous to ScYHL007C (STE20) - SH]
           complement(417710..420625) [2916 bp, 971 aa]
          Length = 971

 Score = 96.7 bits (239), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 65/226 (28%), Positives = 116/226 (51%), Gaps = 23/226 (10%)

Query: 11  KVGEGTYAVVYLGHRQTDGRQIAIKEIK-TSQFKDGLDMSAIREVKYLQEIRHANVIELV 69
           K+G+G    VY  +       +AIK++    Q K  L    I E+  ++  RH N++  +
Sbjct: 688 KIGQGASGGVYTAYEIGTNASVAIKQMNLEKQPKKEL---IINEILVMKGSRHNNIVNFI 744

Query: 70  DLFMAQENLNLVLEFLPA-DLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFILHRD 128
           D ++ + +L +++E++    L  ++  +  + T+  I +    TLRG+H  H   ++HRD
Sbjct: 745 DSYLLKGDLWVIMEYMEGGSLTDVV--THCILTEGQIAAVSRETLRGLHFLHSKGVIHRD 802

Query: 129 LKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAAVDLW 188
           +K +N+LL+ DG +K+ DFG    +   +   T+ V T ++ APE++   + Y   VD+W
Sbjct: 803 IKSDNILLSMDGNIKLTDFGFCAQINETNLKRTTMVGTPYWMAPEVV-SRKEYGPKVDIW 861

Query: 189 SVGVIFAELML-RIPYLPGRDDVDQIDVTFRAL------GTPTDKD 227
           S+G++  E++    PYL         +   RAL      GTP  KD
Sbjct: 862 SLGIMIIEMIEGEPPYL--------NETPLRALYLIATNGTPKLKD 899

>Scas_613.5
          Length = 517

 Score = 95.5 bits (236), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 70/224 (31%), Positives = 103/224 (45%), Gaps = 31/224 (13%)

Query: 6   YTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIRE-VKYLQEIRHAN 64
           Y   K +G G YA V  G  +  G+ +A+K     Q  D       RE    L  I H N
Sbjct: 204 YVLGKDLGSGHYATVKEGINKVTGQTVAVKIFHPQQNDDEKKSKQFREETNILMRIHHPN 263

Query: 65  VIELVDLFMAQENLNLVLEFLPAD-------LEMLIKDSSLLFTQADIKSWLLMTLRGVH 117
           ++ L+D F+   + + + ++L  D        E ++K + L   Q + K+     L G+ 
Sbjct: 264 IVNLLDFFIEPVSKSQIQKYLVLDKIDDGELFERIVKKTCL--RQDETKAIFNQILMGLK 321

Query: 118 HCHRSFILHRDLKPNNLL-------------LAP------DGQLKIADFGLARTLAAPHE 158
           H H+  I+HRD+KP N+L             L P      D Q+KIADFGLA+      +
Sbjct: 322 HLHQQNIIHRDIKPENILLNITRRTNPEQKQLGPWDEDEIDIQVKIADFGLAK-FTGEMQ 380

Query: 159 FMTSNVVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELMLRIP 202
           F  +   T  Y APE+L   + YT+ VD+WS GVI    +   P
Sbjct: 381 FTNTLCGTPSYVAPEVL-TKKGYTSKVDMWSAGVILYVCLCGFP 423

>Scas_673.20*
          Length = 758

 Score = 95.9 bits (237), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 110/201 (54%), Gaps = 7/201 (3%)

Query: 6   YTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHANV 65
           Y K K++GEG   +VY  +       +AIK+I   + +  L M    E+  L+E +H N+
Sbjct: 481 YRKLKRIGEGASGIVYTAYEIGTDISVAIKQIDL-KIQPRLQM-IWTEMLVLKEYQHPNI 538

Query: 66  IELVDLFMAQENLNLVLEFLPA-DLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFI 124
           I  ++ ++  + L +V+E++    L  ++  S    T+  + +    TL G++  H   I
Sbjct: 539 INFINSYLLHDTLWIVMEYMDGGSLADIV--SFFTPTEEQMATICRETLFGLNFLHSRGI 596

Query: 125 LHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAA 184
           +HRD+K +N+LL+ +G +KI DFG    L   +   T+ V T ++ APE++  ++ Y   
Sbjct: 597 VHRDIKSDNILLSMNGDIKITDFGFCGQLTESNTKRTTMVGTPYWMAPEVI-ASKEYGPK 655

Query: 185 VDLWSVGVIFAELML-RIPYL 204
           VD+WS+G++  E++    PYL
Sbjct: 656 VDVWSLGIMIIEMIEGEPPYL 676

>YDR507C (GIN4) [1321] chr4 complement(1462346..1465774)
           Serine/threonine-protein kinase required for septin
           organization at the bud neck, has similarity to Ycl024p
           [3429 bp, 1142 aa]
          Length = 1142

 Score = 95.9 bits (237), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 86/290 (29%), Positives = 131/290 (45%), Gaps = 47/290 (16%)

Query: 12  VGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFK---------------DGLDMSAIREVKY 56
           +G G+   V L    + G++ A+K I  + F                D L     RE+  
Sbjct: 25  LGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREIII 84

Query: 57  LQEIRHANVIELVDLFMAQENLNLVLEFL-PADLEMLIKDSSLLFTQADIKSWLLMTLRG 115
           ++ + H NV+ L D++    +L LVLE+    +L  L+ +   L     I+ +    + G
Sbjct: 85  MKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR-FFRQIIIG 143

Query: 116 VHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELL 175
           V +CH   I+HRDLKP NLLL     +KIADFG+A  L    + + ++  +  Y APE++
Sbjct: 144 VSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEGKLLETSCGSPHYAAPEIV 202

Query: 176 FGARHYTAAVDLWSVGVI-FAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSF 234
            G  +   A D+WS GVI FA L  R+P+       D+ D   R L     K   E+   
Sbjct: 203 SGIPYQGFASDVWSCGVILFALLTGRLPF-------DEEDGNIRTLLLKVQKGEFEM--- 252

Query: 235 SAYNKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCL 284
                      PS  E+       +  A DL+  +LT+DP +R  T   L
Sbjct: 253 -----------PSDDEI-------SREAQDLIRKILTVDPERRIKTRDIL 284

>Scas_648.17
          Length = 340

 Score = 93.6 bits (231), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 68/224 (30%), Positives = 108/224 (48%), Gaps = 10/224 (4%)

Query: 2   TAVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIR 61
           T  +Y    K+G G Y+ V+ G    +     IK +K  + K        RE+K L  + 
Sbjct: 46  TISDYEIITKIGRGKYSEVFSGECVNNETPCVIKVLKPVKMK-----KIYRELKILTNLT 100

Query: 62  HA-NVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCH 120
              NVIEL+D+     +    L F      M  +     FT  DI+ +    L  +++CH
Sbjct: 101 GGPNVIELLDIVQDPGSKIPALIFEEVK-NMDFRQLYPTFTLPDIQFYFTQLLIALNYCH 159

Query: 121 RSFILHRDLKPNNLLLAP-DGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGAR 179
              I+HRD+KP N+++ P + +L++ D+GLA     P       V +R+++ PELL    
Sbjct: 160 SMGIMHRDVKPQNVMIDPKERKLRLIDWGLAE-FYHPGVDYNVRVASRYHKGPELLVNLN 218

Query: 180 HYTAAVDLWSVGVIFAELML-RIPYLPGRDDVDQIDVTFRALGT 222
            Y  ++DLWSVG + A ++  R P+  G  + DQ+      LGT
Sbjct: 219 QYDYSLDLWSVGCMLAAIVFKREPFFKGSSNPDQLVRIAAVLGT 262

>YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protein
           kinase involved in septin organization and cell cycle
           control [3114 bp, 1037 aa]
          Length = 1037

 Score = 95.5 bits (236), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 105/203 (51%), Gaps = 13/203 (6%)

Query: 12  VGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAI---------REVKYLQEIRH 62
           +G G+   V L   +  G + A+K I  S F +  + S           RE+  ++ + H
Sbjct: 27  LGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVIMKLLSH 86

Query: 63  ANVIELVDLFMAQENLNLVLEFL-PADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHR 121
            NV+ L D++    NL L+LE+    +L  L+ D   L  +  I  +  + + G+ +CH 
Sbjct: 87  PNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIII-GISYCHA 145

Query: 122 SFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHY 181
             I+HRDLKP NLLL     +KIADFG+A  L    + + ++  +  Y APE++ G  + 
Sbjct: 146 LGIVHRDLKPENLLLDSFYNIKIADFGMA-ALQTDADLLETSCGSPHYAAPEIVSGLPYE 204

Query: 182 TAAVDLWSVGVI-FAELMLRIPY 203
             A D+WS GVI FA L  R+P+
Sbjct: 205 GFASDVWSCGVILFALLTGRLPF 227

>KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyveromyces
            lactis MAP kinase kinase kinase, start by similarity
          Length = 1338

 Score = 95.5 bits (236), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 107/201 (53%), Gaps = 21/201 (10%)

Query: 12   VGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIR-------EVKYLQEIRHAN 64
            +G+G++  VYL    T G  +A+K++   +F    D SAI        EV  L+++ H N
Sbjct: 1044 IGKGSFGAVYLALNVTTGEMLAVKQVTVPEF-SSQDESAISMVEALKSEVSTLKDLNHVN 1102

Query: 65   VIELVDLFMAQENLNLVLEFLPA-DLEMLIKDSSLLFTQAD---IKSWLLMTLRGVHHCH 120
            +++ +         +L LE++    +  LI+    ++ + D   I+      L G+ + H
Sbjct: 1103 IVQYLGFEEKNGIYSLFLEYVAGGSVGSLIR----MYGRFDDQLIRHLTKQVLEGLAYLH 1158

Query: 121  RSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTR---WYRAPELLFG 177
               ILHRD+K +NLLL  DG  KI+DFG++R   + + +  S++  R   ++ APE++  
Sbjct: 1159 SKGILHRDMKADNLLLDNDGVCKISDFGISR--KSNNIYSNSDMTMRGTVFWMAPEMVDT 1216

Query: 178  ARHYTAAVDLWSVGVIFAELM 198
            A  Y+A VD+WS+G +  E+ 
Sbjct: 1217 AHGYSAKVDIWSLGCVVLEMF 1237

>Kwal_26.7355
          Length = 1446

 Score = 95.1 bits (235), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 115/209 (55%), Gaps = 25/209 (11%)

Query: 6    YTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQF--KDGLDMSAIR----EVKYLQE 59
            + K + +G+G++  V+LG   T G  IA+K+++  ++  +D   +S +     EV  L++
Sbjct: 1146 WIKGEMIGKGSFGSVFLGLNVTTGEMIAVKQVEVPRYGSQDETTLSVLEALRSEVATLKD 1205

Query: 60   IRHANVIELVDLFMAQENLNLVLEFLPADLEMLIKDS--SLL-----FTQADIKSWLLMT 112
            + H N+++    ++  EN N V       LE +   S  SL+     F +  I+   +  
Sbjct: 1206 LDHTNIVQ----YLGFENKNYVYSLF---LEYVAGGSVGSLIRLYGKFDENLIRFLAVQV 1258

Query: 113  LRGVHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTR---WY 169
            LRG+ + H   ILHRD+K +NLLL  DG  KI+DFG+++   + + +  S++  R   ++
Sbjct: 1259 LRGLSYLHSKKILHRDMKADNLLLDVDGICKISDFGISK--KSNNIYSNSDMTMRGTVFW 1316

Query: 170  RAPELLFGARHYTAAVDLWSVGVIFAELM 198
             APE++   + Y+A VD+WS+G +  E+ 
Sbjct: 1317 MAPEMVDTKQGYSAKVDIWSLGCVVLEMF 1345

>AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH]
            complement(595092..599363) [4272 bp, 1423 aa]
          Length = 1423

 Score = 94.4 bits (233), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 62/208 (29%), Positives = 110/208 (52%), Gaps = 25/208 (12%)

Query: 6    YTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSA------IREVKYLQE 59
            + K + +G+G++  VYLG   T G  +A+K+++  +F    + +       I EV  L++
Sbjct: 1124 WIKGEMIGKGSFGAVYLGLNVTTGEMMAVKQVEVPKFGSQDETTVNNAEALISEVSTLKD 1183

Query: 60   IRHANVIELVDLFMAQENLNLVLEFLPADLEMLIKDS--SLL-----FTQADIKSWLLMT 112
            + H N+++    ++  EN N +       LE +   S  SL+     F +  I+      
Sbjct: 1184 LDHLNIVQ----YLGFENKNCIYSLF---LEYVAGGSVGSLIRLYGHFDEQLIRFLTTQV 1236

Query: 113  LRGVHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTR---WY 169
            L G+ + H   ILHRD+K +NLLL  DG  KI+DFG++R   + + +  S +  R   ++
Sbjct: 1237 LEGLAYLHLRGILHRDMKADNLLLDNDGVCKISDFGISR--KSNNIYSNSEMTMRGTVFW 1294

Query: 170  RAPELLFGARHYTAAVDLWSVGVIFAEL 197
             APE++   + Y+A VD+WS+G +  E+
Sbjct: 1295 MAPEMVDTTQGYSAKVDIWSLGCVVLEM 1322

>KLLA0E03487g complement(323764..325707) similar to sgd|S0002874
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 647

 Score = 94.0 bits (232), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 60/215 (27%), Positives = 108/215 (50%), Gaps = 7/215 (3%)

Query: 2   TAVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQF--KDGLDMSAIRE--VKYL 57
           T  +++ ++++G G+Y+ VY    ++ G+  AIK         ++ +    I +  +  L
Sbjct: 6   TPQDFSFKERLGHGSYSTVYKAVDRSTGQLFAIKVCSKKHIISENKVKYVTIEKNTLNLL 65

Query: 58  QEIRHANVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVH 117
               H  +I+L   F   ENL  VL+F P    + +  +   F +A  K ++   +  + 
Sbjct: 66  AHGNHPGIIKLYYTFHDSENLYFVLDFAPGGELLQLLQTQGRFNEAWTKHFMCQLIDALE 125

Query: 118 HCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSN--VVTRWYRAPELL 175
           + H   ++HRDLKP NLLL+ +G+L I DFG+A  LAA     +++  V T  Y +PELL
Sbjct: 126 YIHGCKVVHRDLKPENLLLSSEGKLMITDFGVASNLAATDNLSSTSSFVGTAEYVSPELL 185

Query: 176 FGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDV 210
              +    + D+W+VG +  +     P   G +++
Sbjct: 186 LQNKSNFCS-DIWAVGCMLYQFTQGTPPFRGENEL 219

>ADL102C [1639] [Homologous to ScYIL035C (CKA1) - SH]
           (503670..504788) [1119 bp, 372 aa]
          Length = 372

 Score = 92.8 bits (229), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 66/236 (27%), Positives = 115/236 (48%), Gaps = 34/236 (14%)

Query: 62  HANVIELVDLFM--AQENLNLVLEFLP-ADLEMLIKDSSLLFTQADIKSWLLMTLRGVHH 118
           H N+I L+D+          LV E++   D  +L       F+  DI+ ++   L+ + +
Sbjct: 129 HENIIHLLDVIKDPISRTPALVFEYVDNVDFRILYP----TFSDMDIRYYMFELLKALDY 184

Query: 119 CHRSFILHRDLKPNNLLL-APDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFG 177
           CH   I+HRD+KP+N+++     +L++ D+GLA  L  P E   + V +R+++ PELL  
Sbjct: 185 CHSMGIMHRDVKPHNVMIDHKQRKLRLIDWGLAE-LYHPKEEYNARVASRFFKGPELLVD 243

Query: 178 ARHYTAAVDLWSVGVIFAELM-LRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSA 236
            R Y  ++DLWS+G + A ++ ++ P+  GR + DQ+    R LG+           F  
Sbjct: 244 YRMYDYSLDLWSLGTMLASMVFMKEPFFHGRSNTDQLVKIVRVLGS---------EDFEK 294

Query: 237 Y-NKIQVYPPPSRSEL--------------RSRFIAATENALDLMCGMLTMDPHKR 277
           Y  K Q+  P    ++               +R +   E  +DL+  +L  D H+R
Sbjct: 295 YLVKYQITLPREFMDMDQYIRRPWKRFINDANRHLCDNEEIIDLIDNILKYDHHER 350

>CAGL0L06006g complement(670707..673535) similar to sp|P53104
           Saccharomyces cerevisiae YGL180w APG1 essential for
           autophagocytosis, hypothetical start
          Length = 942

 Score = 94.0 bits (232), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 85/323 (26%), Positives = 136/323 (42%), Gaps = 84/323 (26%)

Query: 6   YTKEKKVGEGTYAVVYLGHRQTDGR-QIAIKEIKTSQFKDGLDMSAIR-EVKYLQEIRHA 63
           Y  EK++G+G++A VY GH  TD +  IA+K +  S+ K+   +  +  E+  L++I+H 
Sbjct: 11  YVVEKEIGKGSFATVYRGHVTTDPKSHIAVKAVARSKLKNKKLLENLEIEIAILKKIKHP 70

Query: 64  NVIELVDLFMAQENLNLVLEFLP-ADLEMLIKDSSLL----------------------- 99
           +++ L+D      +  LV+++    DL  LIK    L                       
Sbjct: 71  HIVGLIDCERTTTDFYLVMDYCALGDLTFLIKKRKELENNHPLLQTVFNKYPPPSKEHNG 130

Query: 100 FTQADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAP------DGQ------------ 141
             +A +  +L      +       ++HRD+KP NLLLA       D +            
Sbjct: 131 LNRAFVVCYLQQLASALKFLRSKNLVHRDIKPQNLLLATPLTNYRDSKTFHELGYVGIYN 190

Query: 142 ---LKIADFGLARTLAAPHEFMTSNVV-TRWYRAPELLFGARHYTAAVDLWSVGVIFAEL 197
              LKIADFG AR L  P   +   +  +  Y APE+L   + Y A  DLWSVG +  E+
Sbjct: 191 LPILKIADFGFARFL--PSTSLAETLCGSPLYMAPEIL-NYQKYNAKADLWSVGTVLFEM 247

Query: 198 MLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKIQVYPPPSRSELRSRF-- 255
              +P                               F+A N ++++    R+     F  
Sbjct: 248 CCGVP------------------------------PFTASNHLELFKKIKRAHDEINFPE 277

Query: 256 IAATENAL-DLMCGMLTMDPHKR 277
           +   E+ L +L+C +LT DP KR
Sbjct: 278 VCEVEDGLKELICSLLTFDPAKR 300

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score = 93.6 bits (231), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 107/201 (53%), Gaps = 8/201 (3%)

Query: 3   AVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRH 62
           +V Y   + +G G+Y VVY    +   +++AIKE+      + +D+  + E+  L+ + H
Sbjct: 19  SVQYQLRQIIGRGSYGVVYKATNKKTAQEVAIKEVNYQDDDELVDI--MSEIDLLKNLNH 76

Query: 63  ANVIELVDLFMAQENLNLVLEFLP-ADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHR 121
            N+++       Q NL ++LE+     L+ LI  +  + ++ + K ++  TL G+++ H 
Sbjct: 77  INIVKYHGFIQKQHNLYIILEYCAKGSLKNLISRNRPM-SEHEAKPYVRQTLNGLNYLHE 135

Query: 122 SFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHY 181
             ++HRD+K  N+LL  +  +K+ADFG++  +   +  MT      W  APE++ G R  
Sbjct: 136 QGVIHRDIKAANILLDSENVVKLADFGVSTKVN--NTAMTLAGSLNWM-APEII-GNRGA 191

Query: 182 TAAVDLWSVGVIFAELMLRIP 202
           +   D+WS+G    EL+   P
Sbjct: 192 STLSDIWSLGATVVELLTGNP 212

>YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase
           kinase kinase essential for late nuclear division [2925
           bp, 974 aa]
          Length = 974

 Score = 93.6 bits (231), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 106/201 (52%), Gaps = 7/201 (3%)

Query: 3   AVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRH 62
           +V Y  ++ +G G+Y VVY    +   + +AIKE+     ++  D+ A  E+  L+ + H
Sbjct: 22  SVQYHLKQVIGRGSYGVVYKAINKHTDQVVAIKEVVYENDEELNDIMA--EISLLKNLNH 79

Query: 63  ANVIELVDLFMAQENLNLVLEFLP-ADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHR 121
            N+++          L ++LE+     L  LI  SS   ++ + K+++  TL G+ + H 
Sbjct: 80  NNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHG 139

Query: 122 SFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHY 181
             ++HRD+K  N+LL+ D  +K+ADFG++  + +    +T      W  APE+L G R  
Sbjct: 140 EGVIHRDIKAANILLSADNTVKLADFGVSTIVNSSA--LTLAGTLNWM-APEIL-GNRGA 195

Query: 182 TAAVDLWSVGVIFAELMLRIP 202
           +   D+WS+G    E++ + P
Sbjct: 196 STLSDIWSLGATVVEMLTKNP 216

>ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH]
           (797020..798951) [1932 bp, 643 aa]
          Length = 643

 Score = 93.2 bits (230), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 69/219 (31%), Positives = 111/219 (50%), Gaps = 11/219 (5%)

Query: 12  VGEGTYAVVYLGHRQTDGRQIAIKEIK--TSQFKDGLDMSAIREV--KYLQEIRHANVIE 67
           +G+GT+  V           +A+K +K  T      +  + I E+  K +  +   + + 
Sbjct: 279 LGQGTFGQVVKCQNMQTKEIVAVKVVKSKTEYLNQSIMEAKILELLNKRIDPLNQHHFLR 338

Query: 68  LVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQAD-IKSWLLMTLRGVHHCHRSFILH 126
           L D F+ + +L LV E L  +L  L+K +       + IK++    L  +     S ++H
Sbjct: 339 LHDSFVHKNHLCLVFELLSNNLYELLKQNKFHGLSMNLIKNFCKQLLDSLCVLKESKLIH 398

Query: 127 RDLKPNNLLL-APD-GQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAA 184
            DLKP N+LL +PD  +LK+ DFG A   A     + + + +R+YRAPE+L G   Y+ +
Sbjct: 399 CDLKPENVLLVSPDRPELKVIDFGSACEEA---RTVYTYIQSRFYRAPEVLMGI-PYSTS 454

Query: 185 VDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTP 223
           +D+WS G I AEL L IP  PG  + +Q+      LG P
Sbjct: 455 IDMWSFGCIVAELFLGIPVFPGASEFNQMTRIVEMLGVP 493

>ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH]
           complement(1062595..1063614) [1020 bp, 339 aa]
          Length = 339

 Score = 91.3 bits (225), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 65/226 (28%), Positives = 109/226 (48%), Gaps = 20/226 (8%)

Query: 5   NYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHA- 63
           NY    K+G G Y+ V+ G    +     IK +K  + K        RE+K L  +    
Sbjct: 49  NYEIINKIGRGKYSEVFRGKSIVNDHPCVIKVLKPVKMK-----KIYRELKILTNLTGGP 103

Query: 64  NVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSL-----LFTQADIKSWLLMTLRGVHH 118
           N+I L+D+     +       +PA +   +K+         FT +D + +    L  + +
Sbjct: 104 NIIGLLDIVQDPGSK------IPALIFEEVKNVEFRTLYPAFTLSDTQHYFKQLLIALDY 157

Query: 119 CHRSFILHRDLKPNNLLLAP-DGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFG 177
           CH   I+HRD+KP N+++ P + +L++ D+GLA     P       V +R+++ PELL  
Sbjct: 158 CHSMGIMHRDVKPQNVMIDPTERKLRLIDWGLAE-FYHPGVDYNVRVASRYHKGPELLVN 216

Query: 178 ARHYTAAVDLWSVGVIFAELMLRI-PYLPGRDDVDQIDVTFRALGT 222
              Y  ++DLWSVG + A ++ +  P+  G  + DQ+    R LGT
Sbjct: 217 LNQYDYSLDLWSVGCMLAAIVFKKEPFFKGSTNPDQLVKIARVLGT 262

>Scas_668.22
          Length = 893

 Score = 92.8 bits (229), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 106/202 (52%), Gaps = 9/202 (4%)

Query: 6   YTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIK-TSQFKDGLDMSAIREVKYLQEIRHAN 64
           YT   K+G+G    VY+ +       +AIK++    Q K  L    I E+  ++  RH N
Sbjct: 611 YTNLVKIGQGASGGVYIANEIGSNESVAIKQMNLEKQPKKEL---IINEILVMKGSRHPN 667

Query: 65  VIELVDLFMAQENLNLVLEFLPA-DLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSF 123
           ++  +D ++   +L +++E++    L  ++  +  + T+  I +    TL G+   H   
Sbjct: 668 IVNFIDSYLLDGDLWVIMEYMEGGSLTDVV--THCILTEGQIGAVCRETLSGLQFLHSKG 725

Query: 124 ILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTA 183
           +LHRD+K +N+LL+  G +K+ DFG    +   +   T+ V T ++ APE++   + Y  
Sbjct: 726 VLHRDIKSDNILLSISGDIKLTDFGFCAQINEINLKRTTMVGTPYWMAPEVV-SRKEYGP 784

Query: 184 AVDLWSVGVIFAELML-RIPYL 204
            VD+WS+G++  E++    PYL
Sbjct: 785 KVDIWSLGIMIIEMIEGEPPYL 806

>CAGL0J11638g complement(1128620..1130860) highly similar to
           sp|P32562 Saccharomyces cerevisiae YMR001c CDC5 involved
           in regulation of DNA replication, hypothetical start
          Length = 746

 Score = 92.4 bits (228), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 65/227 (28%), Positives = 112/227 (49%), Gaps = 8/227 (3%)

Query: 5   NYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEI-KTSQFKDGLDMSAIREVKYLQEIRHA 63
           +Y + + +GEG +A  +   +   G+  A K + K S   +      + E++  + + H 
Sbjct: 80  DYHRGQFLGEGGFARCFQI-KDDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMSHT 138

Query: 64  NVIELVDLFMAQENLNLVLEFLP-ADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRS 122
           N+++ +D F    N+ ++LE  P   L  LIK    + T+ +++ ++     G+ + H +
Sbjct: 139 NIVQFIDCFEDNVNVYILLEICPNGSLMELIKKRKTI-TEPEVRFFMTQICGGIQYMHSN 197

Query: 123 FILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARH-Y 181
            ++HRDLK  N+       LKI DFGLA  LA   E   +   T  Y APE+L G    +
Sbjct: 198 RVIHRDLKLGNIFFDEHYNLKIGDFGLAAVLANDRERKFTICGTPNYIAPEVLMGKHSGH 257

Query: 182 TAAVDLWSVGVIFAELMLRIPYLPGRDDVDQI--DVTFRALGTPTDK 226
           +  VD+WS+GV+   L++  P    + DV+ I   +  R    P DK
Sbjct: 258 SYEVDIWSIGVMLYALLIGKPPFQAK-DVNTIYERIKQRNFAYPKDK 303

>YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kinase
           required for induction of Rnr3p and DNA repair genes
           after DNA damage [1542 bp, 513 aa]
          Length = 513

 Score = 92.0 bits (227), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 84/314 (26%), Positives = 139/314 (44%), Gaps = 57/314 (18%)

Query: 10  KKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIRE-VKYLQEIRHANVIEL 68
           K++G G YA+V     +  G+Q+A+K     Q  D       RE    L  ++H N++ L
Sbjct: 204 KELGAGHYALVKEAKNKKTGQQVAVKIFHAQQNDDQKKNKQFREETNILMRVQHPNIVNL 263

Query: 69  VDLFM-----AQENLNLVLEFLPAD--LEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHR 121
           +D F+     +Q    LVLE +      E +++ + L   Q + K+     L G+ + H 
Sbjct: 264 LDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCL--RQDESKALFKQLLTGLKYLHE 321

Query: 122 SFILHRDLKPNNLL-------------LAP------DGQLKIADFGLARTLAAPHEFMTS 162
             I+HRD+KP N+L             L P      D Q+KIADFGLA+      +F  +
Sbjct: 322 QNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADFGLAK-FTGEMQFTNT 380

Query: 163 NVVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGT 222
              T  Y APE+L   + YT+ VDLWS GVI    +   P  P  D           LG 
Sbjct: 381 LCGTPSYVAPEVL-TKKGYTSKVDLWSAGVILYVCLCGFP--PFSD----------QLGP 427

Query: 223 PTDKDWPEVSSFSAYNKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTR 282
           P+ K+    + ++ Y+                +    ++ L L+  +L ++P +R++   
Sbjct: 428 PSLKEQILQAKYAFYSPY--------------WDKIDDSVLHLISNLLVLNPDERYNIDE 473

Query: 283 CLLSQYFVELPEAT 296
            L   +F ++ + +
Sbjct: 474 ALNHPWFNDIQQQS 487

>Kwal_55.20326
          Length = 750

 Score = 92.4 bits (228), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 69/270 (25%), Positives = 122/270 (45%), Gaps = 40/270 (14%)

Query: 2   TAVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIK-----------------TSQFKD 44
           T  N+ K  ++G G++  VYLG     G  +A+K+++                   Q+  
Sbjct: 454 TPKNWLKGARIGSGSFGSVYLGMNAQTGELMAVKQVELQPTAVAAGVVSVPDEVKKQYNQ 513

Query: 45  GLDMSAIR---------------EVKYLQEIRHANVIELVDLFMAQENLNLVLEFLPADL 89
             + SA++               E+  L+E++H N++          NLN+ LE++P   
Sbjct: 514 NANGSAVKNSSQVHRKMVDALQHEMGLLKELQHENIVTYYGSSQEGGNLNIFLEYVPGGS 573

Query: 90  EMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGL 149
              + +S   F +  I+++    L G+ + HR  I+HRD+K  N+L+   G +KI DFG+
Sbjct: 574 VSSMLNSYGPFEEPLIRNFTRQILIGLSYLHRKDIIHRDIKGANILIDIKGCVKITDFGI 633

Query: 150 ARTLAAPHEFMTSNVVTR---WYRAPELLFGARHYTAAVDLWSVGVIFAELMLRIPYLPG 206
           ++ L+  ++        +   ++ APE++      T   D+WSVG +  E+       P 
Sbjct: 634 SKKLSPLNQQQNKRASLQGSVYWMAPEVVKQVV-TTKKADIWSVGCVIIEMFTGKHPFP- 691

Query: 207 RDDVDQIDVTFRALGTPTDKDWPEVSSFSA 236
             D  Q+   F+ +GT T  D P  SS  A
Sbjct: 692 --DFSQMQAIFK-IGTNTFPDSPSWSSNEA 718

>Kwal_23.6325
          Length = 1542

 Score = 92.4 bits (228), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 78/307 (25%), Positives = 142/307 (46%), Gaps = 42/307 (13%)

Query: 3    AVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDM-SAIRE-VKYLQEI 60
            ++ + K + VG G +  V+       G  +A+KEIK    K    +  AI+E +  L+ +
Sbjct: 1246 SIRWQKRQFVGGGAFGTVFSAVNLDTGEILAVKEIKIQDRKSMKQVFPAIKEEMSVLEML 1305

Query: 61   RHANVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCH 120
             H NV++   + + ++ +NL +E+        + +   +  +   + + L  L G+ + H
Sbjct: 1306 NHPNVVQYYGVEVHRDKVNLFMEYCEGGSLAQLLEHGRIEDEMVTQIYALQMLEGLAYLH 1365

Query: 121  RSFILHRDLKPNNLLLAPDGQLKIADFGLARTLA-----APH-------EFMTSNVVTRW 168
            +S ++HRD+KP N+LL  +G +K  DFG AR+LA     AP+       + + S + T  
Sbjct: 1366 QSSVVHRDIKPENILLDFNGVIKYVDFGAARSLAANGTKAPNVGAEGKADGVNSMMGTPM 1425

Query: 169  YRAPELLFGARHYT-AAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKD 227
            Y +PE + GA+     + D+WS+G +  E+                 VT R      D +
Sbjct: 1426 YMSPESITGAKKGKFGSGDIWSLGCVILEM-----------------VTGRRPWFNLDNE 1468

Query: 228  WPEVSSFSAYNKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQ 287
            W  +   +A +  Q+   P++ EL       +   +D +   L  DP+KR      LL  
Sbjct: 1469 WAIMYHVAAGHVPQL---PTKEEL-------SPQGIDFLLRCLKQDPNKRSTAMELLLHP 1518

Query: 288  YFVELPE 294
            + +E+ E
Sbjct: 1519 WMIEIRE 1525

>CAGL0K02673g complement(240509..243256) similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20
           Serine/threonine-protein kinase, hypothetical start
          Length = 915

 Score = 92.0 bits (227), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 56/196 (28%), Positives = 107/196 (54%), Gaps = 7/196 (3%)

Query: 11  KVGEGTYAVVYLGHRQTDGRQIAIKEIK-TSQFKDGLDMSAIREVKYLQEIRHANVIELV 69
           K+G+G    VY+ H       +AIK++    Q K  L    + E+  ++E +H+N++  +
Sbjct: 625 KIGQGASGGVYIAHDTESEDSVAIKQMNLEKQPKKEL---ILNEILVMRESKHSNIVNFI 681

Query: 70  DLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFILHRDL 129
           D ++A+ +L +V+E++     +    +  L ++  I +    TL+G+   H   +LHRD+
Sbjct: 682 DSYLAKGDLWIVMEYMEGG-SLTDVVTHCLLSEGQIGAVCRETLKGLQFLHSKGVLHRDI 740

Query: 130 KPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAAVDLWS 189
           K +N+LL+  G +K+ DFG    +   +   T+ V T ++ APE++   + Y   VD+WS
Sbjct: 741 KSDNILLSLKGNIKLTDFGFCAQINENNLKRTTMVGTPYWMAPEVV-SRKEYGPKVDIWS 799

Query: 190 VGVIFAELML-RIPYL 204
           +G++  E++    PYL
Sbjct: 800 LGIMIIEMIEGEPPYL 815

>Scas_651.3
          Length = 793

 Score = 92.0 bits (227), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 71/232 (30%), Positives = 116/232 (50%), Gaps = 33/232 (14%)

Query: 12  VGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHA-------N 64
           +G+GT+  V      T    +A+K IK+    + L+ S I E K L+ I +        +
Sbjct: 386 LGQGTFGQVVKCQNLTTKEILAVKVIKSRS--EYLNQS-ITEAKILELINNKIDPENKHH 442

Query: 65  VIELVDLFMAQENLNLVLEFLPADLEMLIKDSSL---------LFTQADIKSWLLMTLRG 115
            + + D F+ + +L LV E L  +L  L+K +           +FT+  ++S  ++    
Sbjct: 443 FLRMYDSFIHKNHLCLVFELLSNNLYELLKQNQFHGLSIQLIRIFTKQMLESLCVLKDSK 502

Query: 116 VHHCHRSFILHRDLKPNNLLL-APDG-QLKIADFGLARTLAAPHEFMTSNVVTRWYRAPE 173
           + HC        DLKP N+LL +PD   LKI DFG +         + + + +R+YRAPE
Sbjct: 503 LIHC--------DLKPENILLCSPDKPALKIIDFGSS---CEETRTVYTYIQSRFYRAPE 551

Query: 174 LLFGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTD 225
           ++ G   Y+ ++D+WS+G I AEL L IP  PG  + +Q+      LG P +
Sbjct: 552 IILGIP-YSTSIDMWSLGCIVAELFLGIPIFPGSSEYNQLTRIVDTLGYPPN 602

>KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces
           cerevisiae YGL180w APG1 essential for autophagocytosis,
           start by similarity
          Length = 831

 Score = 92.0 bits (227), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 72/245 (29%), Positives = 112/245 (45%), Gaps = 50/245 (20%)

Query: 5   NYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIR-EVKYLQEIRHA 63
           NY+ EK++G+G++AVVY G    DGR IAIK +  S+ K+   +  +  E+  L++I+H 
Sbjct: 20  NYSVEKEIGKGSFAVVYKGLSLRDGRNIAIKAVSRSKLKNKKLLENLEVEIAILKKIKHP 79

Query: 64  NVIELVDLFMAQENLNLVLEFLP-ADLEMLIKD-SSLLFTQADIKS-------------- 107
           +++ L+D      +  L++E+    DL   IK   +L+     IK+              
Sbjct: 80  HIVGLIDCERTSSDFYLIMEYCALGDLTFFIKKRKNLVLKHPLIKTVFEHYPPPSTEHNG 139

Query: 108 --------WLLMTLRGVHHCHRSFILHRDLKPNNLLLAP------DGQ------------ 141
                   +L      +       ++HRD+KP NLLL        D +            
Sbjct: 140 LNRVLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLCTPLLDYNDPKTFHELGFVGIYN 199

Query: 142 ---LKIADFGLARTLAAPHEFMTSNVV-TRWYRAPELLFGARHYTAAVDLWSVGVIFAEL 197
              LKIADFG AR L  P+  +   +  +  Y APE+L   + Y A  DLWSVG +  E+
Sbjct: 200 LPILKIADFGFARFL--PNTSLAETLCGSPLYMAPEIL-NYQKYNAKADLWSVGTVLYEM 256

Query: 198 MLRIP 202
               P
Sbjct: 257 CCGRP 261

>KLLA0F16467g 1519800..1520822 highly similar to sp|P19454
           Saccharomyces cerevisiae YOR061w CKA2 casein kinase II
           alpha chain, start by similarity
          Length = 340

 Score = 90.1 bits (222), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 65/224 (29%), Positives = 109/224 (48%), Gaps = 16/224 (7%)

Query: 5   NYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHA- 63
           NY   KK+G G Y+ V+ G    +     IK +K  + K        RE+K L  +    
Sbjct: 50  NYEVIKKIGRGKYSEVFKGKSVLNDIPCVIKVLKPVKMK-----KIYRELKVLTNLTGGP 104

Query: 64  NVIELVDLFM--AQENLNLVLEFLP-ADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCH 120
           N+I L+D+      +   L+ E +   D   L       FT +D + +    L  + +CH
Sbjct: 105 NIIGLLDIVQDPGSKIPALIFEEVKNVDFRTLYPS----FTLSDTQFYFTQLLTALDYCH 160

Query: 121 RSFILHRDLKPNNLLLAPDG-QLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGAR 179
              I+HRD+KP N+++ P+  +L++ D+GLA     P       V +R+++ PELL    
Sbjct: 161 SMGIMHRDVKPQNVMIDPNERKLRLIDWGLAE-FYHPGVDYNIRVASRYHKGPELLVSLN 219

Query: 180 HYTAAVDLWSVGVIFAELMLRI-PYLPGRDDVDQIDVTFRALGT 222
            Y  ++DLW+VG + A ++ +  P+  G  + DQ+    + LGT
Sbjct: 220 QYDYSLDLWAVGCMIAAIVFKKEPFFKGSTNADQLVKIAKVLGT 263

>Kwal_26.7861
          Length = 955

 Score = 91.3 bits (225), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 118/231 (51%), Gaps = 23/231 (9%)

Query: 11  KVGEGTYAVVYLGHRQTDGRQIAIKEIK-TSQFKDGLDMSAIREVKYLQEIRHANVIELV 69
           K+G+G    VY  +       +AIK++    Q K  L    I E+  ++  +HAN++  +
Sbjct: 672 KIGQGASGGVYTAYEVGTNASVAIKQMNLEKQPKKEL---IINEILVMKASKHANIVNFI 728

Query: 70  DLFMAQENLNLVLEFLPA-DLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFILHRD 128
           D ++ + +L +V+E++    L  ++  +  + T+  I +    TL+G+   H   ++HRD
Sbjct: 729 DSYLLRGDLWVVMEYMEGGSLTDVV--THCILTEGQIGAVSRETLKGLQFLHSKGVIHRD 786

Query: 129 LKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAAVDLW 188
           +K +N+LL+  G++K+ DFG    +   +   T+ V T ++ APE++   + Y   VD+W
Sbjct: 787 IKSDNVLLSMSGEIKLTDFGFCAQINEINLKRTTMVGTPYWMAPEVV-SRKEYGPKVDIW 845

Query: 189 SVGVIFAELML-RIPYLPGRDDVDQIDVTFRAL------GTPTDKDWPEVS 232
           S+G++  E++    PYL         +   RAL      GTP  KD   +S
Sbjct: 846 SLGIMIIEMIEGEPPYL--------NETPLRALYLIATNGTPELKDADSLS 888

>CAGL0M10153g complement(1010688..1013291) some similarities with
           sp|Q03497 Saccharomyces cerevisiae YHL007c ser/thr
           protein kinase of the pheromone pathway, hypothetical
           start
          Length = 867

 Score = 91.3 bits (225), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 57/197 (28%), Positives = 106/197 (53%), Gaps = 8/197 (4%)

Query: 11  KVGEGTYAVVYLGHRQTDGRQ-IAIKEIK-TSQFKDGLDMSAIREVKYLQEIRHANVIEL 68
           K+G+G    VYL H ++D  Q +AIK++    Q K  L    + E+  +   +H N++  
Sbjct: 571 KIGQGASGGVYLSHSRSDKSQCVAIKQMNLEKQPKKEL---IVNEIMVMSSSKHQNIVNY 627

Query: 69  VDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFILHRD 128
           +D +++  +L +V+E++       +    +L T+  I +     L+G+   H   +LHRD
Sbjct: 628 IDSYLSGLDLWVVMEYMEGGCLTDVVTYCVL-TEGQIGAVCREVLQGLEFLHSKGVLHRD 686

Query: 129 LKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAAVDLW 188
           +K +N+LL+ +G +K+ DFG    +       T+ V T ++ APE++   + Y   VD+W
Sbjct: 687 IKSDNVLLSMNGDIKLTDFGFCAQVNDTVIKRTTMVGTPYWMAPEIV-SRKEYGPKVDIW 745

Query: 189 SVGVIFAELML-RIPYL 204
           S+G++  E++    PYL
Sbjct: 746 SLGIMIIEMIEGEPPYL 762

>YJL141C (YAK1) [2777] chr10 complement(147885..150308)
           Serine/threonine protein kinase, negative regulator of
           cell growth acting in opposition to cAMP-dependent
           protein kinase A [2424 bp, 807 aa]
          Length = 807

 Score = 90.9 bits (224), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 72/223 (32%), Positives = 114/223 (51%), Gaps = 19/223 (8%)

Query: 12  VGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYL----QEIRHAN--- 64
           +G+GT+  V           +A+K +K+   +      +I E K L    Q+I   N   
Sbjct: 375 LGQGTFGQVVKCQNLLTKEILAVKVVKS---RTEYLTQSITEAKILELLNQKIDPTNKHH 431

Query: 65  VIELVDLFMAQENLNLVLEFLPADLEMLIKDSSL--LFTQADIKSWLLMTLRGVHHCHRS 122
            + + D F+ + +L LV E L  +L  L+K +    L  Q  I+++    L  +     S
Sbjct: 432 FLRMYDSFVHKNHLCLVFELLSNNLYELLKQNKFHGLSIQL-IRTFTTQILDSLCVLKES 490

Query: 123 FILHRDLKPNNLLL-APDG-QLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARH 180
            ++H DLKP N+LL APD  +LKI DFG +   A     + + + +R+YRAPE++ G   
Sbjct: 491 KLIHCDLKPENILLCAPDKPELKIIDFGSSCEEA---RTVYTYIQSRFYRAPEIILGIP- 546

Query: 181 YTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTP 223
           Y+ ++D+WS+G I AEL L IP  PG  + +Q+      LG P
Sbjct: 547 YSTSIDMWSLGCIVAELFLGIPIFPGASEYNQLTRIIDTLGYP 589

>AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W
           (KCC4) - SH] (1721689..1725117) [3429 bp, 1142 aa]
          Length = 1142

 Score = 90.9 bits (224), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 80/290 (27%), Positives = 131/290 (45%), Gaps = 50/290 (17%)

Query: 12  VGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFK------------DGLDMSAIREVKYLQE 59
           +G G+   V L      G+  A+K I  S F             D L     RE+  ++ 
Sbjct: 25  LGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIIIMKL 84

Query: 60  IRHANVIELVDLFMAQENLNLVLEFLPAD--LEMLIKDSSLLFTQADIKSWLLMTLRGVH 117
           + H NV+ L D++   ++L +VLE++       +L++   L   +A    +    + G+ 
Sbjct: 85  LNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEA--VRFFRQIIIGIS 142

Query: 118 HCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFG 177
           +CH   I+HRDLKP NLLL     +K+ADFG+A  L +  + + ++  +  Y APE++ G
Sbjct: 143 YCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLLETSCGSPHYAAPEIVSG 201

Query: 178 ARHYTAAVDLWSVGVI-FAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSA 236
             ++    D+WS GVI +A L  R+P+       D+ D   R L                
Sbjct: 202 LPYHGFESDVWSCGVILYALLTGRLPF-------DEEDGNIRNL---------------- 238

Query: 237 YNKIQV--YPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCL 284
             K+Q   Y  P   E+       +  A DL+  +LT++P +R  T   L
Sbjct: 239 LLKVQSGKYEIPGEDEI-------SPEARDLIVQILTVEPEQRIKTREIL 281

>Scas_718.90
          Length = 647

 Score = 90.5 bits (223), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 79/294 (26%), Positives = 135/294 (45%), Gaps = 33/294 (11%)

Query: 10  KKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYL--QEIRHANVIE 67
           KK+GEG    V +  + TDG+  A+K  +  +  + +  S    V++     + H N+IE
Sbjct: 319 KKLGEGATGSVSIV-QGTDGKMFAVKMFRAPKTTNVVTYSKKITVEFCIGSTLHHQNIIE 377

Query: 68  LVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFILHR 127
             D+    E   +V+E+ P D   L+   + L T  ++  +      GV++ H   I HR
Sbjct: 378 TFDMLREGETFLVVMEYAPYDFFNLVM--ADLMTTKEVSCYFKQLCNGVNYLHDMGIAHR 435

Query: 128 DLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSN----VVTRWYRAPELLFGARHYTA 183
           DLK +N +++ +G LK+ DFG A     P+E         V +  Y APELL  + +   
Sbjct: 436 DLKLDNCVVSHNGILKLIDFGSAVIFQYPYENKIVKAQGIVGSDPYLAPELLNTSTYDPR 495

Query: 184 AVDLWSVGVIFAELML-RIPYLPGRDDVDQIDVTFRALGT-PTDKDWPEVSSFSAYNKIQ 241
            VD+WS+ +I+  ++L R P+   R   +    +FR     P D+D  +V+    Y  ++
Sbjct: 496 PVDVWSIAIIYYCMILRRFPWKAPRKSFN----SFRLFCEDPDDED--DVAK-GPYRLLR 548

Query: 242 VYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYFVELPEA 295
           + P  SR                L+  ML +DP KR      +  ++F  + + 
Sbjct: 549 LLPSKSRP---------------LIAKMLLLDPKKRILMNEVVKDEWFASIKQC 587

>Scas_640.14*
          Length = 728

 Score = 90.1 bits (222), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 94/210 (44%), Gaps = 14/210 (6%)

Query: 12  VGEGTYAVVYLGHRQT---------DGRQIAIKEIKTSQFKDG--LDMSAIREVKYLQEI 60
           +GEG +  V +G   T         D +Q+AIK I+    K G   +M   RE+  L+ +
Sbjct: 44  LGEGEFGKVKMGWSTTSSSSGKITEDSKQVAIKLIRRDFIKKGSEKEMKIFREINSLKHL 103

Query: 61  RHANVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCH 120
            H N++ L ++    + + +VLE+                 +A         + GV + H
Sbjct: 104 THPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYVQRKRRLKEATACRLFAQLISGVSYMH 163

Query: 121 RSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARH 180
              I+HRDLK  NLLL     L I DFG      A +E M ++  +  Y APEL+     
Sbjct: 164 SKGIVHRDLKLENLLLDKHENLIITDFGFVNEFYADNELMKTSCGSPCYAAPELVITTEP 223

Query: 181 YTA-AVDLWSVGVIFAELMLRIPYLPGRDD 209
           Y A   D+WS G+I   ++    YLP  DD
Sbjct: 224 YKARKADIWSCGIILYGMLA--GYLPWDDD 251

>KLLA0C04191g 384198..386591 weakly similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15 protein kinase of
           the MAP kinase kinase kinase family, hypothetical start
          Length = 797

 Score = 90.1 bits (222), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 104/199 (52%), Gaps = 11/199 (5%)

Query: 6   YTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSA-IREVKYLQEIRHAN 64
           Y  ++ +G G Y VVY   ++   +  AIK+I   +F+D  +++  + E+  L+ +RH N
Sbjct: 10  YALKQVIGRGAYGVVYRAVKRGTNKPCAIKQI---EFEDESELNEHMLEIDLLKNLRHQN 66

Query: 65  VIELVDLFMAQENLNLVLEFLP-ADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSF 123
           ++E          L ++LE+     L  ++K   LL  + D  +++  TL G+ + H   
Sbjct: 67  IVEYRGFIQKAHELYIILEYCARGSLRDILKHGPLL--EDDTVNYVTQTLYGLQYLHEQG 124

Query: 124 ILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTA 183
           ++HRD+K  NLLL  +G +K+ADFG++  +      MT      W  APE++ G    T 
Sbjct: 125 VIHRDIKAANLLLTEEGIVKLADFGVSTRIN--RMAMTYAGSPNWM-APEVMTGQGASTV 181

Query: 184 AVDLWSVGVIFAELMLRIP 202
           + D+WS+G    EL+   P
Sbjct: 182 S-DIWSLGATVVELLTGNP 199

>CAGL0I05896g 560169..562505 some similarities with sp|P14680
           Saccharomyces cerevisiae YJL141c YAK1 ser/thr protein
           kinase, hypothetical start
          Length = 778

 Score = 89.7 bits (221), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 67/220 (30%), Positives = 111/220 (50%), Gaps = 13/220 (5%)

Query: 12  VGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHAN----VIE 67
           +G+GT+  V           IA+K +K+        +S  + ++ L E    N     + 
Sbjct: 367 LGQGTFGQVVKCQNLQTKEIIAVKVVKSRSEYLNQSISEAKILELLNEKIDPNNKHHFLR 426

Query: 68  LVDLFMAQENLNLVLEFLPADLEMLIKDSSL--LFTQADIKSWLLMTLRGVHHCHRSFIL 125
           + D F+ + +L LV E L  +L  L+K +    L  Q  I+++ +  L  +     S ++
Sbjct: 427 MHDSFVHKNHLCLVFELLSNNLYELLKQNKFHGLSIQL-IRTFTIQILDSLCVLKDSKLI 485

Query: 126 HRDLKPNNLLL-APDG-QLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTA 183
           H DLKP N+LL +PD   LK+ DFG +         + + + +R+YRAPE++ G   Y+ 
Sbjct: 486 HCDLKPENILLCSPDKPDLKVIDFGSS---CEETRTVYTYIQSRFYRAPEIILGIP-YST 541

Query: 184 AVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTP 223
           ++D+WS+G I AEL L IP  PG  + +Q+      LG P
Sbjct: 542 SIDMWSLGCIVAELFLGIPIFPGSSEFNQLTRIITTLGYP 581

>AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)
           [2181 bp, 726 aa]
          Length = 726

 Score = 89.7 bits (221), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 113/230 (49%), Gaps = 17/230 (7%)

Query: 10  KKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQF--KDGLDMSAIRE--VKYLQEIRHANV 65
           +++G G+Y+ VY    ++   Q AIK         ++ +    I +  +  L +  H  +
Sbjct: 14  EELGHGSYSTVYRVVERSSQHQYAIKICSKRHIIGENKVKYVTIEKNTLNLLGQANHPGI 73

Query: 66  IELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFIL 125
           I+L   F  QENL  V++  P    + +     +F++A  + ++   +  V + H   ++
Sbjct: 74  IKLYYTFHDQENLYFVMDLAPGGELLQLLRRQRVFSEAWARHYMCQLVDTVEYIHSMGVI 133

Query: 126 HRDLKPNNLLLAPDGQLKIADFGLARTLAAP------HEFMTSNVVTRWYRAPELLFGAR 179
           HRDLKP N+LL  +G+L IADFG A T+          +  TS V T  Y +PELL   +
Sbjct: 134 HRDLKPENVLLDKEGRLMIADFGAAYTVGQSDAGSDGDKPATSFVGTAEYVSPELLLENK 193

Query: 180 HYTAAVDLWSVGVIFAELMLRIPYLPGRDDVD------QIDVTFRALGTP 223
            Y ++ D+W++G +  + +   P   G+++++       +D T+R    P
Sbjct: 194 SYYSS-DVWALGCMLYQFLQGTPPFRGQNEMETFEQIVNLDYTWRIPANP 242

>ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH]
           complement(333434..337711) [4278 bp, 1425 aa]
          Length = 1425

 Score = 89.7 bits (221), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 62/209 (29%), Positives = 104/209 (49%), Gaps = 14/209 (6%)

Query: 10  KKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFK------DGLDMSAIREVKYLQEIRHA 63
           K +G+G+   V L      G+  AIK +     +        L     RE+  ++ I H 
Sbjct: 65  KTLGKGSSGRVRLAKNMQSGKLAAIKIVPKRNVRHNQKQVTALPYGIEREIIIMKLITHP 124

Query: 64  NVIELVDLFMAQENLNLVLEFLPAD--LEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHR 121
           N++ L +++  +  L LVLE++      + LI    L   +A    +    ++GV +CH 
Sbjct: 125 NIMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLPEQEA--IHYFKQIVQGVSYCHN 182

Query: 122 SFILHRDLKPNNLLLAPDGQ-LKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARH 180
             I HRDLKP NLLL    + +KIADFG+A  L   +  + ++  +  Y +PE++ G ++
Sbjct: 183 FNICHRDLKPENLLLDKKNKTVKIADFGMA-ALETTNRLLETSCGSPHYASPEIVMGQKY 241

Query: 181 YTAAVDLWSVGVIFAELMLRIPYLPGRDD 209
           + +  D+WS G+I   L+    +LP  DD
Sbjct: 242 HGSPSDVWSCGIILFALLTG--HLPFNDD 268

>Kwal_26.8709
          Length = 829

 Score = 89.7 bits (221), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 61/212 (28%), Positives = 96/212 (45%), Gaps = 11/212 (5%)

Query: 12  VGEGTYAVVYLGHRQTDG------RQIAIKEIKTSQFKDG--LDMSAIREVKYLQEIRHA 63
           +GEG +  V LG  +T        +Q+AIK I+          ++   RE+  L+ + H 
Sbjct: 46  LGEGEFGKVKLGWSKTSNSSMDVPKQVAIKLIRRDTIPKNSEKEIKIYREINALKHLNHP 105

Query: 64  NVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSF 123
           N++ L ++    + + +VLE+                 +          + GV++ H   
Sbjct: 106 NIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKEGPACRLFAQLISGVYYMHSKG 165

Query: 124 ILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTA 183
           ++HRDLK  NLLL  +  L I DFG        +E M ++  +  Y APEL+  AR Y A
Sbjct: 166 LVHRDLKLENLLLDKNENLLITDFGFVNEFLPENELMKTSCGSPCYAAPELVVTARPYEA 225

Query: 184 -AVDLWSVGVIFAELMLRIPYLPGRDDVDQID 214
              D+WS GVI   ++    YLP  DD +  D
Sbjct: 226 RKADVWSCGVILYAMLAG--YLPWDDDPENPD 255

>KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces
           cerevisiae YJL141c YAK1 ser/thr protein kinase, start by
           similarity
          Length = 704

 Score = 89.4 bits (220), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 67/222 (30%), Positives = 108/222 (48%), Gaps = 17/222 (7%)

Query: 12  VGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHA-------N 64
           +G+GT+  V           +A+K +K+   K      ++ E K L+ +          +
Sbjct: 338 LGQGTFGQVVKCQNLITKEILAVKVVKS---KSEYLNQSVTEAKVLELLNRQIDPNNEHH 394

Query: 65  VIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLL-FTQADIKSWLLMTLRGVHHCHRSF 123
            + L D F+ + +L LV E L  +L  L+K +     +   IK++    L  +     S 
Sbjct: 395 FLRLHDTFVHKHHLCLVFELLSNNLYELLKLNEFHGLSMTLIKTFSKQLLDSLCVLKDSK 454

Query: 124 ILHRDLKPNNLLLAPDGQ--LKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHY 181
           ++H DLKP N+LL  + +  LK+ DFG A         + + + +R+YRAPE+L G   Y
Sbjct: 455 LIHCDLKPENILLVSNDRPDLKVIDFGSA---CEETRTIYTYIQSRFYRAPEVLLGI-PY 510

Query: 182 TAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTP 223
           +  +D+WS G I AEL L IP  PG  + DQ+     +LG P
Sbjct: 511 STGIDMWSFGCIVAELFLGIPIFPGNSEFDQVTRIVESLGMP 552

>ABL011C [581] [Homologous to ScYLR362W (STE11) - SH]
           (378259..380364) [2106 bp, 701 aa]
          Length = 701

 Score = 89.4 bits (220), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 68/265 (25%), Positives = 122/265 (46%), Gaps = 35/265 (13%)

Query: 1   MTAVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIK---------------------- 38
           +T  ++ K  ++G G++  VYLG     G  +A+K+++                      
Sbjct: 410 VTPKSWLKGARIGSGSFGSVYLGMNAHTGELMAVKQVELEPTTVMASSDDKKSHPSSNAV 469

Query: 39  ----TSQFKDGLDMSAIREVKYLQEIRHANVIELVDLFMAQENLNLVLEFLPADLEMLIK 94
               T   +DG   S+ + +  L+E+ H N++          NLN+ LE++P      + 
Sbjct: 470 VKKLTDPPQDGGRASSTK-MNLLKELHHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSML 528

Query: 95  DSSLLFTQADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLA 154
           +S   F +  +K++   TL G+ + HR  I+HRD+K  NLL+   G +KI DFG+++ L+
Sbjct: 529 NSYGPFEEPLVKNFTRQTLVGLTYLHRKNIIHRDIKGANLLIDIKGSVKITDFGISKKLS 588

Query: 155 APHEFMTSNVVTR---WYRAPELLFGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVD 211
             ++        +   ++ APE++      T   D+WSVG +  E+       P   D  
Sbjct: 589 PLNKKQNKRASLQGSVYWMAPEVVKQVV-TTEKADIWSVGCVVVEMFTGKHPFP---DFS 644

Query: 212 QIDVTFRALGTPTDKDWPEVSSFSA 236
           Q+   F+ +GT T  + P  +S  A
Sbjct: 645 QMQAIFK-IGTNTIPELPSWASDGA 668

>YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine protein
            kinase of the MEKK family involved in the cell wall
            integrity (low-osmolarity) and nutrient sensing pathways
            [4437 bp, 1478 aa]
          Length = 1478

 Score = 89.4 bits (220), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 60/202 (29%), Positives = 110/202 (54%), Gaps = 13/202 (6%)

Query: 6    YTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLD-----MSAIR-EVKYLQE 59
            + K + +G+G++  VYL    T G  +A+K+++  ++    +     + A+R EV  L++
Sbjct: 1175 WMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKD 1234

Query: 60   IRHANVIELVDLFMAQENLNLVLEFLPA-DLEMLIKDSSLLFTQADIKSWLLMTLRGVHH 118
            + H N+++ +         +L LE++    +  LI+     F +  IK      L+G+ +
Sbjct: 1235 LDHLNIVQYLGFENKNNIYSLFLEYVAGGSVGSLIRMYGR-FDEPLIKHLTTQVLKGLAY 1293

Query: 119  CHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTR---WYRAPELL 175
             H   ILHRD+K +NLLL  DG  KI+DFG++R   +   +  S++  R   ++ APE++
Sbjct: 1294 LHSKGILHRDMKADNLLLDQDGICKISDFGISRK--SKDIYSNSDMTMRGTVFWMAPEMV 1351

Query: 176  FGARHYTAAVDLWSVGVIFAEL 197
               + Y+A VD+WS+G I  E+
Sbjct: 1352 DTKQGYSAKVDIWSLGCIVLEM 1373

>Scas_692.24
          Length = 718

 Score = 89.0 bits (219), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 69/220 (31%), Positives = 105/220 (47%), Gaps = 17/220 (7%)

Query: 25  RQTDGRQIAIKEIKTSQFKDGLDMSAIR---EVKYLQEIRHANVIELVDLFM--AQENLN 79
           R TDG   A+KE +  +  + +   A +   E      + H NVIE VD+F    Q    
Sbjct: 233 RPTDGVTFAVKEFRPRKPNESVKEYAKKCTAEFCIGSTLHHPNVIETVDIFSDSKQNKYF 292

Query: 80  LVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAPD 139
            V+++ P D   ++    +  ++ +I   L   L GV + H   + HRDLK +N ++  D
Sbjct: 293 EVMQYCPVDFFAVVMTGKM--SRGEINCCLKQLLEGVKYLHSMGLAHRDLKLDNCVMNED 350

Query: 140 GQLKIADFGLARTLAAPHE---FMTSNVV-TRWYRAPELLFGARHYT-AAVDLWSVGVIF 194
           G LK+ DFG A     P+E    M   +V +  Y APE++   + Y    VD+WSVG+I+
Sbjct: 351 GILKLIDFGSAVVFRYPYEDDIAMAHGIVGSDPYLAPEVITSTKSYDPQCVDIWSVGIIY 410

Query: 195 AELML-RIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSS 233
             +ML R P+   R+     D  FR    P D +   V S
Sbjct: 411 CCMMLKRFPWKAPRES----DDNFRLYSMPDDMEHDYVES 446

>KLLA0F13552g complement(1252906..1256709)
           gi|33386566|emb|CAD87727.1 Kluyveromyces lactis protein
           kinase, start by similarity
          Length = 1267

 Score = 89.4 bits (220), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 64/208 (30%), Positives = 108/208 (51%), Gaps = 14/208 (6%)

Query: 10  KKVGEGTYAVVYLGHRQTDGRQIAIKEI-----KTSQFKDGLDMSAIREVKYLQEIRHAN 64
           K +G+G+   V L      G+  AIK +     K++Q K  L     RE+  ++ I H N
Sbjct: 77  KTLGKGSSGRVRLAKNMETGKLSAIKIVPKKFVKSNQIKQ-LPYGIEREIIIMKLISHPN 135

Query: 65  VIELVDLFMAQENLNLVLEFLPAD--LEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRS 122
           V+ L +++  +  L LVLE++      + L+    L  ++A    +    ++ V +CH  
Sbjct: 136 VMGLYEVWENKSELYLVLEYVEGGELFDYLVSKGKLPESEA--IHYFKQIVQAVAYCHGF 193

Query: 123 FILHRDLKPNNLLLAPDGQ-LKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHY 181
            I HRDLKP NLLL    + +KIADFG+A  L    + + ++  +  Y +PE++ G +++
Sbjct: 194 NICHRDLKPENLLLDKKKRSIKIADFGMA-ALETSDKLLETSCGSPHYASPEIVLGRKYH 252

Query: 182 TAAVDLWSVGVIFAELMLRIPYLPGRDD 209
            +  D+WS G+I   L+    +LP  DD
Sbjct: 253 GSPSDVWSCGIILFALL--TGHLPFNDD 278

>AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH]
           (1044971..1047679) [2709 bp, 902 aa]
          Length = 902

 Score = 89.0 bits (219), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 106/199 (53%), Gaps = 9/199 (4%)

Query: 5   NYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHAN 64
           +Y  ++ +G+G Y VVY    +   + IAIK I+    +       + E+  L+ ++H N
Sbjct: 18  HYALKQVIGKGAYGVVYKAVNRATDQVIAIKAIEYENEE--ELHEHMLEIDLLKNLKHEN 75

Query: 65  VIELVDLFMAQENLNLVLEF-LPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSF 123
           +++      +   L ++LE+ +   L  LIK  +L  ++A  K+++  TLRG+ + H   
Sbjct: 76  IVKYHGFIQSSHELYILLEYCIRGSLRDLIKKEAL--SEAKAKTYVRQTLRGLQYLHDQG 133

Query: 124 ILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTA 183
           ++HRD+K  NLLL  +G +K+ADFG++  +   +  MT      W  APE++ G    T 
Sbjct: 134 VIHRDIKAANLLLTENGVVKLADFGVSTRVN--NMAMTYAGSPNWM-APEVMLGKGASTV 190

Query: 184 AVDLWSVGVIFAELMLRIP 202
           + D+WS+G    EL+   P
Sbjct: 191 S-DIWSLGATVVELLTGNP 208

>Scas_711.25
          Length = 1515

 Score = 89.0 bits (219), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 62/203 (30%), Positives = 115/203 (56%), Gaps = 15/203 (7%)

Query: 6    YTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQF--KDGLDMSAIR----EVKYLQE 59
            + K + +G+G++  VYL    T G  +A+K+++  ++  +D   +S +     EV  L++
Sbjct: 1214 WMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQDEAIISTVEALRSEVSTLKD 1273

Query: 60   IRHANVIELVDLFMAQENL-NLVLEFLPA-DLEMLIKDSSLLFTQADIKSWLLMTLRGVH 117
            + H N+++ +  F  ++N+ +L LE++    +  LI+     F +  I+      LRG+ 
Sbjct: 1274 LDHLNIVQYLG-FENKDNIYSLFLEYVAGGSVGSLIRMYGR-FDEPLIRHLNTQVLRGLA 1331

Query: 118  HCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTR---WYRAPEL 174
            + H   ILHRD+K +NLLL  DG  KI+DFG++R   +   +  S++  R   ++ APE+
Sbjct: 1332 YLHSRGILHRDMKADNLLLDQDGVCKISDFGISRK--SKDIYSNSDMTMRGTVFWMAPEM 1389

Query: 175  LFGARHYTAAVDLWSVGVIFAEL 197
            +   + Y+A VD+WS+G I  E+
Sbjct: 1390 VDTKQGYSAKVDIWSLGCIVLEM 1412

>KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20 ser/thr protein
           kinase of the pheromone pathway, hypothetical start
          Length = 989

 Score = 89.0 bits (219), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 106/197 (53%), Gaps = 9/197 (4%)

Query: 11  KVGEGTYAVVYLGHRQTDGRQIAIKEIK-TSQFKDGLDMSAIREVKYLQEIRHANVIELV 69
           K+G+G    VY  +       +AIK++    Q K  L    + E+  ++  +H N++  +
Sbjct: 703 KIGQGASGGVYTAYELGTNASVAIKQMNLEKQPKKEL---IVNEILVMKGSKHNNIVNFI 759

Query: 70  DLFMAQENLNLVLEFLPA-DLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFILHRD 128
           D ++ + +L +V+E++    L  ++  +  + T+  I +    TL+G+   H   ++HRD
Sbjct: 760 DSYLFRGDLWVVMEYMEGGSLTDVV--THCILTEGQIGAVSRETLKGLQFLHSKGVIHRD 817

Query: 129 LKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAAVDLW 188
           +K +N+LL+ +G +K+ DFG    +   +   T+ V T ++ APE++   + Y   VD+W
Sbjct: 818 IKSDNILLSMNGDIKLTDFGFCAQINEVNLKRTTMVGTPYWMAPEVV-SRKEYGPKVDIW 876

Query: 189 SVGVIFAELML-RIPYL 204
           S+G++  E++    PYL
Sbjct: 877 SLGIMIIEMIEGEPPYL 893

>ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)
           [2016 bp, 671 aa]
          Length = 671

 Score = 88.6 bits (218), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 72/243 (29%), Positives = 116/243 (47%), Gaps = 18/243 (7%)

Query: 3   AVNYTKEKKV-GEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGL-DMSAIREVKYL--Q 58
           A  Y K  KV G G    V +  R +DGR  A+K+ +  +  + + D +     +Y+   
Sbjct: 113 AQKYGKLGKVLGSGAGGSVKVLVRPSDGRTFAVKQFRPRRPGESVKDYARKCTSEYMIGS 172

Query: 59  EIRHANVIELVDLFM--AQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGV 116
            + H NVIE +D+F    Q     V+E+ P D   ++    +  ++ +I       + GV
Sbjct: 173 MLHHPNVIETLDVFSNSKQNQYYEVMEYCPVDFFAVVMSGQM--SRGEINCCFKQLVEGV 230

Query: 117 HHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLA----RTLAAPHEFMTSNVVTRWYRAP 172
           ++ H     HRDLK +N ++  DG LK+ DFG A     T  A  +     V +  Y AP
Sbjct: 231 NYLHSKGYAHRDLKLDNCVMTRDGILKLIDFGSAFVFKYTYEADEKMAHGVVGSDPYLAP 290

Query: 173 ELLFGARHYTAA-VDLWSVGVIFAELML-RIPYLPGRDDVDQIDVTFRALGTPTDKDWPE 230
           E+L   + Y+A  VD+WS+G+I+  ++L R P+   R      D  F+    P D++   
Sbjct: 291 EVLTSTKSYSAPLVDIWSIGIIYCCMILKRFPWKEPR----LTDNNFKVYCMPDDQEHDY 346

Query: 231 VSS 233
           V S
Sbjct: 347 VKS 349

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
           Saccharomyces cerevisiae YKL101w
           serine/threonine-protein kinase, hypothetical start
          Length = 1489

 Score = 88.6 bits (218), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 65/226 (28%), Positives = 116/226 (51%), Gaps = 32/226 (14%)

Query: 10  KKVGEGTYAVVYLGHRQTDGRQIAIKEIKTS-----------------QFKDGLDMSAI- 51
           K +  GT A + +  ++T  R++  +++KT+                   K+G D SA+ 
Sbjct: 111 KNIENGTLAAIKIVPKRTYNRRMRDQKMKTAGGVSSGTDSKDSSNREDPIKNGTD-SALN 169

Query: 52  -----REVKYLQEIRHANVIELVDLFMAQENLNLVLEFLPAD--LEMLIKDSSLLFTQAD 104
                RE+  ++ I H NV+ L++++  +  L LVLE++      + L+    L  ++ +
Sbjct: 170 PYGIEREIVIMKLISHPNVMGLLEVWENKSELYLVLEYVDGGELFDYLVSKGKL--SEPE 227

Query: 105 IKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAPDGQ-LKIADFGLARTLAAPHEFMTSN 163
              +    ++GV +CH   I HRDLKP NLLL    + +KIADFG+A  L  P++ + ++
Sbjct: 228 AVHYFTQIIQGVSYCHSFNICHRDLKPENLLLDKKNKVIKIADFGMA-ALELPNKLLETS 286

Query: 164 VVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDD 209
             +  Y +PE++ G  ++    D+WS G+I   L+    +LP  DD
Sbjct: 287 CGSPHYASPEIVMGKPYHGGPSDVWSCGIILFALL--TGHLPFNDD 330

>CAGL0C02893g complement(286017..287966) similar to tr|Q08732
           Saccharomyces cerevisiae YOR267c, hypothetical start
          Length = 649

 Score = 87.8 bits (216), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 67/227 (29%), Positives = 106/227 (46%), Gaps = 17/227 (7%)

Query: 10  KKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIR---EVKYLQEIRHANVI 66
           K +G G    V +  R TDG   A+KE +  +  + +   A +   E      + H NVI
Sbjct: 219 KLLGSGAGGSVKILTRPTDGATFAVKEFRPRKPNESVKEYAKKCTAEFCIGSSLHHPNVI 278

Query: 67  ELVDLFM--AQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFI 124
           E VD+F    Q     V+++ P D   ++    +  ++ +I   L     GV + H   +
Sbjct: 279 ETVDVFSDSKQNKYYEVMQYCPIDFFAVVMTGKM--SRGEINCCLKQLTEGVRYLHSMGL 336

Query: 125 LHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHE---FMTSNVV-TRWYRAPELLFGARH 180
            HRDLK +N ++  DG +K+ DFG A     P E    M   +V +  Y APE++   + 
Sbjct: 337 AHRDLKLDNCVMTADGIIKLIDFGSAVVFRYPFEDDVTMAHGIVGSDPYLAPEVITSTKS 396

Query: 181 YT-AAVDLWSVGVIFAELML-RIPYLPGRDDVDQIDVTFRALGTPTD 225
           Y    VD+WS+G+I+  +ML R P+   R+     D  FR    P +
Sbjct: 397 YDPQCVDIWSIGIIYCCMMLKRFPWKAPRES----DENFRLYCMPDE 439

>CAGL0K12496g 1218391..1219473 similar to sp|P43568 Saccharomyces
           cerevisiae YFL029c CAK1 cdk-activating protein kinase,
           hypothetical start
          Length = 360

 Score = 86.7 bits (213), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 60/220 (27%), Positives = 100/220 (45%), Gaps = 51/220 (23%)

Query: 63  ANVIELVDLFMAQENLNLVLEFLPADLEMLIKDS----------------------SLLF 100
           A+VI+L++      N+ L  +F P DLE  ++                        S   
Sbjct: 59  AHVIKLIEDQCKNSNIELWFKFYPIDLEDYLRSCFKPQNKFNPYYTLGEVLETSLRSSYV 118

Query: 101 TQADI----KSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAP----DGQLKIADFGLART 152
            + D+    K + L  ++G++  H+S I+HRD+KP N++L         L + DFG++  
Sbjct: 119 NEFDVNEFAKDFFLQIVKGLNFIHQSGIIHRDIKPRNIVLEKLSTGKFNLVLIDFGISYD 178

Query: 153 LAAPH-----EFMTSNVVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELM--------- 198
           +   +     +   ++V T  Y+APELLFG ++Y++AVD+W++ VI +            
Sbjct: 179 ITETNIDERPDSKITDVSTSIYKAPELLFGVKNYSSAVDIWAMLVILSNFFSLASDCKNY 238

Query: 199 ----LRIPYLPGRDDVDQIDV---TFRALGTPTDKDWPEV 231
                   Y PG +D   I +    F   G PT  +WPEV
Sbjct: 239 LSSCFDDGYRPGEEDGSDIKLIFSIFEKFGVPTANEWPEV 278

>Scas_698.37
          Length = 347

 Score = 86.3 bits (212), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 76/304 (25%), Positives = 143/304 (47%), Gaps = 31/304 (10%)

Query: 2   TAVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIR 61
           T  +Y    K+G G Y+ V+ G    +     IK +K  + +        RE+K L  + 
Sbjct: 54  TLTDYEIINKIGRGKYSEVFRGKHILNDVSCVIKVLKPVKLR-----KIHRELKILWNLT 108

Query: 62  HA-NVIELVDLFMAQENLNLVLEFLPADLEML-IKDSSLLFTQADIKSWLLMTLRGVHHC 119
              N++EL+D+    +    V  F+  D++ +  ++    F  +D++ +    L  +++ 
Sbjct: 109 GGPNIVELLDV--VHDEKTRVPAFIFEDVKNVDFRELYPTFKLSDVQYYFKQLLIALNYA 166

Query: 120 HRSFILHRDLKPNNLLLAP-DGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGA 178
           H   I+HRD+KP N+++ P   +L++ D+GLA     P       V +R+++ PELL   
Sbjct: 167 HSMGIMHRDVKPQNVMIDPVQRKLRLIDWGLAE-FYHPGVDYNVRVASRYHKGPELLTDL 225

Query: 179 RHYTAAVDLWSVGVIFAELMLRI-PYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAY 237
             Y  ++D+WSVG + A ++ +  P+  G  + DQ+    + LGT       ++ ++ A 
Sbjct: 226 NQYDYSLDMWSVGCMIAAIIFKKEPFFKGGSNPDQLVKIAKVLGT------KQLINYLAR 279

Query: 238 NKIQVYPPPSRSELR-------SRFIA-----ATENALDLMCGMLTMDPHKRWDTTRCLL 285
             + + P    + +R       S FI+     AT  A+DL+  +L  D  +R      + 
Sbjct: 280 YGLHL-PSEHDNLIRTWARKPWSHFISIETPLATPEAVDLVDNLLRYDHQERLTAEEAMN 338

Query: 286 SQYF 289
            Q+F
Sbjct: 339 HQFF 342

>Kwal_0.96
          Length = 427

 Score = 87.0 bits (214), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 99/202 (49%), Gaps = 12/202 (5%)

Query: 5   NYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSA---IREVKYLQEIR 61
           +Y   K +G G++ VV    + + G  +AIK +     K G D+       E+  LQ++ 
Sbjct: 45  DYIFGKTLGAGSFGVVRQARQVSSGENVAIKILLKKALK-GKDVELQMLYDELSILQKLD 103

Query: 62  HANVIELVDLFMAQENLNLVLEFLPAD--LEMLIKDSSLLFTQADIKSWLLMTLRGVHHC 119
           H N+++  D F +++   +V +        + ++K     FT+ D    +   L+ V + 
Sbjct: 104 HPNIVKFKDWFESKDKFYIVTQLATGGELFDRILKQGK--FTEEDAVRIVYQILKAVEYL 161

Query: 120 HRSFILHRDLKPNNLLL---APDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLF 176
           H   I+HRDLKP NLL    A D QL + DFG+A+ L    E +     +  Y APE++ 
Sbjct: 162 HSRNIVHRDLKPENLLYLTEAADSQLVLGDFGIAKELKNDDELIHKAAGSMGYVAPEVVT 221

Query: 177 GARHYTAAVDLWSVGVIFAELM 198
            + H     D+WS+GV+   L+
Sbjct: 222 TSGH-GKPCDIWSLGVVTYTLL 242

>Kwal_56.22476
          Length = 697

 Score = 87.4 bits (215), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 99/203 (48%), Gaps = 9/203 (4%)

Query: 5   NYTKEKKVGEGTYAVVYL----GHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEI 60
           +Y +   +GEG +A  +     G +    + +A   IK+ + +  L    + E++  + +
Sbjct: 78  DYHRGHFLGEGGFARCFQIKDDGGKIFAAKTVAKISIKSEKTRKKL----LSEIQIHKSM 133

Query: 61  RHANVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCH 120
           RH N+++ VD F    N+ ++LE  P    M +     + T+ +++ +    +  V + H
Sbjct: 134 RHTNIVQFVDCFEDDTNVYILLEICPNGSLMDLLKRRKMLTEPEVRFFTTQIVGAVKYMH 193

Query: 121 RSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGAR- 179
              ++HRDLK  N+       LK+ DFGLA  LA   E   +   T  Y APE+L G   
Sbjct: 194 SRRVIHRDLKLGNIFFDKHYNLKVGDFGLAAVLANDRERKYTVCGTPNYIAPEVLTGKHT 253

Query: 180 HYTAAVDLWSVGVIFAELMLRIP 202
            ++  VD+WS GV+   L++  P
Sbjct: 254 GHSYEVDIWSCGVMIYALLIGKP 276

>KLLA0E01584g 149713..150960 highly similar to sp|P39009
           Saccharomyces cerevisiae YDL101c DUN1 protein kinase,
           start by similarity
          Length = 415

 Score = 86.7 bits (213), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 67/224 (29%), Positives = 103/224 (45%), Gaps = 31/224 (13%)

Query: 6   YTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAI-REVKYLQEIRHAN 64
           Y   K++G G YA+V     +  G  +A+K     Q  D         E K L  I+H N
Sbjct: 101 YLAGKELGTGHYAIVKEARNKETGETVAVKIFHPQQNDDDKRTKKFTEETKILLSIQHPN 160

Query: 65  VIELVDLFM-----AQENLNLVLEFLPAD--LEMLIKDSSLLFTQADIKSWLLMTLRGVH 117
           +++L+D F+      Q    LVLE +      E +++ ++L   + + K+     L G+ 
Sbjct: 161 IVKLIDRFVEPVSKTQIQTYLVLEKINDGELFERIVRKNNL--REDETKALFRQLLNGLK 218

Query: 118 HCHRSFILHRDLKPNNLLLAP-------------------DGQLKIADFGLARTLAAPHE 158
           + H   I+HRD+KP N+LL+                    D Q+KIADFGLA+      +
Sbjct: 219 YLHSRNIIHRDIKPENILLSISKRRSPEEIALGPWDDDELDIQVKIADFGLAK-FTGEMK 277

Query: 159 FMTSNVVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELMLRIP 202
           F  +   T  Y APE+L     YT+ VD+WS GV+    +   P
Sbjct: 278 FTNTLCGTPSYVAPEVLVKT-GYTSRVDMWSAGVLLYVCLCGFP 320

>Kwal_55.21709
          Length = 340

 Score = 85.9 bits (211), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 64/222 (28%), Positives = 112/222 (50%), Gaps = 12/222 (5%)

Query: 5   NYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHA- 63
           +Y    K+G G Y+ V+ G    +     IK +K  +          RE+K L  +    
Sbjct: 49  HYEIVNKIGRGKYSEVFRGKCVVNDEYCVIKVLKPVK-----LKKIYRELKILTNLTGGP 103

Query: 64  NVIELVDLFMAQENLNLVLEFLPADLEML-IKDSSLLFTQADIKSWLLMTLRGVHHCHRS 122
           NVI L+D+   Q++ + +   +  +++ +  +   L FT  DI+ +    L  + +CH  
Sbjct: 104 NVIALLDI--VQDSGSKIPALIFEEVKNVDFRTLYLKFTLPDIQYYFSQLLIALDYCHSM 161

Query: 123 FILHRDLKPNNLLLAP-DGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHY 181
            I+HRD+KP N+++ P + +L++ D+GLA     P       V +R+++ PELL     Y
Sbjct: 162 GIMHRDVKPQNVMIDPVERKLRLIDWGLAE-FYHPGVDYNVRVASRYHKGPELLVNLNQY 220

Query: 182 TAAVDLWSVGVIFAELMLRI-PYLPGRDDVDQIDVTFRALGT 222
             ++DLWSVG + A ++ +  P+  G  + DQ+    R LGT
Sbjct: 221 DYSLDLWSVGCMLAAIVFKKEPFFKGSTNPDQLVKIARVLGT 262

>KLLA0F11143g complement(1026129..1028570) similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 813

 Score = 87.0 bits (214), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 59/204 (28%), Positives = 102/204 (50%), Gaps = 15/204 (7%)

Query: 12  VGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHANVIELVDL 71
           VG+G +A V     ++ G+  A+K I   +  D  D    RE+  LQ++ H  +++L D 
Sbjct: 198 VGQGAFATVKKAVERSTGKTFAVKIIHKRKVMDKFD-GVKRELDVLQKLNHPRIVKLKDF 256

Query: 72  FMAQENLNLVLEFLP-ADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFILHRDLK 130
           F   +N  +++EF+   DL   +     +   A  +      L  V + H   I HRDLK
Sbjct: 257 FEDNDNYYMLMEFVSGGDLMDFVAAHGTVGEDAG-REITRQVLEAVKYMHDQGISHRDLK 315

Query: 131 PNNLLLAPDGQ--LKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARH-------- 180
           P+N+++  D    +KI DFGLA+ +   + F+ +   T  Y APE++ G           
Sbjct: 316 PDNIMIEQDDPVLIKITDFGLAK-VQNQNTFLNTFCGTLAYVAPEVIDGKNAEDKTNRDL 374

Query: 181 YTAAVDLWSVG-VIFAELMLRIPY 203
           Y++ VD+WS+G +++  L   +P+
Sbjct: 375 YSSLVDMWSIGCLVYVILTGHLPF 398

>Kwal_26.7788
          Length = 1267

 Score = 87.0 bits (214), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 104/205 (50%), Gaps = 10/205 (4%)

Query: 10  KKVGEGTYAVVYLGHRQTDGRQIAIKEI-KTSQFKDG-LDMSAIREVKYLQEIRHANVIE 67
           K +G+G+   V L      G+  AIK + KT   + G L     RE+  ++ I H NV+ 
Sbjct: 62  KTLGKGSSGRVRLAKNMETGKLAAIKIVPKTKSSRTGSLPYGIEREIIIMKLISHPNVMG 121

Query: 68  LVDLFMAQENLNLVLEFLPAD--LEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFIL 125
           L +++  +  L LVLE++      + L+    L   +A    +    + G  +CH   I 
Sbjct: 122 LYEVWENKLELFLVLEYVDGGELFDYLVSRGRLPEKEA--IHYFRQIIEGTAYCHGFNIC 179

Query: 126 HRDLKPNNLLL-APDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAA 184
           HRDLKP NLLL   + ++KIADFG+A  L   ++ + ++  +  Y +PE++ G  +    
Sbjct: 180 HRDLKPENLLLDKKNKRIKIADFGMA-ALQTSNKLLETSCGSPHYASPEIVMGKNYNGGP 238

Query: 185 VDLWSVGVIFAELMLRIPYLPGRDD 209
            D+WS G+I   L+    +LP  DD
Sbjct: 239 SDVWSCGIILFALL--TGHLPFNDD 261

>KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, start by similarity
          Length = 427

 Score = 86.3 bits (212), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 99/205 (48%), Gaps = 18/205 (8%)

Query: 5   NYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIR------EVKYLQ 58
           +Y   K +G GT+ VV      + G  +A+K +     K  L   +++      E+  LQ
Sbjct: 45  DYIFGKTLGAGTFGVVRQARCISSGENVAVKIL----LKKALKGQSVQLQMLYDELSILQ 100

Query: 59  EIRHANVIELVDLFMAQENLNLVLEFLPAD--LEMLIKDSSLLFTQADIKSWLLMTLRGV 116
           ++ H N++   D F ++E   +V +        + +++     F + D    +   L+GV
Sbjct: 101 QLNHPNIVRFKDWFESKEKFYIVTQLATGGELFDRILEKGK--FCEVDAVFIVKQILQGV 158

Query: 117 HHCHRSFILHRDLKPNNLLL---APDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPE 173
            + H+  I+HRDLKP N+L    + D  L I DFG+A+ L   +E +     +  Y APE
Sbjct: 159 QYLHQRNIVHRDLKPENILYLNKSDDSPLVIGDFGIAKELKDDNELIHKAAGSMGYVAPE 218

Query: 174 LLFGARHYTAAVDLWSVGVIFAELM 198
           +L  + H     D+WS+GVI   L+
Sbjct: 219 VLTSSGH-GKPCDIWSIGVITYTLL 242

>Scas_707.3
          Length = 1598

 Score = 86.7 bits (213), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 58/163 (35%), Positives = 88/163 (53%), Gaps = 5/163 (3%)

Query: 2   TAVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIR 61
           T  +YT  K + +G Y  VYL  ++  G   AIK +K S       ++ ++  + +  ++
Sbjct: 695 TIKDYTILKPISKGAYGSVYLARKKITGDYFAIKVLKKSDMIAKNQVTNVKSERAIMMVQ 754

Query: 62  HAN--VIELVDLFMAQENLNLVLEFLPA-DLEMLIKDSSLLFTQADIKSWLLMTLRGVHH 118
                V  L   F  +ENL LV+E+LP  DL  LIK    L  Q  +K +L   + GV  
Sbjct: 755 SDKPYVARLFATFQNKENLFLVMEYLPGGDLATLIKMMGYLPDQW-VKQYLTEIIVGVDD 813

Query: 119 CHRSFILHRDLKPNNLLLAPDGQLKIADFGLART-LAAPHEFM 160
            HR++I+H DLKP+NLL+   G +K+ DFGL+R  L   H+F+
Sbjct: 814 MHRNWIIHHDLKPDNLLIDNLGHVKLTDFGLSRAGLIHRHKFV 856

>Scas_644.15
          Length = 726

 Score = 86.3 bits (212), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 63/226 (27%), Positives = 106/226 (46%), Gaps = 6/226 (2%)

Query: 5   NYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEI-KTSQFKDGLDMSAIREVKYLQEIRHA 63
           +Y +   +GEG +A  +   +   G+  A K + K S   +      + E++  + ++H 
Sbjct: 91  DYRRGHFLGEGGFARCF-QIKDESGKIFAAKTVAKISIKTEKTKKKLLSEIQIHKSMKHP 149

Query: 64  NVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSF 123
           N++  VD F    N+ ++LE       M +       T+ +++ +       V + H   
Sbjct: 150 NIVHFVDCFEDDTNVYILLEICSNGSLMDLMKKRKTLTEPEVRFFTTQICGAVKYMHSRR 209

Query: 124 ILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGAR-HYT 182
           ++HRDLK  N+    D  LK+ DFGLA  LA   E   +   T  Y APE+L G    ++
Sbjct: 210 VIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANNRERKYTVCGTPNYIAPEVLMGKHAGHS 269

Query: 183 AAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRAL--GTPTDK 226
             VD+WS+GV+   L++  P    + DV+ I    +A   G P DK
Sbjct: 270 FEVDIWSIGVMIYALLVGKPPFQAK-DVNVIYDRIKACQYGYPKDK 314

>Kwal_26.8941
          Length = 661

 Score = 86.3 bits (212), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 71/250 (28%), Positives = 113/250 (45%), Gaps = 18/250 (7%)

Query: 3   AVNYTKEKKV-GEGTYAVVYLGHRQTDGRQIAIKEIKT---SQFKDGLDMSAIREVKYLQ 58
           A  Y K  K+ G G    V +  R +DG   A+KE +    ++           E     
Sbjct: 127 AQKYGKLGKILGSGAGGSVRVIVRPSDGATFAVKEFRPRRPTELAKDYAKKCTAEFCIGS 186

Query: 59  EIRHANVIELVDLF--MAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGV 116
            + H NVIE +D+F    Q     V+E+ P D   ++   ++  ++ +I   L     GV
Sbjct: 187 TLHHPNVIETLDIFSDAKQNKYYEVMEYCPIDFFAVVMSGNM--SRGEINCCLRQLSEGV 244

Query: 117 HHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEF---MTSNVV-TRWYRAP 172
            + H   + HRDLK +N ++  DG LK+ DFG A     P +    M   +V +  Y AP
Sbjct: 245 RYLHNMGLAHRDLKLDNCVMTCDGILKLIDFGSAVVFKYPFDSSVTMAHGIVGSDPYLAP 304

Query: 173 ELLFGARHYTAA-VDLWSVGVIFAELML-RIPYLPGRDDVDQIDVTFRALGTPTDKDWPE 230
           E++   + Y    VD+WS+G+I+  +ML R P+   ++  D     FR    P D +   
Sbjct: 305 EVMTSTKRYDPQFVDIWSIGIIYCCMMLKRFPWKTPKESDDN----FRLFCLPDDVEHDY 360

Query: 231 VSSFSAYNKI 240
           V S   + K+
Sbjct: 361 VKSAREHEKL 370

>YIL035C (CKA1) [2632] chr9 complement(287789..288907) Casein kinase
           II (protein kinase CK2), catalytic (alpha) subunit [1119
           bp, 372 aa]
          Length = 372

 Score = 85.1 bits (209), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/166 (30%), Positives = 89/166 (53%), Gaps = 10/166 (6%)

Query: 62  HANVIELVDLFM--AQENLNLVLEFLP-ADLEMLIKDSSLLFTQADIKSWLLMTLRGVHH 118
           HAN+I L D+      +   LV E++   D  +L        T  +I+ ++   L+ + +
Sbjct: 130 HANIIHLFDIIKDPISKTPALVFEYVDNVDFRILYPK----LTDLEIRFYMFELLKALDY 185

Query: 119 CHRSFILHRDLKPNNLLL-APDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFG 177
           CH   I+HRD+KP+N+++   + +L++ D+GLA       E+    V +R+++ PELL  
Sbjct: 186 CHSMGIMHRDVKPHNVMIDHKNKKLRLIDWGLAEFYHVNMEY-NVRVASRFFKGPELLVD 244

Query: 178 ARHYTAAVDLWSVGVIFAELML-RIPYLPGRDDVDQIDVTFRALGT 222
            R Y  ++DLWS G + A ++  R P+  G  + DQ+    + LGT
Sbjct: 245 YRMYDYSLDLWSFGTMLASMIFKREPFFHGTSNTDQLVKIVKVLGT 290

>Scas_618.8
          Length = 427

 Score = 85.5 bits (210), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 103/209 (49%), Gaps = 18/209 (8%)

Query: 1   MTAVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIR------EV 54
           +T  +Y   K +G G++ VV    ++++  ++AIK +     K  L+ + ++      E+
Sbjct: 22  VTKSDYEFGKTLGAGSFGVVREATKKSNNEEVAIKIL----LKKALEGNQVQLQMLYDEL 77

Query: 55  KYLQEIRHANVIELVDLFMAQENLNLVLEFLPAD--LEMLIKDSSLLFTQADIKSWLLMT 112
             L+++ H N++E  + F   + + +V +        + +IK     F++ D    L+  
Sbjct: 78  TILKKLHHPNIVEFKNWFETDDKIYIVTQLATGGELFDRIIKKGR--FSEDDAVKILIQI 135

Query: 113 LRGVHHCHRSFILHRDLKPNNLLL---APDGQLKIADFGLARTLAAPHEFMTSNVVTRWY 169
           L  V + H   I+HRDLKP NLL      D +L IADFG+A+ L    + +     +  Y
Sbjct: 136 LSAVEYIHSRDIVHRDLKPENLLYLTEKEDSELVIADFGIAKELKKGEQLIFKAAGSLGY 195

Query: 170 RAPELLFGARHYTAAVDLWSVGVIFAELM 198
            APE+L    H     D+WS+GVI   L+
Sbjct: 196 VAPEVLTVDGH-GKPCDIWSIGVITYTLL 223

>KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication, start by similarity
          Length = 708

 Score = 85.9 bits (211), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 97/200 (48%), Gaps = 3/200 (1%)

Query: 5   NYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEI-KTSQFKDGLDMSAIREVKYLQEIRHA 63
           +Y +   +GEG +A  +   +   G+  A K + K S   +      + E++  + ++H 
Sbjct: 89  DYHRGHFLGEGGFARCF-QMKDDKGKVFAAKTVAKLSIKSEKTRRKLLSEIQIHKSMKHP 147

Query: 64  NVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSF 123
           N+++  D F    N+ ++LE  P    M +       T+ +++  ++  +  + + H   
Sbjct: 148 NIVQFTDCFEDDTNVYILLEICPNGSVMELLRQRKHLTEPEVRFCMIQIIGAIRYMHSRR 207

Query: 124 ILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGAR-HYT 182
           ++HRDLK  N+    +  LKI DFGLA  LA   E   +   T  Y APE+L G    ++
Sbjct: 208 VIHRDLKLGNIFFDKEYNLKIGDFGLAAVLANDKERKYTICGTPNYIAPEVLTGKHTGHS 267

Query: 183 AAVDLWSVGVIFAELMLRIP 202
             VD+WS+GV+   L+   P
Sbjct: 268 YEVDIWSIGVMLYALLFGKP 287

>CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, hypothetical start
          Length = 442

 Score = 85.5 bits (210), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 63/207 (30%), Positives = 100/207 (48%), Gaps = 14/207 (6%)

Query: 1   MTAVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSA---IREVKYL 57
           ++  NY   K +G GT+ VV           +A+K +     K G D+       E+  L
Sbjct: 40  VSKSNYVFGKTLGAGTFGVVRQARYSPTNEDVAVKILLKKALK-GNDVQLQMLYDELSIL 98

Query: 58  QEIRHANVIELVDLFMAQENLNLVLEF-LPADL--EMLIKDSSLLFTQADIKSWLLMTLR 114
           Q ++H N++E  D F +++   +V +  +  +L   +L K     FT+ D  S  +  L 
Sbjct: 99  QMLKHPNIVEFKDWFESKDKFYIVTQLAVGGELFDRILAKGK---FTERDAVSITMQILS 155

Query: 115 GVHHCHRSFILHRDLKPNNLLL---APDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRA 171
            V + H   ++HRDLKP N+L    + D QL IADFG+A+ L    + +     +  Y A
Sbjct: 156 AVDYMHSKNVVHRDLKPENVLYIDKSDDSQLVIADFGIAKQLQDNDDLIFKAAGSLGYVA 215

Query: 172 PELLFGARHYTAAVDLWSVGVIFAELM 198
           PE+L    H     D+WS+GVI   L+
Sbjct: 216 PEVLTNNGH-GKPCDIWSIGVIVYTLL 241

>YDL025C (YDL025C) [836] chr4 complement(405341..407203)
           Serine/threonine protein kinase with similarity to
           members of the NPR1 subfamily [1863 bp, 620 aa]
          Length = 620

 Score = 85.9 bits (211), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 61/204 (29%), Positives = 99/204 (48%), Gaps = 16/204 (7%)

Query: 10  KKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKD-GLDMSAI--------REVKYLQEI 60
           +K+GEG    V +  R TDG+  A K  +     + G + S +         E      +
Sbjct: 306 RKLGEGASGSVSVVER-TDGKLFACKMFRKPHLNNEGTNQSQLANYSKKVTTEFCIGSTL 364

Query: 61  RHANVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCH 120
            H N++E +D+    +   LV+E+ P D   L+   S L TQ ++  +      GV++ H
Sbjct: 365 HHENIVETLDMLTEGDTYLLVMEYAPYDFFNLVM--SNLMTQDEVNCYFKQLCHGVNYLH 422

Query: 121 RSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHE--FMTSN--VVTRWYRAPELLF 176
              + HRDLK +N ++  DG LK+ DFG A     P+E   + S+  V +  Y APELL 
Sbjct: 423 SMGLAHRDLKLDNCVVTKDGILKLIDFGSAVVFQYPYEDTIVKSHGIVGSDPYLAPELLK 482

Query: 177 GARHYTAAVDLWSVGVIFAELMLR 200
              +     D+WS+ +IF  ++L+
Sbjct: 483 QTSYDPRVADVWSIAIIFYCMVLK 506

>Scas_713.7
          Length = 983

 Score = 85.9 bits (211), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 56/201 (27%), Positives = 104/201 (51%), Gaps = 7/201 (3%)

Query: 3   AVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRH 62
           +V Y  ++ +G+G+Y VVY    +   + +AIKE+      + +++  + E+  L+ + H
Sbjct: 23  SVQYQLKQVIGKGSYGVVYKAVNKKTLQIVAIKEVNYDNDDELIEI--MTEIDLLKNLNH 80

Query: 63  ANVIELVDLFMAQENLNLVLEFLP-ADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHR 121
            N+++         NL ++LEF     L+ L+        + D K ++  TL G+ + H 
Sbjct: 81  VNIVKYHGFIQKSSNLYIILEFCSKGSLKNLLTGYKDGIPELDAKVYIRQTLNGLVYLHE 140

Query: 122 SFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHY 181
             ++HRD+K  NLLL  +  +K+ADFG++  ++  +  MT      W  +PE++ G R  
Sbjct: 141 QGVIHRDIKAANLLLDSNDVVKLADFGVSTKVS--NTAMTLAGSLHWM-SPEII-GNRGA 196

Query: 182 TAAVDLWSVGVIFAELMLRIP 202
           +   D+WS+G    EL+   P
Sbjct: 197 STLSDIWSLGATVVELVTGNP 217

>Scas_616.10
          Length = 1461

 Score = 85.9 bits (211), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 52/161 (32%), Positives = 89/161 (55%), Gaps = 8/161 (4%)

Query: 52  REVKYLQEIRHANVIELVDLFMAQENLNLVLEFLPAD--LEMLIKDSSLLFTQADIKSWL 109
           RE+  ++ I H NV+ L +++  +  L LVLE++      + L+    L  ++ +   + 
Sbjct: 185 REIVIMKLISHPNVMALYEVWENKSELYLVLEYVDGGELFDYLVSKGKL--SEKEAVHYF 242

Query: 110 LMTLRGVHHCHRSFILHRDLKPNNLLL-APDGQLKIADFGLARTLAAPHEFMTSNVVTRW 168
              ++GV +CH   I HRDLKP NLLL   +  +KIADFG+A  L  P++ + ++  +  
Sbjct: 243 KQIIQGVSYCHSFNICHRDLKPENLLLDKKNKSIKIADFGMA-ALELPNKLLQTSCGSPH 301

Query: 169 YRAPELLFGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDD 209
           Y +PE++ G  ++    D+WS G+I   L+    +LP  DD
Sbjct: 302 YASPEIVMGKSYHGGPSDVWSCGIILFALL--TGHLPFNDD 340

>AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C
           (CMK1) - SH] complement(358947..360308) [1362 bp, 453
           aa]
          Length = 453

 Score = 85.1 bits (209), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 97/203 (47%), Gaps = 8/203 (3%)

Query: 1   MTAVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEI 60
           +   +Y   K +G G + VV         + +AIK +     K         E+  LQ++
Sbjct: 51  VNKADYIFGKTLGAGAFGVVRQARNSKQNQNVAIKILLKRALKGNELQMLYDELSILQKL 110

Query: 61  RHANVIELVDLFMAQENLNLVLEFLPAD--LEMLIKDSSLLFTQADIKSWLLMTLRGVHH 118
            H N+++  D F ++E   +V +        + ++K     FT+ D    ++  L  V +
Sbjct: 111 DHPNIVKFKDWFESREKFYIVTQLATGGELFDRILKKGK--FTETDAVKIVVQMLTAVEY 168

Query: 119 CHRSFILHRDLKPNNLLL---APDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELL 175
            H   ++HRDLKP N+L    + + QL I+DFG+A+ L++  + +     +  Y APE+L
Sbjct: 169 MHSQNVVHRDLKPENVLYLDPSDESQLVISDFGIAKQLSSESQLIHRAAGSMGYVAPEVL 228

Query: 176 FGARHYTAAVDLWSVGVIFAELM 198
             + H     D+WS+GVI   L+
Sbjct: 229 TTSGH-GKPCDIWSLGVITYTLL 250

>CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4 ser/thr protein kinase or
           tr|Q03002 Saccharomyces cerevisiae YPL141c, start by
           similarity
          Length = 661

 Score = 85.5 bits (210), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 59/211 (27%), Positives = 93/211 (44%), Gaps = 15/211 (7%)

Query: 12  VGEGTYAVVYLG----------HRQTDGRQIAIKEIKTSQF--KDGLDMSAIREVKYLQE 59
           +GEG +  V LG           R    +Q+AIK I+          ++   RE+  L+ 
Sbjct: 50  LGEGEFGKVKLGWTRTPSTGPEQRPAVSKQVAIKLIRRDTIVKNSEKEIKIYREINALKH 109

Query: 60  IRHANVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHC 119
           + H NV+ L ++    + + +VLE+                 ++         + GV + 
Sbjct: 110 LTHPNVVRLEEVLQNSKYIGIVLEYASGGEFYKYIQRKRRLKESTACRLFAQLISGVTYM 169

Query: 120 HRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGAR 179
           H   ++HRDLK  NLLL  +  L I DFG        +E+M ++  +  Y APEL+   R
Sbjct: 170 HSKNLVHRDLKLENLLLDKNENLVITDFGFVNEFLPDNEYMKTSCGSPCYAAPELVISTR 229

Query: 180 HYTA-AVDLWSVGVIFAELMLRIPYLPGRDD 209
            Y A   D+WS G+I   ++    YLP  DD
Sbjct: 230 PYVARKADVWSCGIILYAMLAG--YLPWDDD 258

>CAGL0L03520g complement(401103..405446) similar to sp|Q01389
            Saccharomyces cerevisiae YJL095w BCK1, start by
            similarity
          Length = 1447

 Score = 85.5 bits (210), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 57/203 (28%), Positives = 111/203 (54%), Gaps = 15/203 (7%)

Query: 6    YTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQF-------KDGLDMSAIREVKYLQ 58
            + K + +G+G++  VYL    T G  +A+K+++  ++       KD ++ +   EV  L+
Sbjct: 1151 WMKGEMIGKGSFGAVYLSLNITTGEMMAVKQVEVPKYGTQNELVKDMVE-ALKSEVATLK 1209

Query: 59   EIRHANVIELVDLFMAQENLNLVLEFLPA-DLEMLIKDSSLLFTQADIKSWLLMTLRGVH 117
            ++ H N+++ +   +     +L LE++    +  LI+     F +  I+      L G+ 
Sbjct: 1210 DLDHLNIVQYLGSEIRGNIYSLFLEYVAGGSVGSLIRLYGR-FDEKLIRHLNTQVLSGLK 1268

Query: 118  HCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTR---WYRAPEL 174
            + H   ILHRD+K +NLLL  DG  KI+DFG+++   + + +  S++  R   ++ APE+
Sbjct: 1269 YLHSKGILHRDMKADNLLLDEDGICKISDFGISKK--SKNIYSNSDMTMRGTVFWMAPEM 1326

Query: 175  LFGARHYTAAVDLWSVGVIFAEL 197
            +   + Y+A VD+WS+G +  E+
Sbjct: 1327 VDTKQGYSAKVDIWSLGCVVLEM 1349

>CAGL0K01661g complement(146952..148400) some similarities with
           tr|Q12100 Saccharomyces cerevisiae YDL025c, hypothetical
           start
          Length = 482

 Score = 84.7 bits (208), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 61/205 (29%), Positives = 103/205 (50%), Gaps = 22/205 (10%)

Query: 10  KKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEI--------- 60
           KK+GEG    V +  ++++G+Q A+K  +TS      + +  +  KY ++I         
Sbjct: 183 KKIGEGASGSVSIV-KKSNGQQYAVKMFRTSP-----NSTQEQIEKYCKKITAEFCMGST 236

Query: 61  -RHANVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHC 119
             HANVIE  D+     +L +V+E+ P D   L+  +++  +  +I  +      GV++ 
Sbjct: 237 LHHANVIETFDIIREGNSLLMVMEYAPYDFFDLVMTNTM--SPDEISCYFKQLCHGVNYL 294

Query: 120 HRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEF----MTSNVVTRWYRAPELL 175
           H   I HRDLK +N ++  DG LK+ DFG A     P+E      T  V +  Y +PELL
Sbjct: 295 HAMGIAHRDLKLDNCVVTNDGILKLIDFGSAVIFQYPYERNIVKATGIVGSDPYLSPELL 354

Query: 176 FGARHYTAAVDLWSVGVIFAELMLR 200
               +     D+WS+ +I+  + L+
Sbjct: 355 EMNHYDPRLADVWSLAIIYYCMTLK 379

>Scas_704.50
          Length = 369

 Score = 84.0 bits (206), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 51/166 (30%), Positives = 89/166 (53%), Gaps = 10/166 (6%)

Query: 62  HANVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLF---TQADIKSWLLMTLRGVHH 118
           H N+I+L D+     +    L F   D      D  +L+   T  DI+ ++   L+ + +
Sbjct: 130 HKNIIQLFDIIKDPISKTPALVFEHVD----NIDFRVLYPKLTDMDIRYYMFELLKALDY 185

Query: 119 CHRSFILHRDLKPNNLLL-APDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFG 177
           CH   I+HRD+KP+N+++   + +L++ D+GLA    A  E+    V +R+++ PELL  
Sbjct: 186 CHSMGIMHRDVKPHNVMIDHKNKKLRLIDWGLAEFYHANMEY-NVRVASRFFKGPELLVD 244

Query: 178 ARHYTAAVDLWSVGVIFAELML-RIPYLPGRDDVDQIDVTFRALGT 222
            R Y  ++DLWS G + A ++  + P+  G  + DQ+    R LG+
Sbjct: 245 YRMYDYSLDLWSFGTMLASMVFQKEPFFHGTSNTDQLVKIVRVLGS 290

>KLLA0A06820g complement(615686..618004) some similarities with
           sp|P38970 Saccharomyces cerevisiae YJL165c HAL5 ser/thr
           protein kinase, hypothetical start
          Length = 772

 Score = 85.1 bits (209), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 67/228 (29%), Positives = 98/228 (42%), Gaps = 42/228 (18%)

Query: 12  VGEGTYAVVYLGHRQTDGRQ---------------IAIKEIK--------------TSQF 42
           +G+G Y VV L ++  D  +                A+KE+K              TS+F
Sbjct: 460 IGQGAYGVVKLCYKFIDPDEPDLKDNTYFHDNKLFYAVKELKPRPDEPPKKFSTRLTSEF 519

Query: 43  KDGLDMSAIREVKYLQEIRHANVIELVDLFMAQENLNLVLEFLPA-DLEMLI-----KDS 96
             GL +S   + +      H N++ ++DL         V+EF P+ DL  LI      DS
Sbjct: 520 VIGLSLSGGNKSRRSSARTHPNILNVIDLMQTPNAFYEVMEFCPSGDLYSLITRSSKSDS 579

Query: 97  SLLFTQADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAP 156
            L   +AD   ++   L G+ + H   + H D+KP NLL  P G LKI DFG +      
Sbjct: 580 VLHPLEADC--FMKQLLHGIQYMHAHGVAHCDIKPENLLFLPTGVLKICDFGTSSVFQTA 637

Query: 157 HE----FMTSNVVTRWYRAPELLFGARHYTAA-VDLWSVGVIFAELML 199
            E    F T    +  Y APE     + Y    VD WS G+I+  ++L
Sbjct: 638 WEKKAHFQTGPAGSEPYVAPEEFIPKQQYDPRLVDCWSCGIIYCVMVL 685

>CAGL0I05192g complement(493635..494756) highly similar to sp|P15790
           Saccharomyces cerevisiae YIL035c CKA1 casein kinase II,
           start by similarity
          Length = 373

 Score = 83.6 bits (205), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 76/327 (23%), Positives = 140/327 (42%), Gaps = 68/327 (20%)

Query: 5   NYTKEKKVGEGTYAVVYLGHRQTDGRQIAI------------------------------ 34
           +Y  E KVG G Y+ V+ G +    + I I                              
Sbjct: 39  DYEIEMKVGRGKYSEVFQGVQLASRKHIVIKMLKPVKKKKIRREIKILTNLSNEKNPPTA 98

Query: 35  KEIKTSQFKDGLDMSAIREVK-YLQEI---RHANVIELVDLFM--AQENLNLVLEFLPA- 87
           +E     +    D + +++++ Y+ E+    H N+I+L D+          LV E +   
Sbjct: 99  QEFNRDLYFSNRDENILKQIRPYIYELPHHGHENIIQLFDVIRDPISRTPALVFEHVNNM 158

Query: 88  DLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLL-APDGQLKIAD 146
           D  +L        +  DI+ ++   L+ + +CH   I+HRD+KP+N+++     +L++ D
Sbjct: 159 DFRVLYPK----LSDIDIRYYMFELLKALDYCHSMGIMHRDVKPHNVMIDHKQRKLRLID 214

Query: 147 FGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELML-RIPYLP 205
           +GLA       E+    V +R+++ PELL   R Y  ++DLWS G + A ++  + P+  
Sbjct: 215 WGLAEFYHVNMEY-NVRVASRFFKGPELLVDYRMYDYSLDLWSFGTMLASMIFQKEPFFH 273

Query: 206 GRDDVDQIDVTFRALGTPTDKDWPEVSSFSAY-NKIQVYPPPSRSEL------------- 251
           G  + DQ+    R LG+           F  Y  K Q+  P    ++             
Sbjct: 274 GTSNTDQLVKIVRVLGS---------DDFEKYLIKYQITLPREFHDMDQYIRRPWYRFVN 324

Query: 252 -RSRFIAATENALDLMCGMLTMDPHKR 277
            ++R ++  E+ +DL+  +L  D  +R
Sbjct: 325 DQNRHLSDNEDVIDLLDNLLRYDHQER 351

>Scas_700.34
          Length = 864

 Score = 84.7 bits (208), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 61/216 (28%), Positives = 95/216 (43%), Gaps = 15/216 (6%)

Query: 12  VGEGTYAVVYLG------HRQTDG----RQIAIKEIK--TSQFKDGLDMSAIREVKYLQE 59
           +GEG +  V LG         + G    +Q+AIK I+  T       ++   RE+  L+ 
Sbjct: 54  LGEGEFGKVKLGWPKNSLPSSSSGIDVPKQVAIKLIRRDTISKDSSKEIKIYREINALKH 113

Query: 60  IRHANVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHC 119
           + H N+++L ++    + + +VLE+                 +          + GVH+ 
Sbjct: 114 LTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQRKKRLKEGPACRLFAQLINGVHYI 173

Query: 120 HRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGAR 179
           H   ++HRDLK  NLLL     L I DFG      +  E M ++  +  Y APEL+   +
Sbjct: 174 HSKGLVHRDLKLENLLLDKHENLIITDFGFVSEFYSHGELMKTSCGSPCYAAPELVVSTK 233

Query: 180 HYTA-AVDLWSVGVIFAELMLRIPYLPGRDDVDQID 214
            Y A   D+WS GVI   ++    YLP  DD    D
Sbjct: 234 PYEAKKADIWSCGVILYAMLAG--YLPWDDDAGNPD 267

>Kwal_47.18098
          Length = 374

 Score = 83.6 bits (205), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 90/173 (52%), Gaps = 4/173 (2%)

Query: 52  REVKYLQEIRHANVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLM 111
           +EV  L    H N+I+L+D+     +    L F   D  +  +     F   DI+ ++  
Sbjct: 120 QEVYELAHDGHKNIIQLLDVVKDHVSKTPALVFEHVD-NIDFRTLYPTFQDLDIRYYMFE 178

Query: 112 TLRGVHHCHRSFILHRDLKPNNLLL-APDGQLKIADFGLARTLAAPHEFMTSNVVTRWYR 170
            L+ + +CH   I+HRD+KP+N+++     +L++ D+GLA     P+      V +R+++
Sbjct: 179 LLKALDYCHSMGIMHRDVKPHNVMIDHKRKKLRLIDWGLAE-FYHPNMEYNVRVASRFFK 237

Query: 171 APELLFGARHYTAAVDLWSVGVIFAELML-RIPYLPGRDDVDQIDVTFRALGT 222
            PELL   R Y  ++DLWS G + A ++  + P+  G  + DQ+    R LG+
Sbjct: 238 GPELLVDYRMYDYSLDLWSFGTMLASMIFQKEPFFHGTSNTDQLVKIVRVLGS 290

>Kwal_33.13984
          Length = 649

 Score = 84.7 bits (208), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 66/226 (29%), Positives = 110/226 (48%), Gaps = 25/226 (11%)

Query: 12  VGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIR-------HAN 64
           +G+GT+  V           +A+K +K+   K      +I E K L+ +          +
Sbjct: 284 LGQGTFGQVVKCQNLLTKEILAVKVVKS---KSEYLNQSITEAKILELLNGKIDPQGEHH 340

Query: 65  VIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLL-FTQADIKSWLLMTLRGVHHCHRSF 123
            + + + F+ + +L LV E L ++L  L+K +     + + I+++    L  +       
Sbjct: 341 FLRMHETFVHKNHLCLVFELLSSNLYELLKQNQFHGLSISLIRTFARQLLDSLCVLKEHK 400

Query: 124 ILHRDLKPNNLLLAP--DGQLKIADFGLA----RTLAAPHEFMTSNVVTRWYRAPELLFG 177
           ++H DLKP N+LL      +LK+ DFG A    RTL        + + +R+YRAPE++ G
Sbjct: 401 LIHCDLKPENILLVSLDRPELKVIDFGSACEETRTLY-------TYIQSRFYRAPEVILG 453

Query: 178 ARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTP 223
              Y+  +D+WS+G I AEL L IP  PG  + +QI      LG P
Sbjct: 454 IP-YSTGIDMWSLGCIIAELFLGIPIFPGSSEFNQITRIVDTLGLP 498

>YFR014C (CMK1) [1695] chr6 complement(172529..173869)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type I [1341 bp, 446 aa]
          Length = 446

 Score = 84.0 bits (206), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 97/200 (48%), Gaps = 10/200 (5%)

Query: 6   YTKEKKVGEGTYAVVYLGHRQTDGRQIAIK-EIKTSQFKDGLDMSAI-REVKYLQEIRHA 63
           Y   K +G GT+ VV        G  +A+K  IK +   + + + A+  E+  LQ + H 
Sbjct: 37  YVFGKTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYDELDILQRLHHP 96

Query: 64  NVIELVDLFMAQENLNLVLEFLPAD--LEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHR 121
           N++   D F +++   ++ +        + ++K     FT+ D    L+  L  V + H 
Sbjct: 97  NIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGK--FTEEDAVRILVEILSAVKYMHS 154

Query: 122 SFILHRDLKPNNLLL---APDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGA 178
             I+HRDLKP NLL    + +  L +ADFG+A+ L +  E +     +  Y APE+L   
Sbjct: 155 QNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKPAGSLGYVAPEVLTQD 214

Query: 179 RHYTAAVDLWSVGVIFAELM 198
            H     D+WS+GVI   L+
Sbjct: 215 GH-GKPCDIWSIGVITYTLL 233

>ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH]
           complement(344395..346521) [2127 bp, 708 aa]
          Length = 708

 Score = 84.0 bits (206), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 55/206 (26%), Positives = 98/206 (47%), Gaps = 3/206 (1%)

Query: 5   NYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEI-KTSQFKDGLDMSAIREVKYLQEIRHA 63
           +Y +   +GEG +A  +   +   G+  A K + K S   +      + E++  + ++H 
Sbjct: 72  DYHRGMFLGEGGFARCF-QMKDDSGKVFAAKTVAKISIKSEKTRKKLLSEIQIHKSMKHP 130

Query: 64  NVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSF 123
           N+++  D F    N+ ++LE  P    M +       T+ +++ +    +  + + H   
Sbjct: 131 NIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPEVRFFTTQIVGAIKYMHSRR 190

Query: 124 ILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGAR-HYT 182
           I+HRDLK  N+       LKI DFGLA  LA   E   +   T  Y APE+L G    ++
Sbjct: 191 IIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIAPEVLTGKHTGHS 250

Query: 183 AAVDLWSVGVIFAELMLRIPYLPGRD 208
             VD+WS+GV+   L++  P    ++
Sbjct: 251 FEVDIWSIGVMIYALLIGKPPFQAKE 276

>Kwal_33.14434
          Length = 759

 Score = 84.0 bits (206), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 62/210 (29%), Positives = 102/210 (48%), Gaps = 24/210 (11%)

Query: 6   YTKE-KKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEI---- 60
           YTK  + +G G    V L  R  D +  A+KE +T       D  A R+  Y+++I    
Sbjct: 403 YTKTGENLGAGAGGSVRLVRRTQDNKLFAVKEFRTK-----FDHEAKRD--YVKKITSEY 455

Query: 61  ------RHANVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLR 114
                 RH N+IE V++      +  V+EF   DL  ++  + + + +  I       L 
Sbjct: 456 CIGTTLRHPNIIETVEIVYDNNRILQVMEFCDYDLFAIVMSNKMSYEE--ICCCFKQILT 513

Query: 115 GVHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHE---FMTSNVV-TRWYR 170
           GV + H   + HRDLK +N ++   G +K+ DFG A   + P       +S +V +  Y 
Sbjct: 514 GVQYLHSMGLAHRDLKLDNCVINKHGVVKLIDFGAAAVFSYPFSKTLVESSGIVGSDPYL 573

Query: 171 APELLFGARHYTAAVDLWSVGVIFAELMLR 200
           APE+   +++    VD+WSV +IFA ++L+
Sbjct: 574 APEVCIFSKYDPRPVDVWSVAIIFACMVLK 603

>YGL179C (TOS3) [1812] chr7 complement(163413..165095)
           Serine/threonine protein kinase with similarity to Elm1p
           and Kin82p [1683 bp, 560 aa]
          Length = 560

 Score = 83.6 bits (205), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 65/223 (29%), Positives = 112/223 (50%), Gaps = 33/223 (14%)

Query: 12  VGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMS-------AIREVKYLQEIRHAN 64
           +G G Y  V L      G  +AIK +   + + G  +          +E++ ++   H N
Sbjct: 56  LGNGQYGKVKLARDLGTGALVAIKILNRFEKRSGYSLQLKVENPRVNQEIEVMKRCHHEN 115

Query: 65  VIELVDLFMAQENLN--LVLEFLP-------ADLEMLIKD---SSLLFTQADIKSWLLMT 112
           V+EL ++    E+    LVLE+          + +M IK    S L F Q+  +  +L  
Sbjct: 116 VVELYEILNDPESTKVYLVLEYCSRGPVKWCPENKMEIKAVGPSILTFQQS--RKVVLDV 173

Query: 113 LRGVHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLA-------APHE--FMTSN 163
           + G+ + H   I HRD+KP+NLL++ +G +KI+DFG+A + A       + HE    +  
Sbjct: 174 VSGLEYLHSQGITHRDIKPSNLLISSNGTVKISDFGVAMSTATGSTNIQSSHEQLLKSRA 233

Query: 164 VVTRWYRAPELLFGARHY--TAAVDLWSVGV-IFAELMLRIPY 203
           + T  + APEL    + Y  ++A+D+WS+GV I+  L  ++P+
Sbjct: 234 LGTPAFFAPELCSTEKEYSCSSAIDIWSLGVTIYCLLFGKLPF 276

>Scas_598.6
          Length = 790

 Score = 83.6 bits (205), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 63/216 (29%), Positives = 111/216 (51%), Gaps = 25/216 (11%)

Query: 10  KKVGEGTYAVVYLGHR---------QTD--GRQIAIKE-IKTSQFKDGLDMSAIREVKYL 57
           +K G+G    VYL  R         +T   G ++AIK+ I + Q +  L    + E+  +
Sbjct: 506 EKAGQGASGSVYLAERIAIPPGEFDETPEVGDKVAIKQMILSKQPRKEL---IVNEILVM 562

Query: 58  QEIRHANVIELVDLFMAQEN-LNLVLEFLPA-DLEMLIKDS------SLLFTQADIKSWL 109
           ++ RH N++  ++ ++  E+ L +V+EF+    L  +I++S      S   T+  I   +
Sbjct: 563 KDSRHKNIVNFLEAYLKTEDDLWVVMEFMEGGSLTDIIENSPATGSSSSPLTEPQIAYIV 622

Query: 110 LMTLRGVHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWY 169
             T +G+   H   I+HRD+K +N+LL  + ++KI DFG    L        + V T ++
Sbjct: 623 RETCQGLKFLHDKHIIHRDIKSDNVLLDNNARVKITDFGFCAKLTDQRSKRATMVGTPYW 682

Query: 170 RAPELLFGARHYTAAVDLWSVGVIFAELM-LRIPYL 204
            APE++   R Y   VD+WS+G++  E++    PYL
Sbjct: 683 MAPEVV-KQREYDEKVDVWSLGIMTIEMLESEPPYL 717

>Scas_720.94
          Length = 1683

 Score = 83.6 bits (205), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/325 (23%), Positives = 135/325 (41%), Gaps = 62/325 (19%)

Query: 3    AVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAI-----REVKYL 57
            ++ + K   +G GT+  VY      +G  +A+KEIK    +D   M  I      E+  L
Sbjct: 1358 SIRWQKRNFIGGGTFGTVYSAVNLDNGEILAVKEIK---IQDSKTMKKIFPLVKEEMTVL 1414

Query: 58   QEIRHANVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVH 117
            + + H N+++   + + ++ +N+ +E+        + +   +  +   + + L  L G+ 
Sbjct: 1415 EMLNHPNIVQYYGVEVHRDKVNIFMEYCEGGSMASLLEHGRIEDEMVTQVYTLELLEGLA 1474

Query: 118  HCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTS--------------- 162
            + H++ ++HRD+KP N+LL  +G +K  DFG AR +A     +T+               
Sbjct: 1475 YLHQAGVVHRDIKPENILLDFNGIIKYVDFGAARKIAKNGTKVTNINSKSKDDDEPDEKD 1534

Query: 163  -----NVV-----TRWYRAPELLFGARHYT--AAVDLWSVGVIFAELMLRIPYLPGRDDV 210
                 N V     T  Y APE + G ++ T   + D+WS G +  E+             
Sbjct: 1535 TEGGANSVHDMLGTPMYMAPESITGYKNKTKFGSDDIWSFGCVVLEM------------- 1581

Query: 211  DQIDVTFRALGTPTDKDWPEVSSFSAYNKIQVYPPPSRSELRSRFIAATENALDLMCGML 270
                +T R      D +W  +   +A    Q+  P   S    RF+          C  L
Sbjct: 1582 ----ITGRRPWANLDNEWAIIYHVAAGQTPQLPYPNEVSPAGRRFLQR--------C--L 1627

Query: 271  TMDPHKRWDTTRCLLSQYFVELPEA 295
              DP KR      L+  + VE+ EA
Sbjct: 1628 VQDPIKRATAVELLMDPWIVEIREA 1652

>Scas_715.34
          Length = 1150

 Score = 83.6 bits (205), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 71/262 (27%), Positives = 124/262 (47%), Gaps = 16/262 (6%)

Query: 10   KKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYL----QEIRHANV 65
            K +G+G +  V L   +  GR  AIK +K        D+ + R  K +     + +H  +
Sbjct: 827  KVLGKGNFGKVILSRSKNTGRLCAIKVLKKDNIIQNHDIESARAEKKVFLLATKTKHPFL 886

Query: 66   IELVDLFMAQENLNLVLEFLPA-DLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFI 124
              L   F  +  +   +EF+   DL   +++  L   +A  K +    L  + + H + +
Sbjct: 887  TNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQRLSVRRA--KFYAAEVLLALKYFHDNGV 944

Query: 125  LHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAA 184
            ++RDLK  N+LL P G +KIAD+GL +     +   ++   T  + APE+L   + YT A
Sbjct: 945  IYRDLKLENILLTPQGHIKIADYGLCKDEMWYNNKTSTFCGTPEFMAPEIL-KEQGYTRA 1003

Query: 185  VDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKIQVYP 244
            VD W+ GV+  +++L      G DD D++   F A+ T    D P      A + +Q++ 
Sbjct: 1004 VDWWAFGVLLYQMLLCQSPFSG-DDEDEV---FNAILT----DEPLYPIDMAGDIVQIFQ 1055

Query: 245  PPSRSELRSRFIAATENALDLM 266
                 +  +R  A   +AL++M
Sbjct: 1056 GLLTKDPENRLGAGQRDALEVM 1077

>KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732.1
            Kluyveromyces lactis protein kinase C, start by
            similarity
          Length = 1161

 Score = 83.6 bits (205), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 70/262 (26%), Positives = 121/262 (46%), Gaps = 16/262 (6%)

Query: 10   KKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYL----QEIRHANV 65
            K +G+G +  V L   +      AIK +K        D+ + R  K +     E +H  +
Sbjct: 838  KVLGKGNFGKVLLARSKNTSNLCAIKVLKKDNIIKNHDIESARAEKKVFLLATETKHPFL 897

Query: 66   IELVDLFMAQENLNLVLEFLPA-DLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFI 124
              L   F  +  +   +EF+   DL   +++  L   +A  K +    L  + + H + +
Sbjct: 898  TNLYCSFQTENRIYFAMEFIGGGDLMWHVQNRRLSVRRA--KFYAAEVLLSLKYFHDNGV 955

Query: 125  LHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAA 184
            ++RDLK  N+LL P+G +KIAD+GL +         ++   T  + APE+L G + YT A
Sbjct: 956  IYRDLKLENILLTPEGHIKIADYGLCKDNMWYGNKTSTFCGTPEFMAPEILKG-QAYTKA 1014

Query: 185  VDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKIQVYP 244
            VD W+ GV+  +++L      G D+    D  F A+ T    D P      A + +Q++ 
Sbjct: 1015 VDWWTFGVLLYQMLLCQSPFSGEDE----DEVFNAILT----DEPLYPIDMAGDIVQIFQ 1066

Query: 245  PPSRSELRSRFIAATENALDLM 266
                 +   R  A  ++AL++M
Sbjct: 1067 GLLTKDPEKRLGAGPKDALEIM 1088

>KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 843

 Score = 83.2 bits (204), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 73/278 (26%), Positives = 126/278 (45%), Gaps = 47/278 (16%)

Query: 5   NYTKEKKVGEGTYAVVYLG-HRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHA 63
           NY   K +GEG++  VYL  HR T  + +    +KT   +D    + +REV Y ++    
Sbjct: 36  NYKISKFIGEGSFGKVYLATHRLTHQKVV----LKTGNKRDP---NVVREVFYHRQFDFP 88

Query: 64  NVIELVDLFMAQENLNLVLEFLPAD--LEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHR 121
            + +L ++ + +  + +VLE+       E L+K+  L   ++  K         V++ H 
Sbjct: 89  YITKLYEVIVTESRVWMVLEYCSGHELYEHLLKEQRLSLEES--KKLFSQIASAVYYAHE 146

Query: 122 SFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHY 181
              +HRDLK  N+LL  +G  K+ DFG  R +A   +  T    T  Y APEL+    + 
Sbjct: 147 LKCVHRDLKLENVLLDGNGHAKLTDFGFTREMATRSQLETI-CGTTVYMAPELIERKCYD 205

Query: 182 TAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTD--KDWPEVSSFSAYNK 239
              VD+WS+G+I   ++    Y+P  +D D I    + +    D  ++W           
Sbjct: 206 GFKVDIWSLGIILYTMI--NGYMPFDED-DDIKTKLKIVNDELDFNQEW----------- 251

Query: 240 IQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKR 277
                              +++A+DL+ GML  +P++R
Sbjct: 252 ------------------ISDDAIDLIQGMLRKNPNER 271

>ADR313W [2054] [Homologous to ScYDL025C - SH]
           complement(1255932..1257668) [1737 bp, 578 aa]
          Length = 578

 Score = 82.8 bits (203), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 74/286 (25%), Positives = 127/286 (44%), Gaps = 35/286 (12%)

Query: 15  GTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGL---DMSAIREVKYLQEIRHANVIELVDL 71
           G+ +V+    + TDG+  A+K  +    ++ L         E      +RH N+IE +D+
Sbjct: 276 GSVSVI----KSTDGQLFAVKRFRPRAPRETLKEYSRKVTSEFCTGSTLRHQNIIETLDM 331

Query: 72  FMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFILHRDLKP 131
               E   +V+E+ P D   L+  + +  T+ ++  +     RGV + H   + HRDLK 
Sbjct: 332 LQEGELFLVVMEYCPYDFFNLVMSNQM--TKHEVWCYFKQICRGVDYLHSQGLAHRDLKL 389

Query: 132 NNLLLAPDGQLKIADFGLA----RTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAAVDL 187
           +N ++  DG LK+ DFG A        +  E     V +  Y APELL    +  +A D+
Sbjct: 390 DNCVVTADGILKLIDFGSAIIFRYNFNSKLEPAKGIVGSDPYLAPELLTQLYYDPSAADV 449

Query: 188 WSVGVIFAELML-RIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKIQVYPPP 246
           WS+ V+F  + L R P+    +DV    +  +    P D++     S   Y  +++ P  
Sbjct: 450 WSIAVMFYCMSLRRFPWKKPSEDVPSFKLFCQK---PDDEN---DHSKGPYRLLKLLPRA 503

Query: 247 SRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYFVEL 292
           +R                L+  ML +DP KR   T  +   +F+ +
Sbjct: 504 TRL---------------LISRMLELDPKKRASITEIIQDPWFLSI 534

>YHL007C (STE20) [2279] chr8 complement(95113..97932)
           Serine/threonine protein kinase of the pheromone
           response pathway, also participates in the filamentous
           growth and STE vegetative growth pathways [2820 bp, 939
           aa]
          Length = 939

 Score = 83.2 bits (204), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 63/239 (26%), Positives = 117/239 (48%), Gaps = 21/239 (8%)

Query: 3   AVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIK-TSQFKDGLDMSAIREVKYLQEIR 61
           +  Y    K+G+G    VY  +       +AIK++    Q K  L    I E+  ++  +
Sbjct: 617 STKYANLVKIGQGASGGVYTAYEIGTNVSVAIKQMNLEKQPKKEL---IINEILVMKGSK 673

Query: 62  HANVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHR 121
           H N++  +D ++ + +L +++E++     +    +  + T+  I +    TL G+   H 
Sbjct: 674 HPNIVNFIDSYVLKGDLWVIMEYMEGG-SLTDVVTHCILTEGQIGAVCRETLSGLEFLHS 732

Query: 122 SFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHY 181
             +LHRD+K +N+LL+ +G +K+ DFG    +   +   T+ V T ++ APE++   + Y
Sbjct: 733 KGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINELNLKRTTMVGTPYWMAPEVV-SRKEY 791

Query: 182 TAAVDLWSVGVIFAELML-RIPYLPGRDDVDQIDVTFRAL------GTPTDKDWPEVSS 233
              VD+WS+G++  E++    PYL         +   RAL      GTP  K+   +SS
Sbjct: 792 GPKVDIWSLGIMIIEMIEGEPPYLN--------ETPLRALYLIATNGTPKLKEPENLSS 842

>Kwal_33.13831
          Length = 700

 Score = 83.2 bits (204), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 72/227 (31%), Positives = 101/227 (44%), Gaps = 44/227 (19%)

Query: 12  VGEGTYAVVYLGHRQT----DGRQI------------AIKEIK--------------TSQ 41
           +G+G Y +V +    T    D R I            A+KE+K              TS+
Sbjct: 390 IGQGAYGIVKVCCIDTANVGDERSIDETYSNGSKMYYAVKELKPKSDEAKDKFGTRLTSE 449

Query: 42  FKDGLDMSAIREVKYLQEIRHANVIELVDLFMAQENLNLVLEFLPA-DLEMLIKDSS--- 97
           F  G  +S   E +   +  H N+++++DL    +    VLEF P+ DL  L+  +S   
Sbjct: 450 FIIGHSLS---ERETASQKPHPNILKMLDLMQTHDGFIEVLEFCPSGDLYSLLSRTSKNG 506

Query: 98  LLFTQADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPH 157
           L   +AD   ++   L GV + H   I H DLKP N+L  P G LKI DFG +       
Sbjct: 507 LHPLEADC--FMKQLLHGVKYMHDHGIAHCDLKPENILFGPQGVLKICDFGTSCVFQTAW 564

Query: 158 E----FMTSNVVTRWYRAPELLFGARHYTAA-VDLWSVGVIFAELML 199
           E    F T  V +  Y APE     R Y    VD WS GVI+  ++L
Sbjct: 565 EKQVHFQTGAVGSEPYVAPEEFIAEREYDPRLVDSWSCGVIYCTMVL 611

>KLLA0E04136g 382874..383995 similar to sp|P15790 Saccharomyces
           cerevisiae YIL035c CKA1 casein kinase II, catalytic
           alpha chain, start by similarity
          Length = 373

 Score = 82.0 bits (201), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 99/207 (47%), Gaps = 27/207 (13%)

Query: 100 FTQADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLL-APDGQLKIADFGLARTLAAPHE 158
           F+  DI+ ++   L+ + +CH   I+HRD+KP+N+++     +L++ D+GLA       E
Sbjct: 167 FSDLDIRYYMFELLKALDYCHSMGIMHRDVKPHNVMIDHKQHKLRLIDWGLAEFYHPSME 226

Query: 159 FMTSNVVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELM-LRIPYLPGRDDVDQIDVTF 217
           +    V +R+++ PELL   R Y  ++DLWS G + A ++ L+ P+  G  + DQ+    
Sbjct: 227 Y-NVRVASRFFKGPELLVDYRMYDYSLDLWSFGAMLASMVFLKEPFFYGSSNTDQLVKIV 285

Query: 218 RALGTPTDKDWPEVSSFSAY-NKIQVYPPPSRSEL--------------RSRFIAATENA 262
           R LG+           F  Y  K Q+  P    ++               ++ +   ++ 
Sbjct: 286 RVLGS---------DDFERYLQKYQITLPDEFIDMDQYIRRPWQKFVNDSNKHLCGNDDI 336

Query: 263 LDLMCGMLTMDPHKRWDTTRCLLSQYF 289
           +DL+  +L  D  +R+     +   +F
Sbjct: 337 IDLIDNLLRYDHQERFSCKEAMAHPWF 363

>Scas_700.54
          Length = 698

 Score = 82.8 bits (203), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 58/203 (28%), Positives = 102/203 (50%), Gaps = 14/203 (6%)

Query: 12  VGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHANVIELVDL 71
           VG+G +A V     ++ G+  A+K I   +    ++    RE++ LQ++ H  ++ L   
Sbjct: 229 VGQGAFATVKKAVERSTGKTFAVKIISKRKVMGNME-GVSRELEVLQQLDHPRIVRLKGF 287

Query: 72  FMAQENLNLVLEFLPA-DLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFILHRDLK 130
           +  +++  +V+EF+   DL   +     +  +A  K      L  V + H   I HRDLK
Sbjct: 288 YEDKDSYYMVMEFVSGGDLMDFVAAHGAVGEEAG-KEISRQILEAVKYIHSKGISHRDLK 346

Query: 131 PNNLLLAPDGQ--LKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGA-------RHY 181
           P+N+L+  D    +KI DFGLA+ +     FM +   T  Y APE++ G          Y
Sbjct: 347 PDNILIEQDDPVLVKITDFGLAK-VQGNGSFMKTFCGTLAYVAPEVIGGKGETNEERNEY 405

Query: 182 TAAVDLWSVG-VIFAELMLRIPY 203
           ++ VD+WS+G +++  L   +P+
Sbjct: 406 SSLVDMWSMGCLVYVILTGHLPF 428

>AEL118C [2388] [Homologous to ScYKL168C (KKQ8) - SH; ScYJL165C
           (HAL5) - SH] (399738..401789) [2052 bp, 683 aa]
          Length = 683

 Score = 82.8 bits (203), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 71/232 (30%), Positives = 103/232 (44%), Gaps = 48/232 (20%)

Query: 12  VGEGTYAVVYLGHR-----------------QTDGRQI-AIKEIK--------------T 39
           +G+G Y  V++  R                 + +G+   AIKEIK              T
Sbjct: 370 IGQGAYGTVWVTCRSLPQDNQTETHYPTETYERNGKLFYAIKEIKPRADEPNEKFSTRLT 429

Query: 40  SQFKDGLDMSA-IREVKYLQEIRHANVIELVDLFMAQENLNLVLEFLPA-DLEMLIKDSS 97
           S+F  G  +S      K L    H N+++++DL  A +    V EF P+ DL  L+  SS
Sbjct: 430 SEFVIGHSLSGGAGGTKRL--TSHPNILKVLDLMQAHDVFIEVFEFCPSGDLFSLLTRSS 487

Query: 98  LLFT-----QADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLART 152
              +     +AD   ++   L GV + H   + H DLKP N+L  P+G LK+ DFG +  
Sbjct: 488 KTGSGLHPLEADC--FMKQLLNGVRYMHDHGVAHCDLKPENILFTPNGTLKLCDFGSSSV 545

Query: 153 LAAPHE----FMTSNVVTRWYRAPELLFGARHY-TAAVDLWSVGVIFAELML 199
                E    F T  V +  Y APE     R Y T  VD WS G+I+  ++L
Sbjct: 546 FQTAWEKRVHFQTGAVGSEPYVAPEEFIPKREYDTRLVDCWSCGIIYCTMVL 597

>YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase
            kinase kinase (MAPKKK) with strong similarity to Ssk2p,
            participates in the high-osmolarity signal transduction
            pathway [3996 bp, 1331 aa]
          Length = 1331

 Score = 82.4 bits (202), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 63/252 (25%), Positives = 113/252 (44%), Gaps = 47/252 (18%)

Query: 3    AVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAI-----REVKYL 57
            ++ + K   +G GT+  VY      +G  +A+KEIK     D   M  I      E+  L
Sbjct: 1031 SMRWQKRSFIGGGTFGQVYSAINLENGEILAVKEIK---IHDTTTMKKIFPLIKEEMTVL 1087

Query: 58   QEIRHANVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVH 117
            + + H N+++   + + ++ +N+ +E+        + D   +  +   + +    L G+ 
Sbjct: 1088 EMLNHPNIVQYYGVEVHRDKVNIFMEYCEGGSLASLLDHGRIEDEMVTQVYTFELLEGLA 1147

Query: 118  HCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTL----------AAPHEF------MT 161
            + H+S ++HRD+KP N+LL  +G +K  DFG ART+          AA  +F      + 
Sbjct: 1148 YLHQSGVVHRDIKPENILLDFNGIIKYVDFGTARTVVGSRTRTVRNAAVQDFGVETKSLN 1207

Query: 162  SNVVTRWYRAPELLFGA--RHYTAAVDLWSVGVIFAELML-------------------- 199
              + T  Y APE + G+  +    A D+W++G +  E+                      
Sbjct: 1208 EMMGTPMYMAPETISGSAVKGKLGADDVWALGCVVLEMATGRRPWSNLDNEWAIMYHVAA 1267

Query: 200  -RIPYLPGRDDV 210
             RIP LP RD++
Sbjct: 1268 GRIPQLPNRDEM 1279

>Kwal_23.3590
          Length = 499

 Score = 82.0 bits (201), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 69/233 (29%), Positives = 110/233 (47%), Gaps = 49/233 (21%)

Query: 6   YTKEKKVGEGTYAVVYLGHRQTDGRQIAIK---------EIKTSQFKDGLDMSAIREVKY 56
           Y   K++G G YA+V     +  G  +A+K         + KT QF++        E K 
Sbjct: 186 YIAGKELGSGHYAIVKEAIDKDSGDVVAVKIFHAQHNDDQKKTKQFRE--------ETKI 237

Query: 57  LQEIRHANVIELVDLFM-----AQENLNLVLEFLPADLEM---LIKDSSLLFTQADIKSW 108
           L  I+H N+++L+D F+     AQ    LVLE + +D E+   +++ + L   + +  + 
Sbjct: 238 LMSIQHKNIVKLIDRFVEPVSKAQIQTFLVLEKV-SDGELFDRIVRKTRL--REDETNAI 294

Query: 109 LLMTLRGVHHCHRSFILHRDLKPNNLLLA-------------------PDGQLKIADFGL 149
               L G+ + H   I+HRD+KP N+LL+                    D  +KIADFGL
Sbjct: 295 FKQILNGLRYLHAKNIIHRDIKPENILLSIRKRRHSDEQQLGPWDDDEIDITIKIADFGL 354

Query: 150 ARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELMLRIP 202
           A+ +    +F  +   T  Y APE+L     YT+ VD+WS GV+    +   P
Sbjct: 355 AKFIGE-MQFTNTLCGTPSYVAPEVLTKT-GYTSRVDMWSAGVLLYVCLCGFP 405

>CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 893

 Score = 82.4 bits (202), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 67/216 (31%), Positives = 107/216 (49%), Gaps = 27/216 (12%)

Query: 5   NYTKEKKVGEGTYAVVYLG-HRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHA 63
           NY  +K++GEG++  VYL  HR T  + +    +KT    D  D + +REV Y ++  + 
Sbjct: 41  NYKIQKQIGEGSFGKVYLATHRPTKQKVV----LKTG---DKSDPNVVREVFYHRQFDYP 93

Query: 64  NVIELVDLFMAQENLNLVLEFLPAD--LEMLIKDSSLLFTQADIKSWLLMTLRG-VHHCH 120
            + +L ++ + +  + + LE+ P     + L+  S L   +    + L   + G VH+ H
Sbjct: 94  YITKLYEVIVTETKVWMALEYCPGKELYDHLLSKSRLPTLEC---AELFAQITGAVHYAH 150

Query: 121 RSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVV-----TRWYRAPELL 175
               +HRDLK  N+LL  +G  K+ DFG  R      E MT  V+     T  Y APE++
Sbjct: 151 TLNCVHRDLKLENVLLDKNGNAKLTDFGFTR------ESMTKAVLETVCGTTVYMAPEMI 204

Query: 176 FGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVD 211
               +    VD+WS+GVI   L+     LP  +D D
Sbjct: 205 QHKPYDGFKVDIWSLGVILYTLLCGC--LPFDEDDD 238

>ACL054W [995] [Homologous to ScYGL180W (APG1) - SH]
           complement(269703..272621) [2919 bp, 972 aa]
          Length = 972

 Score = 82.0 bits (201), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 84/332 (25%), Positives = 139/332 (41%), Gaps = 84/332 (25%)

Query: 1   MTAVNYTKEKKVGEGTYAVVYLGH-RQTDGRQIAIKEIKTSQFKDGLDMSAIR-EVKYLQ 58
           + A  Y  EK++G G++AVVY GH   +    +AIK +  S+ ++   +  +  E+  L+
Sbjct: 13  IVAERYVVEKEIGRGSFAVVYKGHLADSSAGNVAIKAVSRSKLRNKKLLENLEIEIAILK 72

Query: 59  EIRHANVIELVDLFMAQENLNLVLEFLP-ADLEMLIKDSSLL------------------ 99
           +I+H +++ L++      +  L++E+    DL   IK    L                  
Sbjct: 73  KIKHPHIVGLLECERTGTDFYLMMEYCALGDLTFFIKKRRSLMDKHPLVRTLFEKYPPPS 132

Query: 100 -----FTQADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAP---DGQ---------- 141
                  +  + ++L      +       ++HRD+KP NLLL+    D            
Sbjct: 133 EHHNGLNRVLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLSTPLVDYNDPAEFHARGF 192

Query: 142 --------LKIADFGLARTLAAPHEFMTSNVV-TRWYRAPELLFGARHYTAAVDLWSVGV 192
                   LKIADFG AR L  P+  +   +  +  Y APE+L   + Y A  DLWSVG 
Sbjct: 193 VGIYNLPILKIADFGFARFL--PNTSLAETLCGSPLYMAPEIL-NYQKYNAKADLWSVGT 249

Query: 193 IFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKIQVYPPPSRSELR 252
           +  E+                       G P          F A N ++++    ++   
Sbjct: 250 VLYEM---------------------CCGKPP---------FKASNHLELFQKIKKANDV 279

Query: 253 SRFI--AATENAL-DLMCGMLTMDPHKRWDTT 281
            +F   AA E+A+ DL+CG+LT +P KR   T
Sbjct: 280 IQFPKHAALESAMVDLICGLLTFEPAKRMGFT 311

>KLLA0C07535g 658746..660620 some similarities with sgd|S0005793
           Saccharomyces cerevisiae YOR267c, hypothetical start
          Length = 624

 Score = 81.6 bits (200), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 71/243 (29%), Positives = 112/243 (46%), Gaps = 18/243 (7%)

Query: 3   AVNYTKEKKV-GEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIR---EVKYLQ 58
           A  Y K  KV G G    V +  R +DG   A+K+ ++ +  + +   A +   E     
Sbjct: 212 AQKYGKLGKVLGSGAGGSVKVLVRPSDGAMFAVKQFRSRKPNEPIRDYARKCTSEFCVGS 271

Query: 59  EIRHANVIELVDLF--MAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGV 116
            + H N+IE +D+F    Q     V+E+ P D   ++    +  ++ +I       +  V
Sbjct: 272 MLHHPNIIETLDIFSDAKQTQYYQVMEYCPVDFFAVVMSGEM--SRGEINCCFKQLVEAV 329

Query: 117 HHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMT----SNVVTRWYRAP 172
           ++ H     HRDLK +N ++  +G LK+ DFG A      +E  T      V +  Y AP
Sbjct: 330 NYLHSKGYAHRDLKLDNCVMTKEGILKLIDFGSAFVYKYTYENDTKLAHGIVGSDPYLAP 389

Query: 173 ELLFGARHYTAA-VDLWSVGVIFAELML-RIPYLPGRDDVDQIDVTFRALGTPTDKDWPE 230
           E+L  +  Y A  VD+WS+G+IF  +ML R P+   +D     DV F     P D +   
Sbjct: 390 EVLVHSNGYDAPMVDIWSMGIIFCCMMLKRFPWKVPKDS----DVNFSLYCMPDDVEHDY 445

Query: 231 VSS 233
           V S
Sbjct: 446 VKS 448

>AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..90211)
           [1419 bp, 472 aa]
          Length = 472

 Score = 81.3 bits (199), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 81/300 (27%), Positives = 131/300 (43%), Gaps = 57/300 (19%)

Query: 6   YTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIRE-VKYLQEIRHAN 64
           Y   K++G G YA+V     +  G+ +A+K     +  D       RE  K L  + H N
Sbjct: 155 YIPGKELGSGHYAIVKEAINKITGQSVAVKIFHPQKNDDAKKTRQFREETKILMGLNHEN 214

Query: 65  VIELVDLFM-----AQENLNLVLEFLPAD--LEMLIKDSSLLFTQADIKSWLLMTLRGVH 117
           +++L++ F+     +Q    LVLE +      + +++ + L   Q + ++     L G+ 
Sbjct: 215 IVKLLERFVEPLSKSQVQTYLVLEKIQDGELFDKIVRKTKL--HQDETRALFKQILAGLK 272

Query: 118 HCHRSFILHRDLKPNNLLL------APDG-------------QLKIADFGLARTLAAPHE 158
           + H   I+HRD+KP N+LL      +PD               +KIADFGLA+      +
Sbjct: 273 YLHDRNIIHRDIKPENILLSIRRRTSPDQVQLGPWDEDELDITVKIADFGLAK-FTGEMQ 331

Query: 159 FMTSNVVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFR 218
           F T+   T  Y A E+L     YT+ VDLWS GV+    +   P  P  D          
Sbjct: 332 FTTTLCGTPSYVAAEVLTKT-GYTSKVDLWSAGVLLYVCLCGFP--PFSD---------- 378

Query: 219 ALGTPTDKDWPEVSSFSAYNKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRW 278
            L  P+ K+      F+ Y+       P   E+        ++ L L+  +L +DP KR+
Sbjct: 379 QLAPPSMKEQILQGKFAFYS-------PYWDEI-------DDSVLHLISNLLVVDPAKRY 424

>Kwal_33.14192
          Length = 577

 Score = 81.3 bits (199), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 96/207 (46%), Gaps = 11/207 (5%)

Query: 10  KKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDG---LDMSAIREVKYLQEIRHANVI 66
           + +GEG    V +    +DG+  A+K  +    ++           E      + H N+I
Sbjct: 225 RTIGEGASGSVSV-VESSDGKMFAVKRFRARGSRESQIEYSKKVTSEFCIGSTLHHCNII 283

Query: 67  ELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFILH 126
           E +D+     N  +V+E+ P D   L+   S L ++ +I  +      GV + HR  + H
Sbjct: 284 ETLDMLQEGTNFLVVMEYCPYDFFNLVM--SDLMSKNEISCYFKQICNGVDYLHRMGLAH 341

Query: 127 RDLKPNNLLLAPDGQLKIADFGLARTLAAPHE---FMTSNVV-TRWYRAPELLFGARHYT 182
           RDLK +N ++   G LK+ DFG A     P+E        +V +  Y APELL    +  
Sbjct: 342 RDLKLDNCVVTKQGILKLIDFGSAVVFQYPYEKEILRAKGIVGSDPYLAPELLSHPSYDP 401

Query: 183 AAVDLWSVGVIFAELML-RIPYLPGRD 208
             VD+WS+ ++F  + L R P+   RD
Sbjct: 402 RPVDVWSIAIMFYCITLKRFPWKAPRD 428

>AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919)
           [1440 bp, 479 aa]
          Length = 479

 Score = 80.9 bits (198), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 59/221 (26%), Positives = 101/221 (45%), Gaps = 11/221 (4%)

Query: 6   YTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEI-KTSQFKDGLDMSAI---REVKYLQEI- 60
           Y   + +  G+++VV+       G+ +A+K + K     + L   A     E   L+ + 
Sbjct: 7   YKVGRLIQSGSFSVVHHAQDCQTGQDVALKYVRKPHDNPEQLQKVAALVHNEYAILRRLG 66

Query: 61  RHANVIELVDLFMAQENLNLVLEFLP-ADLEMLIKDSSLLFT-QADIKSWLLMTLRGVHH 118
            H N+ +L+D +   +    VLE+    DL   IK      T + +  S+L      + +
Sbjct: 67  THRNICQLLDFYEDADTYVFVLEYCAYGDLYDFIKAIRERPTMRINFHSFLFQLCSAISY 126

Query: 119 CHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGA 178
           CH   + HRD+KP N+L+   GQ+K+ DFGL++  +   ++    + T  Y APE     
Sbjct: 127 CHSKDVSHRDIKPENVLMDDRGQVKLTDFGLSQIGSVSKDYC---IGTEKYLAPETFLRE 183

Query: 179 RHYTAAVDLWSVGV-IFAELMLRIPYLPGRDDVDQIDVTFR 218
            H T A D WS+G+ IF  +    P+     D  +    F+
Sbjct: 184 YHNTFATDYWSLGITIFCLMFGSCPFESASSDAPKRSANFQ 224

>KLLA0E11979g complement(1060048..1061892) some similarities with
           sp|P25333 Saccharomyces cerevisiae YCR008w SAT4
           serine/threonine-specific protein kinase, hypothetical
           start
          Length = 614

 Score = 80.9 bits (198), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 97/197 (49%), Gaps = 16/197 (8%)

Query: 12  VGEGTYAVVYLGHRQT----DGRQI-AIKEIKTSQFKDGLDMSA--IREVKYLQEIRHAN 64
           +G+G++ VV + H++      G  + A+KE +    ++ +  S     E      ++H N
Sbjct: 336 IGKGSFGVVRICHKKNLKSVSGEILYAVKEFRRRPTENPVKYSKRLTSEFCISSSLKHTN 395

Query: 65  VIELVDLFM-AQENLNLVLEFLPAD--LEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHR 121
           +IE +DLF  A+ +   V+E+        ++I    L + +AD   +L   + GV + H 
Sbjct: 396 IIETLDLFQDAKGDYCEVMEYCSGGDLFTLIIAAGKLEYQEADC--FLKQLITGVVYMHN 453

Query: 122 SFILHRDLKPNNLLLAPDGQLKIADFGLART--LAAPHEFMTSNVV--TRWYRAPELLFG 177
             + HRDLKP NLLL  DG LKI DFG +    +A   E   S  V  +  Y APE    
Sbjct: 454 MGVCHRDLKPENLLLTHDGTLKITDFGNSECFRMAWEKEIHLSGGVCGSGPYIAPEEYTQ 513

Query: 178 ARHYTAAVDLWSVGVIF 194
                 AVD+W+ GVI+
Sbjct: 514 EEFDPRAVDIWACGVIY 530

>Kwal_33.13112
          Length = 505

 Score = 80.5 bits (197), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 76/292 (26%), Positives = 131/292 (44%), Gaps = 39/292 (13%)

Query: 6   YTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHANV 65
           Y  ++ VG+G++  VY    +  G  +A+K I   + +D +D+ A +E+ +L E+R   V
Sbjct: 36  YDIKECVGKGSFGDVYRAIDKETGEMVAVKIINLEETQDDIDVLA-QEIYFLSELRAPFV 94

Query: 66  IELVDLFMAQENLNLVLEFLP----ADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHR 121
                 ++   ++ +V+EF      ADL   + +  L   +  +   +   L G+ + H 
Sbjct: 95  TTYYKTYVEDVSMWIVMEFCGGGSCADLLKHLPEHRL--PENKVAYIIREVLYGLEYLHS 152

Query: 122 SFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHY 181
              +HRD+K  N+LL  +G++K+ DFG++  + A  +  T  V T ++ APE++     Y
Sbjct: 153 QRKIHRDVKAANILLTDEGEVKLGDFGVSGQIMATLKRNTF-VGTPYWMAPEIIARDNGY 211

Query: 182 TAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKIQ 241
               D+WS+G+   EL+                      G P    + +         I 
Sbjct: 212 DEKADIWSLGITAMELL---------------------TGQPP---YAKYDPMKVLMNIP 247

Query: 242 VYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYFVELP 293
           +  PP    L+ RF   T +A D +   LT DP  R  T   LLS  F+  P
Sbjct: 248 LRKPP---RLQGRF---TSSARDFIALCLTKDPALR-PTASDLLSHKFLNRP 292

>Scas_477.5
          Length = 703

 Score = 80.9 bits (198), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 67/276 (24%), Positives = 122/276 (44%), Gaps = 48/276 (17%)

Query: 1   MTAVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKE------------------------ 36
           +T  ++ K  ++G G++  VYLG     G  +A+K+                        
Sbjct: 401 VTPKSWLKGARIGSGSFGTVYLGMNAQTGELMAVKQVGITAPPTPSAVVDKSKNSNSNGS 460

Query: 37  --------IKTSQFKDGLDM------SAIREVKYLQEIRHANVIELVDLFMAQENLNLVL 82
                   I   Q K+  +M      +   E+  L+E+ H N++          NLN+ L
Sbjct: 461 GKNNSNGKIANDQAKNSPNMHKKMVDALQHEMNLLKELHHENIVTYYGSSQEGPNLNIFL 520

Query: 83  EFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAPDGQL 142
           E++P      + ++   F ++ I +++   L GV + H   I+HRD+K  N+L+   G +
Sbjct: 521 EYVPGGSVSSMLNNYGPFEESLIVNFIRQVLIGVAYLHNKNIIHRDIKGANILIDTKGCV 580

Query: 143 KIADFGLARTLA--APHEFMTSNVVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELMLR 200
           KI DFG+++ L+  +  +   S   + ++ APE++      T   D+WS G +  E+   
Sbjct: 581 KITDFGISKKLSPLSKQDKRASLQGSVYWMAPEVV-KQTATTEKADIWSTGCVVIEMFTG 639

Query: 201 IPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSA 236
               P   D  Q+   F+ +GT T    PEV S+++
Sbjct: 640 KHPFP---DFSQMQTIFK-IGTNTT---PEVPSWAS 668

>CAGL0B02739g complement(262590..264620) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, hypothetical start
          Length = 676

 Score = 80.9 bits (198), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 70/287 (24%), Positives = 129/287 (44%), Gaps = 50/287 (17%)

Query: 1   MTAVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIK---------------------- 38
           +T  N+ K  ++G G++  VYLG     G  +A+K+++                      
Sbjct: 384 VTPKNWLKGARIGSGSFGTVYLGMNAQTGELMAVKQVEIKPAIAATADANVEDKNAEKNV 443

Query: 39  -----TSQFKDGLDMSAIREVKYLQEIRHANVIELVDLFMAQENLNLVLEFLPADLEMLI 93
                T+  +  +D +   E+  L+E++H N++          NLN+ LE++P      +
Sbjct: 444 AKAPSTNLHRKMID-ALQHEMSLLKELQHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSM 502

Query: 94  KDSSLLFTQADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTL 153
             +   F +  I ++    L GV + HR  I+HRD+K  N+L+   G +KI DFG+++ L
Sbjct: 503 LSNYGPFEEPLIVNFTRQILIGVAYLHRKNIIHRDIKGANILIDIKGCVKITDFGISKKL 562

Query: 154 A----APHEFMTSNVVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELML-RIPYLPGRD 208
           +       +  TS   + ++ +PE++      T+  D+WS G +  E+   + PY     
Sbjct: 563 SPLNQENQDKRTSLQGSVYWMSPEVV-KQTATTSKADIWSTGCVVIEMFTGKHPY----P 617

Query: 209 DVDQIDVTFRALGTPTDKDWPEVSSFSAYNKIQVYPPPSRSELRSRF 255
           D  Q+   F+ +GT      PE+ S+++        P  R  +R  F
Sbjct: 618 DFSQMQALFK-IGTNV---TPEIPSWAS--------PQGRDFIRKTF 652

>CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces
           cerevisiae YOR231w MKK1 ser/thr protein kinase or
           sp|P32491 Saccharomyces cerevisiae YPL140c MKK2, start
           by similarity
          Length = 467

 Score = 80.5 bits (197), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 96/194 (49%), Gaps = 13/194 (6%)

Query: 12  VGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHANVIELVDL 71
           +GEG    V     +T  +  A+K I             +RE+++ +  +   ++    +
Sbjct: 186 LGEGAGGSVAKCKLRTGKKVFALKTINILNGDPEFQKQLLRELQFNKSFKSEYIVRYFGM 245

Query: 72  FMAQEN--LNLVLEFLPA-DLEMLIKDSSLLFTQADIKSWLL-----MTLRGVHHCHRSF 123
           F  ++N  + + +E++    LE + K+  LL     I   +L       LRG+ + H   
Sbjct: 246 FTDEQNSSIYIAMEYMGGKSLEAIYKE--LLSRGGRISEKVLGKISEAVLRGLSYLHEKK 303

Query: 124 ILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTA 183
           ++HRD+KP N+LL  DGQ+K+ DFG++    A +   T+   T +Y APE + G + Y+ 
Sbjct: 304 VIHRDIKPQNILLNEDGQVKLCDFGVSG--EAVNSLATTFTGTSYYMAPERIQG-QPYSV 360

Query: 184 AVDLWSVGVIFAEL 197
             D+WS+G+   E+
Sbjct: 361 TCDVWSLGLTILEV 374

>Scas_690.13
          Length = 354

 Score = 79.7 bits (195), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 95/200 (47%), Gaps = 25/200 (12%)

Query: 10  KKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIR----EVKYLQEIRHANV 65
           + +G G++  V+L     +GR  AIK +K  Q    + M  I     E + L+ + H  +
Sbjct: 48  RTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQV---VRMKQIEHTNDERRMLKLVEHPFL 104

Query: 66  IELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFIL 125
           I +   F    NL +V++++       +   S  F     K +      G+ + H   I+
Sbjct: 105 IRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLGLEYLHSHNII 164

Query: 126 HRDLKPNNLLLAPDGQLKIADFGLAR-------TLAAPHEFMTSNVVTRWYRAPELLFGA 178
           +RDLKP N+LL  +G +KI DFG A+       TL  P +++          APE++   
Sbjct: 165 YRDLKPENILLDRNGHIKITDFGFAKEVDTVTWTLCGPPDYI----------APEVI-AT 213

Query: 179 RHYTAAVDLWSVGVIFAELM 198
           + Y  +VD WS+GV+  E++
Sbjct: 214 KPYNKSVDWWSLGVLIFEML 233

>Kwal_26.8796
          Length = 796

 Score = 80.9 bits (198), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 61/207 (29%), Positives = 103/207 (49%), Gaps = 14/207 (6%)

Query: 8   KEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHANVIE 67
           K++ VG+G +A V     +  G+  A+K I   +    +D  A RE++ LQ + H  ++ 
Sbjct: 190 KDEVVGQGAFATVKKAIERKTGKTHAVKIISKRKVVGVMDGVA-RELEVLQRLDHPRIVS 248

Query: 68  LVDLFMAQENLNLVLEFLPA-DLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFILH 126
           L   +  +++  LV+EF+   DL   +     +   A  +      L  V + H   I H
Sbjct: 249 LKGFYEDKDSHYLVMEFVSGGDLMDFVAAHGSVGEDAG-REITRQILEAVKYIHSMGISH 307

Query: 127 RDLKPNNLLLAPDGQ--LKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFG------- 177
           RDLKP+N+L+  D    +KI DFGLA+ +     FM +   T  Y APE++ G       
Sbjct: 308 RDLKPDNILIERDDPVLVKITDFGLAK-IQGNGTFMKTFCGTLAYVAPEVISGKNSGEKE 366

Query: 178 ARHYTAAVDLWSVG-VIFAELMLRIPY 203
              Y++ VD+WS+G +++  L   +P+
Sbjct: 367 GNTYSSLVDMWSIGCLVYVILTGHLPF 393

>YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase C,
            regulates MAP kinase cascade involved in regulating cell
            wall metabolism [3456 bp, 1151 aa]
          Length = 1151

 Score = 80.9 bits (198), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 74/278 (26%), Positives = 124/278 (44%), Gaps = 39/278 (14%)

Query: 5    NYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYL----QEI 60
            N+   K +G+G +  V L   +   R  AIK +K        D+ + R  K +     + 
Sbjct: 823  NFVLLKVLGKGNFGKVILSKSKNTDRLCAIKVLKKDNIIQNHDIESARAEKKVFLLATKT 882

Query: 61   RHANVIELVDLFMAQENLNLVLEFLPA-DLEMLIKDSSLLFTQADIKSWLLMTLRGVHHC 119
            +H  +  L   F  +  +   +EF+   DL   +++  L   +A  K +    L  + + 
Sbjct: 883  KHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQRLSVRRA--KFYAAEVLLALKYF 940

Query: 120  HRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGAR 179
            H + +++RDLK  N+LL P+G +KIAD+GL +         ++   T  + APE+L   +
Sbjct: 941  HDNGVIYRDLKLENILLTPEGHIKIADYGLCKDEMWYGNRTSTFCGTPEFMAPEIL-KEQ 999

Query: 180  HYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNK 239
             YT AVD W+ GV+  +++L      G DD D++   F A+ T    D P          
Sbjct: 1000 EYTKAVDWWAFGVLLYQMLLCQSPFSG-DDEDEV---FNAILT----DEP---------- 1041

Query: 240  IQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKR 277
              +YP     E+           + +  G+LT DP KR
Sbjct: 1042 --LYPIDMAGEI-----------VQIFQGLLTKDPEKR 1066

>KLLA0F08877g 825217..826182 gi|27526975|emb|CAD36965.1
           Kluyveromyces lactis cyclin-dependent kinase activating
           kinase 1, start by similarity
          Length = 321

 Score = 79.0 bits (193), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 74/139 (53%), Gaps = 14/139 (10%)

Query: 113 LRGVHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAP 172
           + G+ + H + I+HRD+KP N++L    ++ + DFG++      +E  T +  T  Y+AP
Sbjct: 122 IEGLVYIHGNGIIHRDVKPQNIMLNSYNEVVLGDFGISYNRNLDNEAKTCDCSTSIYKAP 181

Query: 173 ELLFGARHYTAAVDLWSVGVIFAEL-------------MLRIPYLPGRDDVDQIDVTFRA 219
           ELLF   +Y   +D+W++ V+ ++L             ++ I +     D+  +   F  
Sbjct: 182 ELLFSVSNYKFEIDIWALAVLISQLWNDKTQSKSKSSKVIDIDF-DECSDIKLVLTLFDK 240

Query: 220 LGTPTDKDWPEVSSFSAYN 238
            G P+++DWP+V+   ++N
Sbjct: 241 FGKPSNEDWPQVTKNESFN 259

>Kwal_27.10581
          Length = 1154

 Score = 80.5 bits (197), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 71/273 (26%), Positives = 121/273 (44%), Gaps = 39/273 (14%)

Query: 10   KKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYL----QEIRHANV 65
            K +G+G +  V L   + + R  AIK +K        D+ + R  K +     + +H  +
Sbjct: 831  KVLGKGNFGKVLLAESKNNERLCAIKVLKKDHIIKNHDIESARAEKKVFLLATKAKHPFL 890

Query: 66   IELVDLFMAQENLNLVLEFLPA-DLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFI 124
              L   F  +  +   +EF+   DL   +++  L   +A  K +    L  + + H + +
Sbjct: 891  TNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQRLSVRRA--KFYAAEVLLALKYFHDNGV 948

Query: 125  LHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAA 184
            ++RDLK  N+LL P+G +KIAD+GL +         ++   T  + APE+L   + YT A
Sbjct: 949  IYRDLKLENILLTPEGHIKIADYGLCKDEMWYGNKTSTFCGTPEFMAPEIL-KEQEYTKA 1007

Query: 185  VDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKIQVYP 244
            VD W+ GV+  +++L      G D+    D  F A+ T    D P            +YP
Sbjct: 1008 VDWWAFGVLLYQMLLCQSPFSGEDE----DEVFNAILT----DEP------------LYP 1047

Query: 245  PPSRSELRSRFIAATENALDLMCGMLTMDPHKR 277
                       I    + + +  G+LT DP +R
Sbjct: 1048 -----------IDMAGDIVQIFQGLLTKDPERR 1069

>KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces
            cerevisiae YNR031c SSK2 MAP kinase kinase kinase of the
            high osmolarity signal transduction pathway, start by
            similarity
          Length = 1551

 Score = 80.5 bits (197), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 101/214 (47%), Gaps = 21/214 (9%)

Query: 3    AVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAI-----REVKYL 57
            ++ + K   +G G++  VY       G  +A+KEIK    +D   M  I      E++ +
Sbjct: 1256 SIRWQKRSFIGSGSFGTVYSAVNLDTGDILAVKEIK---IQDAKSMKQIFPSLKEEMRVM 1312

Query: 58   QEIRHANVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVH 117
            + + H N+++   + + ++ +N+ +EF        + +   +  +   + + L  L G+ 
Sbjct: 1313 EILNHPNIVQYYGVEVHRDKVNIFMEFCEGSSLASLLEHGRIEDEMVTQVYTLQLLEGLA 1372

Query: 118  HCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTS------------NVV 165
              H+S ++HRD+KP N+LL  +G +K  DFG A+ +A       S             + 
Sbjct: 1373 CLHQSGVVHRDIKPENILLDRNGVIKYVDFGAAKLIAKNGSKRISLDANNKSTGGKDMIG 1432

Query: 166  TRWYRAPELLFGARHYT-AAVDLWSVGVIFAELM 198
            T  Y APE + G  H    + D+WS+G +  E++
Sbjct: 1433 TPMYMAPETVTGQGHGKFGSDDIWSLGCVVLEMV 1466

>Kwal_27.9763
          Length = 868

 Score = 79.7 bits (195), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 55/199 (27%), Positives = 100/199 (50%), Gaps = 9/199 (4%)

Query: 5   NYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHAN 64
           +Y  ++ VG+G Y +VY    +   +Q+AIK I+  + +       + E+  L+ ++H N
Sbjct: 22  HYALKQVVGKGAYGIVYRAINRQTHKQVAIKVIEYDEEE--ELNEHMLEIDLLKNLKHEN 79

Query: 65  VIELVDLFMAQENLNLVLEFLP-ADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSF 123
           +++          L ++LE+     L  LIK   +   +   K+++  TL G+ + H   
Sbjct: 80  IVKYHGFIQKSHQLFILLEYCSQGSLRDLIKRGPV--EEQQCKTYIRQTLHGLKYLHDQG 137

Query: 124 ILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTA 183
           ++HRD+K  NLLL     +K+ADFG++  +   +  MT      W  APE++ G    T 
Sbjct: 138 VIHRDIKAANLLLDAQNVVKLADFGVSTRVN--NLAMTYAGSPNWM-APEVMMGQGASTV 194

Query: 184 AVDLWSVGVIFAELMLRIP 202
           + D+WS+G    E++   P
Sbjct: 195 S-DIWSLGATVVEILTGNP 212

>CAGL0F03707g complement(359839..361665) similar to sp|Q08732
           Saccharomyces cerevisiae YOR267c, start by similarity
          Length = 608

 Score = 79.7 bits (195), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 69/252 (27%), Positives = 110/252 (43%), Gaps = 40/252 (15%)

Query: 10  KKVGEGTYAVVYLGHRQTDGRQIAIKEI---KTSQFKDGLDMSAIREVKYLQEIRHANVI 66
           K +G G    V +  R TDG   A+KE    K ++         I E      + H NVI
Sbjct: 184 KTLGSGAGGSVKILKRPTDGATFAVKEFRPKKPTETSKQYAKKCIAEFTIGSTLHHVNVI 243

Query: 67  ELVDLF--MAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFI 124
           E +D+F    ++    V+E+ P D   ++    +  ++ ++   L     GV + H   +
Sbjct: 244 ETMDIFSDAKKQRYFEVMEYCPVDFFAVVMSGKM--SRGEVNCCLKQLACGVKYLHSMGL 301

Query: 125 LHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHE---FMTSNVV-TRWYRAPELLFGAR- 179
            HRDLK +N ++  +G LK+ DFG A     P E    + S +V +  Y APE+L     
Sbjct: 302 AHRDLKLDNCVMTENGILKLIDFGSAVVFRYPFEQEVTLASGIVGSDPYLAPEVLGKISR 361

Query: 180 ---------HYT--------------AAVDLWSVGVIFAELML-RIPYLPGRDDVDQIDV 215
                    H T               AVD+WS+G+IF+ +ML R P+   ++     D 
Sbjct: 362 ADGDESEEPHQTIKIDKKTGLSLYDPQAVDVWSIGIIFSCMMLKRFPWKAPKES----DP 417

Query: 216 TFRALGTPTDKD 227
            F+    P D++
Sbjct: 418 NFKLYNMPEDEE 429

>CAGL0M09361g complement(928484..931918) highly similar to sp|P24583
            Saccharomyces cerevisiae YBL105c PKC1 ser/thr protein
            kinase, start by similarity
          Length = 1144

 Score = 79.7 bits (195), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 75/278 (26%), Positives = 123/278 (44%), Gaps = 39/278 (14%)

Query: 5    NYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYL----QEI 60
            N+   K +G+G +  V L   +   R  AIK +K        D+ + R  K +     + 
Sbjct: 816  NFVLLKVLGKGNFGKVILSRSKNTNRLCAIKVLKKDNIIQNHDIESARAEKKVFLLATKT 875

Query: 61   RHANVIELVDLFMAQENLNLVLEFLPA-DLEMLIKDSSLLFTQADIKSWLLMTLRGVHHC 119
            +H  +  L   F  +  +   +EF+   DL   +++  L   +A  K +    L  +   
Sbjct: 876  KHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQRLSVRRA--KFYAAEVLLALKFF 933

Query: 120  HRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGAR 179
            H + +++RDLK  N+LL P+G +KIAD+GL +         ++   T  + APELL   +
Sbjct: 934  HDNGVIYRDLKLENILLTPEGHIKIADYGLCKDGMWYGNKTSTFCGTPEFMAPELL-REQ 992

Query: 180  HYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNK 239
             YT AVD W+ GV+  +++L      G DD D++   F A+ T    D P          
Sbjct: 993  DYTKAVDWWAFGVLLYQMLLCQSPFSG-DDEDEV---FNAILT----DEP---------- 1034

Query: 240  IQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKR 277
              +YP           I    + + +  G+LT DP KR
Sbjct: 1035 --LYP-----------IDMAGDIVQIFQGLLTKDPEKR 1059

>KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces
           cerevisiae YNL298w CLA4 ser/thr protein kinase, start by
           similarity
          Length = 879

 Score = 79.7 bits (195), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 108/219 (49%), Gaps = 28/219 (12%)

Query: 10  KKVGEGTYAVVYLGHR--------------QTDGRQIAIKE-IKTSQFKDGLDMSAIREV 54
           +K G+G    VYL  R                 G ++AIK+ I + Q +  L    + E+
Sbjct: 592 EKAGQGASGSVYLAERLQLPPYKDELEAEKNQLGNKVAIKQMILSKQPRKEL---IVNEI 648

Query: 55  KYLQEIRHANVIELVDLFMAQEN-LNLVLEFLPA-DLEMLIKDSSL------LFTQADIK 106
             +++ +H N++  ++ ++  E+ L +V+E++    L  +I++S          T+  I 
Sbjct: 649 LVMKDSKHNNIVNFLEAYLKTEDDLWVVMEYMEGGSLTDIIENSPTGSSGQSPLTEPQIA 708

Query: 107 SWLLMTLRGVHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVT 166
             +  T +G+   H   I+HRD+K +N+LL   G++KI DFG    L        + V T
Sbjct: 709 YIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRGRVKITDFGFCAKLTDKRSKRATMVGT 768

Query: 167 RWYRAPELLFGARHYTAAVDLWSVGVIFAELM-LRIPYL 204
            ++ APE++   R Y   VD+WS+G++  E++    PYL
Sbjct: 769 PYWMAPEVV-KQREYDEKVDVWSLGIMTIEMLESEPPYL 806

>Kwal_47.17252
          Length = 872

 Score = 79.7 bits (195), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 84/328 (25%), Positives = 137/328 (41%), Gaps = 82/328 (25%)

Query: 1   MTAVNYTKEKKVGEGTYAVVYLGHRQTDGRQ----IAIKEIKTSQFKDGLDMSAIR-EVK 55
           M +  Y  ++++G+G++A VY G R    R     IAIK +  S+ K+   +  +  E+ 
Sbjct: 15  MISDKYLVQQEIGKGSFATVYKG-RIASNRDLNDFIAIKAVSRSKLKNKKLLENLEIEIA 73

Query: 56  YLQEIRHANVIELVDLFMAQENLNLVLEFLP-ADLEMLIKDSSLL--------------- 99
            L++I+H +++ L+D      +  L++E+    DL  LIK    L               
Sbjct: 74  ILKKIKHPHIVGLMDCERTGADFFLIMEYCALGDLTFLIKKRGGLIEKHPLVRTMFEKYP 133

Query: 100 --------FTQADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLA------PDGQ---- 141
                     +  + S+L      +       ++HRD+KP NLLL+       D +    
Sbjct: 134 PPSESHNGLNRVVVVSYLQQLSSALMFLRSKNLVHRDIKPQNLLLSTPLVNYSDRETFHK 193

Query: 142 -----------LKIADFGLARTLAAPHEFMTSNVV-TRWYRAPELLFGARHYTAAVDLWS 189
                      LKIADFG AR L  P+  +   +  +  Y APE+L   + Y A  DLWS
Sbjct: 194 MGFVGIYNLPILKIADFGFARFL--PNTSLAETLCGSPLYMAPEIL-DYQKYNAKADLWS 250

Query: 190 VGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKIQVYPPPSRS 249
           VG +  E+    P     + ++     F+ +    D     V SF  + K+    P  R 
Sbjct: 251 VGTVLYEMCCGRPPFKASNHLE----LFKKIKRAND-----VISFPTHCKVD---PQMR- 297

Query: 250 ELRSRFIAATENALDLMCGMLTMDPHKR 277
                         +L+CG+LT DP +R
Sbjct: 298 --------------ELICGLLTFDPSQR 311

>Kwal_0.307
          Length = 490

 Score = 79.3 bits (194), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 61/197 (30%), Positives = 98/197 (49%), Gaps = 16/197 (8%)

Query: 12  VGEGTYAVVYLGHRQT----DGRQI-AIKEI--KTSQFKDGLDMSAIREVKYLQEIRHAN 64
           VG+G + VV + H+++    +G ++ A+KE   K S+  +        E      ++H N
Sbjct: 273 VGKGAFGVVRICHKKSQDDPNGEKLYAVKEFRRKPSESPEKYSRRLTSEFCISSSLKHTN 332

Query: 65  VIELVDLFM-AQENLNLVLEF-LPADL-EMLIKDSSLLFTQADIKSWLLMTLRGVHHCHR 121
           +I  +DLF  A+ +   V+E+    DL  ++I    L + +AD   +    +RGV + H 
Sbjct: 333 IIMTLDLFQDAKGDYCQVMEYCFGGDLFTLIIAAGKLEYMEADC--FFKQLIRGVVYMHD 390

Query: 122 SFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHE---FMTSNVV-TRWYRAPELLFG 177
             + HRDLKP NLLL+ +G LKI DFG +       E    ++  V  +  Y APE    
Sbjct: 391 MGVCHRDLKPENLLLSSNGTLKITDFGNSECFRMAWEKDIHLSGGVCGSSPYIAPEEYVH 450

Query: 178 ARHYTAAVDLWSVGVIF 194
                  VD+W+ GVI+
Sbjct: 451 EEFDPRPVDIWACGVIY 467

>ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -
           SH] complement(560761..563556) [2796 bp, 931 aa]
          Length = 931

 Score = 79.3 bits (194), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 99/206 (48%), Gaps = 12/206 (5%)

Query: 12  VGEGTYAVVYLGHRQT----DGRQIAIKEIK--TSQFKDGLDMSAIREVKYLQEIRHANV 65
           +GEG +  V LG  +     D R +AIK I+  T       ++   RE+  L+ + H N+
Sbjct: 51  LGEGEFGKVKLGWSKARLDGDSRNVAIKLIRRDTVPKNSEKEIKIYRELNALKLLSHPNI 110

Query: 66  IELVDLFMAQENLNLVLEFLPA-DLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFI 124
           + L ++    + + +VL++    +    I+    L      + +  + + GVH+ H   +
Sbjct: 111 VRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRLKEPPACRLFAQL-ISGVHYIHYKGL 169

Query: 125 LHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTA- 183
            HRDLK  NLLL     L I DFG        ++ M ++  +  Y APEL+  ++ Y+A 
Sbjct: 170 AHRDLKLENLLLDEHENLIITDFGFVNEFHK-NDLMRTSCGSPCYAAPELVVSSKPYSAQ 228

Query: 184 AVDLWSVGVIFAELMLRIPYLPGRDD 209
             D+WS GVI   ++    YLP  DD
Sbjct: 229 KADVWSCGVILYAMLAG--YLPWDDD 252

>Kwal_14.1249
          Length = 344

 Score = 78.2 bits (191), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 65/228 (28%), Positives = 106/228 (46%), Gaps = 44/228 (19%)

Query: 48  MSAIREVKYLQEIRHANVIELVDLFMAQENLNLVLEFLPADL-EMLIK-------DSSLL 99
           M  +  ++ LQ  R A++IELV   +A+  + L   F   ++ + ++K       +  LL
Sbjct: 40  MCELAILRKLQVGRSAHIIELVSFEVARGVVTLQFPFYKQNMYQYVLKYYQKRRWNPYLL 99

Query: 100 FTQADIKSWLLMTLR-------------GVHHCHRSFILHRDLKPNNLLLAPDG-----Q 141
             Q D  S L+  L+              + + H   I+HRD+K  N+++  DG     Q
Sbjct: 100 TEQGDSGSKLVNNLKIDYALDFFRQLADALSNLHEHKIIHRDVKLQNVMVDEDGPHDIPQ 159

Query: 142 LKIADFGLARTLAAPHEFMTS---NVVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELM 198
           L + DFG+A       E   S   +V T  Y+APELLF  ++Y++A D+WS+ V+ ++L 
Sbjct: 160 LVLIDFGIAYDPETSQEAADSKITDVSTSIYKAPELLFSVKNYSSAADIWSLMVLVSQLF 219

Query: 199 LR-------IP--------YLPGRDDVDQIDVTFRALGTPTDKDWPEV 231
                    IP         L    D+  +   F  LG P+ ++WPEV
Sbjct: 220 QTESSSDRFIPAFVSDGSEVLEQGSDIRLVSSIFEKLGIPSLQEWPEV 267

>AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C
            (SSK2) - SH] (1120017..1124468) [4452 bp, 1483 aa]
          Length = 1483

 Score = 79.3 bits (194), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 69/302 (22%), Positives = 134/302 (44%), Gaps = 39/302 (12%)

Query: 3    AVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDM-SAIR-EVKYLQEI 60
            ++ + K   +G G++  VY       G  +A+KEIK +  K    +  +IR E+  L+ +
Sbjct: 1188 SIKWQKRSFIGGGSFGSVYSAVNLDTGDILAVKEIKFNDRKTIKQVFPSIRDEMTVLEML 1247

Query: 61   RHANVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCH 120
             H NV++   + + ++ +N+ +E+        +     +  +   + + L  L G+ + H
Sbjct: 1248 NHPNVVQYYGVEVHRDRVNIFMEYCEGGSLASLLAHGRIEDEMVTQVYSLQMLEGLAYLH 1307

Query: 121  RSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAA---------PHEFMTSNVVTRWYRA 171
             S + HRD+KP N+LL  +G +K  DFG A+ LA+          H      + T  Y +
Sbjct: 1308 ESGVDHRDIKPENILLDFNGIIKYVDFGAAKVLASNGSKKLNLEQHMEGEKMIGTPMYMS 1367

Query: 172  PELLFGARHYT-AAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPE 230
            PE + G  +    + D+WS+G +  E+                 VT R      D  W  
Sbjct: 1368 PEAISGTGYGKFGSDDIWSLGCVILEM-----------------VTGRRPWANLDNQWAI 1410

Query: 231  VSSFSAYNKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYFV 290
            +   +A  +I ++  PS++E+       ++  +  +   L  DP++R      L+  + +
Sbjct: 1411 IYQVAA-GQIPMF--PSKNEM-------SQAGIKFLSRCLIQDPNQRSTAVELLMDPWII 1460

Query: 291  EL 292
            E+
Sbjct: 1461 EI 1462

>KLLA0B13112g complement(1146006..1148198) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, start by similarity
          Length = 730

 Score = 79.0 bits (193), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 59/250 (23%), Positives = 110/250 (44%), Gaps = 40/250 (16%)

Query: 8   KEKKVGEGTYAVVYLGHRQTDGRQIAIKEIK----------------------------- 38
           K  ++G G++  VYLG     G  +A+K+++                             
Sbjct: 441 KGARIGSGSFGSVYLGMNAETGELMAVKQVELKPTAVTAGVVSIADESKKAHSPGGGNTA 500

Query: 39  ---TSQFKDGLDMSAIREVKYLQEIRHANVIELVDLFMAQENLNLVLEFLPADLEMLIKD 95
              TSQ    +  +   E+  L+E+ H N++          NLN+ LE++P      + +
Sbjct: 501 VKNTSQIHRKMIDALQHEMNILKELHHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLN 560

Query: 96  SSLLFTQADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAA 155
           +   F +  +K++    L G+ + H+  I+HRD+K  N+L+   G +KI DFG+++ L+ 
Sbjct: 561 NYGPFDEPLVKNFTRQILIGLAYLHKRNIIHRDIKGANILIDIKGGVKITDFGISKKLSP 620

Query: 156 PHEFMTSNVVTR---WYRAPELLFGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQ 212
            ++        +   ++ APE++      T   D+WSVG +  E+       P   D  Q
Sbjct: 621 LNKQQNKRASLQGSVYWMAPEVVKQVV-TTEKADIWSVGCVIVEMFTGKHPFP---DFSQ 676

Query: 213 IDVTFRALGT 222
           +   F+ +GT
Sbjct: 677 MQAIFK-IGT 685

>CAGL0M02233g complement(267332..269635) highly similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, hypothetical start
          Length = 767

 Score = 79.0 bits (193), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 58/209 (27%), Positives = 98/209 (46%), Gaps = 20/209 (9%)

Query: 12  VGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHANVIELVDL 71
           VG G +A V     +  G+  A+K I   +    +D    RE++ LQ++ H  ++ L   
Sbjct: 194 VGTGAFATVKKAVERNTGKTFAVKIINKRKVVGNMD-GVSRELEVLQKLNHPRIVSLKAF 252

Query: 72  FMAQENLNLVLEFLPA-DLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFILHRDLK 130
           +  + N  +V+EF+   DL   +     +  +A  +      L  + + H   I HRDLK
Sbjct: 253 YEDEANYYMVMEFISGGDLMDFVAAHGAVGEEAG-REISRQILEAIQYIHSKGISHRDLK 311

Query: 131 PNNLLLAPDGQ--LKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFG----------- 177
           P+N+L+  D    +KI DFGLA+ +      M +   T  Y APE++ G           
Sbjct: 312 PDNILIEQDDPVLVKITDFGLAK-VQGNGSIMKTFCGTLAYVAPEVIGGFTGATGEEETE 370

Query: 178 --ARHYTAAVDLWSVG-VIFAELMLRIPY 203
                Y++ VD+WS+G ++F  L   +P+
Sbjct: 371 EERIEYSSLVDMWSMGCLVFVILTGHLPF 399

>ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH]
           complement(597519..600032) [2514 bp, 837 aa]
          Length = 837

 Score = 79.0 bits (193), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 98/205 (47%), Gaps = 16/205 (7%)

Query: 12  VGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHANVIELVDL 71
           VG+G +A V     +  G+  A+K I   +    +D    RE++ L+ + H  ++ L   
Sbjct: 223 VGQGAFATVKKAVERNTGKTFAVKIINKRKVMGNVD-GVTRELEVLRRLNHPRIVSLKGF 281

Query: 72  FMAQENLNLVLEFLPA-DLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFILHRDLK 130
           +   E+  L++EF+   DL   +     +   A  +      L  V + H   I HRDLK
Sbjct: 282 YEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAG-REITRQILEAVRYIHEQGISHRDLK 340

Query: 131 PNNLLLAPDGQ--LKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFG---------AR 179
           P+N+L+  D    +KI DFGLA+ +     FM +   T  Y APE++ G           
Sbjct: 341 PDNILIEQDDPVLVKITDFGLAK-IQDNTTFMKTFCGTLAYVAPEVIGGKNPEGNGANGN 399

Query: 180 HYTAAVDLWSVG-VIFAELMLRIPY 203
            Y++ VD+WS+G +++  L   +P+
Sbjct: 400 LYSSLVDMWSIGCLVYVILTGHLPF 424

>CAGL0K10604g complement(1029226..1030566) similar to sp|P27466
           Saccharomyces cerevisiae YFR014c CMK1
           Ca2+/calmodulin-dependent ser/thr protein kinase type I,
           hypothetical start
          Length = 446

 Score = 78.6 bits (192), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 98/199 (49%), Gaps = 9/199 (4%)

Query: 6   YTKEKKVGEGTYAVVYLGHRQTDGRQIAIK-EIKTSQFKDGLDMSAIREVKYLQEIRHAN 64
           Y  ++ +G G++ VV    +      +A+K  +K +  K+G       E+  +Q + H N
Sbjct: 65  YLFQRTLGAGSFGVVKRAKQLHSDEDVAVKILLKRALEKNGGLEPIYDELNIIQHLDHPN 124

Query: 65  VIELVDLFMAQENLNLVLEFLPAD--LEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRS 122
           +++  D F  +    +V +        + ++ D    +T+ D  + ++  L+ V + H  
Sbjct: 125 IVKFKDWFETESKFYIVTQLASGGELFDRIMHDGK--YTEEDAVNIVVQILKAVEYLHSQ 182

Query: 123 FILHRDLKPNNLLL---APDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGAR 179
            I+HRDLKP NLL    + D ++ +ADFG+AR L    + +     +  Y APE +F + 
Sbjct: 183 NIIHRDLKPENLLYLDKSKDSRIVLADFGIARQLENDDDVIYRPAGSLGYVAPE-VFTSD 241

Query: 180 HYTAAVDLWSVGVIFAELM 198
            +    D+WSVGVI   L+
Sbjct: 242 GHGKPSDIWSVGVITYTLL 260

>YFL029C (CAK1) [1654] chr6 complement(78053..79159) Cdk-activating
           kinase (serine/threonine protein kinase) responsible for
           in vivo activation of Cdc28p, also involved in spore
           wall formation [1107 bp, 368 aa]
          Length = 368

 Score = 77.8 bits (190), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 105/240 (43%), Gaps = 58/240 (24%)

Query: 101 TQADIKSWLLMTLR----GVHHCHRSFILHRDLKPNNLLLAPDG-----QLKIADFGLA- 150
            Q D+  + L   R    G+   H + I+HRD+KP N++L  +      +L I DFG++ 
Sbjct: 125 NQLDVNRYSLSFFRQMVEGIAFLHENKIIHRDIKPQNIMLTNNTSTVSPKLYIIDFGISY 184

Query: 151 ------RTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAAVDLWSVGVI----FAELMLR 200
                 +T A P +   +++ T  Y+APE+LFG + Y   VD+WS+ +I    F     R
Sbjct: 185 DMANNSQTSAEPMDSKVTDISTGIYKAPEVLFGVKCYDGGVDVWSLLIIISQWFQRETSR 244

Query: 201 IPYLP-----GRDDVDQ-------IDVTFRALGTPTDKDWPEVSSFSAYN---------- 238
           + ++P     G DD++        I   F  LG P+ + W EV+   + +          
Sbjct: 245 MGHVPAMIDDGSDDMNSDGSDFRLICSIFEKLGIPSIQKWEEVAQHGSVDAFVGMFGADG 304

Query: 239 ----------KIQVY----PPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCL 284
                      +Q+       P   E+    +   +  ++ + GM++  P++RW   R L
Sbjct: 305 DGKYVLDQEKDVQISIVERNMPRLDEIAD--VKVKQKFINCILGMVSFSPNERWSCQRIL 362

>CAGL0L07810g complement(857656..859446) similar to sp|P25333
           Saccharomyces cerevisiae YCR008w SAT4
           serine/threonine-specific protein kinase, start by
           similarity
          Length = 596

 Score = 78.6 bits (192), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 77/295 (26%), Positives = 127/295 (43%), Gaps = 40/295 (13%)

Query: 12  VGEGTYAVVYLGHRQTDG-----RQIAIKEIK--TSQFKDGLDMSAIREVKYLQEIRHAN 64
           +G+G + VV + H++        +  A+KE K   ++ K+        E      + H N
Sbjct: 300 LGKGAFGVVRICHKKVPENPKVEKLYAVKEFKRKATEPKEKFAKRLTSEFCISSSLHHTN 359

Query: 65  VIELVDLFM-AQENLNLVLEFLPAD--LEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHR 121
           +++ +DLF  A  +   V+E+        ++I    L + +AD   +    LRGV + H 
Sbjct: 360 IVDTLDLFQDANGDYCEVMEYCAGGDLFTLIIAAGKLEYMEADC--FFKQLLRGVVYMHD 417

Query: 122 SFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHE---FMTSNVV-TRWYRAPELLFG 177
             + HRDLKP NL+L  DG LKI DFG +       E    ++  V  +  Y APE    
Sbjct: 418 MGVCHRDLKPENLILTHDGVLKITDFGNSECFKMAWEEDIHLSGGVCGSSPYIAPEEYVL 477

Query: 178 ARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAY 237
                  VD+W+ GVI+  + +R               T R L T   KD P  + +   
Sbjct: 478 EEFDPRPVDIWACGVIY--MAMR---------------TGRQLWTAAKKDDPFYNKYLQG 520

Query: 238 NKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKRWDTTRCLLSQYFVEL 292
            + +    P  S  R+R         +++  ML   PH+R +  + L S++  E+
Sbjct: 521 RRQKSGYEPIESLKRAR-------CRNVIYSMLDPAPHRRINGKQILNSEWGREI 568

>AFR150C [3342] [Homologous to ScYFL029C (CAK1) - SH]
           (707306..708355) [1050 bp, 349 aa]
          Length = 349

 Score = 77.0 bits (188), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 66/291 (22%), Positives = 121/291 (41%), Gaps = 68/291 (23%)

Query: 53  EVKYLQEIRHANVIELVDLFMAQENLNLVLEFLPADLEMLIK---------------DSS 97
           E++ LQ  +H+N+I ++   +    + + + ++  DL   ++               DS 
Sbjct: 44  ELRILQACQHSNIIPVLSATVEGGIVKICMPYVKTDLYAFMRQHYGGKHLAYLMPCLDSE 103

Query: 98  LLFTQADIKSWLLMTLRGVHHC----------HRSFILHRDLKPNNLLLAPDGQLKIADF 147
               +A  K+ L M  R +H C          H   ++HRD+KP N+L+  +  + + DF
Sbjct: 104 ARGRRAQ-KNRLSMA-RTMHVCSQLADALAYLHGLGVIHRDIKPQNVLVDSNDHVYVIDF 161

Query: 148 GLARTLA--APHEFMTSN------VVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELML 199
           G+    A   P  +  ++      V T  Y+APEL+F  R+Y   VD+WS+ V F++L  
Sbjct: 162 GVCYDTAQRGPRRYGETDDSKIPDVSTSIYKAPELMFSVRNYGLPVDVWSLAVTFSQLFQ 221

Query: 200 RIPYLPG---------------RDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKIQVYP 244
           R     G                 D+  +   F+ LG P+ + WP+V  + +   + ++ 
Sbjct: 222 RYETPQGGIAAFVDDGAEELETGTDIRAVMSIFQQLGIPSQEQWPQVVRYGSSGFVGMFG 281

Query: 245 -------------PPSRSELRSRF-----IAATENALDLMCGMLTMDPHKR 277
                        P   +++   F     ++  E    ++ GML  D  KR
Sbjct: 282 TEGDGNYIFDKPWPEQLAKVEQLFPRLAEVSQHEELARMLLGMLHFDTQKR 332

>AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH]
           (1043479..1044750) [1272 bp, 423 aa]
          Length = 423

 Score = 77.4 bits (189), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 67/254 (26%), Positives = 107/254 (42%), Gaps = 57/254 (22%)

Query: 10  KKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHANVIELV 69
           +++G G++  V         + +  KEIK            I E   L  +RH N++E  
Sbjct: 31  EEIGRGSFGSVRKVLHVPTSKLMVRKEIKYGHMNSKERQQLIAECTILAGLRHENIVEFY 90

Query: 70  DLFMAQ------------ENLNLVLEFLP-ADLEMLIKDSSLL---FTQADIKSWLLMTL 113
           +   A             E L L +E+    DL  +IK    +     + DI    +  L
Sbjct: 91  NWDHASSRTGNSVDYGNGEVLYLYMEYCSCGDLSQMIKHYKGMRKYVPERDIWRIAVQLL 150

Query: 114 RGVHHCHRSF--------------------------ILHRDLKPNNLLLAPDG------- 140
             ++ CH S                           ++HRDLKP N+ L  DG       
Sbjct: 151 LALYKCHTSCDLPQLDTIYDKISKSAIESEAGKVTSVIHRDLKPGNIFLTGDGVGGRGSV 210

Query: 141 -----QLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAAVDLWSVGVIFA 195
                ++K+ DFGLA++L +  EF T+ V T +Y +PE+L   + Y+   D+WS+G +  
Sbjct: 211 DYSKVEVKLGDFGLAKSLQSAIEFATTYVGTPYYMSPEVLMD-QPYSPLSDIWSLGCVIY 269

Query: 196 ELM-LRIPYLPGRD 208
           EL  LR+P+ P R+
Sbjct: 270 ELCALRVPF-PARN 282

>Kwal_14.1159
          Length = 1521

 Score = 77.8 bits (190), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 97/202 (48%), Gaps = 29/202 (14%)

Query: 5   NYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIR--- 61
           +Y   K + +G Y  V+L  R+  G   AIK +K S      DM A  +V  ++  R   
Sbjct: 676 DYDVIKPISKGAYGSVFLAKRRITGEYFAIKVLKKS------DMIAKNQVTNVKSERAIM 729

Query: 62  --HAN---VIELVDLFMAQENLNLVLEFLPA-DLEMLIKDSSLLFTQADIKSWLLMTLRG 115
              +N   V +L   F  + NL LV+E+L   DL  LIK    L  Q  +K ++   + G
Sbjct: 730 MVQSNKPYVAKLYATFQNRGNLFLVMEYLSGGDLGTLIKMMGSLPDQW-VKQYISEVIYG 788

Query: 116 VHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPE-- 173
           V   H+S I+H DLKP+NLL+   G LK+ DFGL+R            +VTR   A +  
Sbjct: 789 VEDMHQSGIIHHDLKPDNLLIDQRGHLKLTDFGLSRM----------GLVTRHTGATQKS 838

Query: 174 -LLFGARHYTAAVDLWSVGVIF 194
            L  G+R  +A  +   +G  F
Sbjct: 839 RLRAGSRKGSATSEDIKLGGSF 860

>Scas_707.7
          Length = 376

 Score = 76.6 bits (187), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 76/148 (51%), Gaps = 26/148 (17%)

Query: 115 GVHHCHRSFILHRDLKPNNLLLA--PDGQLK--IADFGLARTLAAPHEFM-------TSN 163
           G++  H   I+HRD+KP N++L    DG +   I DFG++    AP + +        ++
Sbjct: 151 GINSIHEQKIIHRDIKPQNVMLEIHDDGSISLLITDFGISYDHEAPADKLREPPLQKITD 210

Query: 164 VVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELMLR-------IP--------YLPGRD 208
           V T +Y++PELLFG ++Y   VD+W++ V+ ++   +       +P         L    
Sbjct: 211 VSTSFYKSPELLFGIKNYEFEVDIWALLVLLSQFFQKETNIENFVPSMFDDGSGVLDSGS 270

Query: 209 DVDQIDVTFRALGTPTDKDWPEVSSFSA 236
           D+  I   F  +GTP  KDWP+V  + +
Sbjct: 271 DIRLIFSIFEMVGTPGVKDWPKVIEYGS 298

>CAGL0M03729g complement(420316..422901) similar to sp|P48562
           Saccharomyces cerevisiae YNL298w CLA4, start by
           similarity
          Length = 861

 Score = 77.4 bits (189), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 60/224 (26%), Positives = 107/224 (47%), Gaps = 32/224 (14%)

Query: 10  KKVGEGTYAVVYLGHR----QTDGRQ----------------IAIKEIKTSQFKDGLDMS 49
           +K G+G    VYL  R    + DG Q                +AIK++  S  K      
Sbjct: 568 EKAGQGASGSVYLAERTEIIEADGPQHQRGGTEHEDPLIGDKVAIKQMVLS--KQPRKEL 625

Query: 50  AIREVKYLQEIRHANVIELVDLFMAQEN-LNLVLEFLPA-DLEMLIKDSSL------LFT 101
            + E+  + + RH N++  ++ ++  E+ L +V+E++    L  +I++S          +
Sbjct: 626 IVNEIMVMNDSRHENIVNFLEAYLKTEDDLWVVMEYMEGGSLTDIIENSPTNGSAYSPLS 685

Query: 102 QADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMT 161
           +  I   +  T +G+   H   I+HRD+K +N+LL    ++KI DFG    L        
Sbjct: 686 EPQIAYIVRETCKGLKFLHDKNIIHRDIKSDNVLLDTKARVKITDFGFCAKLTDQRSKRA 745

Query: 162 SNVVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELML-RIPYL 204
           + V T ++ APE++   + Y A VD+WS+G++  E++    PYL
Sbjct: 746 TMVGTPYWMAPEVV-KQKEYDAKVDVWSLGIMAIEMLEGEPPYL 788

>KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces
           cerevisiae YNL183c NPR1 ser/thr protein kinase, start by
           similarity
          Length = 774

 Score = 77.4 bits (189), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/205 (25%), Positives = 99/205 (48%), Gaps = 23/205 (11%)

Query: 10  KKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEI--------- 60
           + +G G    V L  R +D +  A+KE     F+   +  + R+  Y+++I         
Sbjct: 427 ENLGAGAGGSVRLMKRISDNQVFAVKE-----FRPKFEHESKRD--YVKKITSEYCIGTT 479

Query: 61  -RHANVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHC 119
            RH N+I  +++      +  V+E+   DL  ++  + + + +  I       L GV + 
Sbjct: 480 LRHPNIISTIEIVYENNRIFQVMEYCDYDLFAIVMSNKMSYEE--ICCCFKQILTGVEYL 537

Query: 120 HRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHE---FMTSNVV-TRWYRAPELL 175
           H   + HRD+K +N ++   G +K+ DFG A   + PH      +S +V +  Y APE+ 
Sbjct: 538 HSIGLAHRDMKLDNCVINNQGIVKLIDFGAAEVFSYPHSKTLIESSGIVGSDPYLAPEVC 597

Query: 176 FGARHYTAAVDLWSVGVIFAELMLR 200
              ++    VD+WSV ++FA ++L+
Sbjct: 598 IFTKYDPRPVDIWSVAILFACMVLK 622

>CAGL0G09020g 860266..861351 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, hypothetical start
          Length = 361

 Score = 76.3 bits (186), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 96/194 (49%), Gaps = 13/194 (6%)

Query: 10  KKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIR----EVKYLQEIRHANV 65
           + +G G++  V+L     +GR  AIK +K +Q    + M  I     E + L+ + H  +
Sbjct: 55  RTLGTGSFGRVHLVRSVHNGRYYAIKVLKKAQV---VKMKQIEHTNDERRMLKLVEHPFL 111

Query: 66  IELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFIL 125
           I +   F    NL +V++++       +   S  F     K +       + + H   I+
Sbjct: 112 IRMWGTFQDSRNLFMVMDYIEGGELFTLLRKSQRFPNPVAKFYAAEVTLALEYLHFHNII 171

Query: 126 HRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVV-TRWYRAPELLFGARHYTAA 184
           +RDLKP N+LL  +G +KI DFG A+ +    E +T  +  T  Y APE++   + Y  +
Sbjct: 172 YRDLKPENILLDRNGHIKITDFGFAKEV----ETVTWTLCGTPDYIAPEVI-ATKPYNKS 226

Query: 185 VDLWSVGVIFAELM 198
           VD WS+GV+  E++
Sbjct: 227 VDWWSLGVLIYEML 240

>Kwal_26.8751
          Length = 848

 Score = 77.4 bits (189), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 61/236 (25%), Positives = 112/236 (47%), Gaps = 32/236 (13%)

Query: 5   NYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHAN 64
           NY   K VGEG++  VYL       +++ +K           D + +REV Y ++  +++
Sbjct: 36  NYKILKIVGEGSFGKVYLASHCLTHQKVVLK------MGSKNDPNVVREVFYHRQFDYSH 89

Query: 65  VIELVDLFMAQENLNLVLEFLP---------ADLEMLIKDSSLLFTQADIKSWLLMTLRG 115
           + +L ++ + +  + + LE+ P         A   + +++ S LF+Q          +  
Sbjct: 90  ITKLYEVIVTENYVWMALEYCPGKELYEYLLAKKHIPLEECSELFSQ---------IVGA 140

Query: 116 VHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELL 175
           V++ H    +HRDLK  N+LL   G  K+ DFG  R  A     + +   T  Y APEL+
Sbjct: 141 VYYAHSMKCVHRDLKLENILLDKKGHAKLTDFGFTRECAT-KGILETICGTTVYMAPELI 199

Query: 176 FGARHYTAAVDLWSVGVI-FAELMLRIPYLPGRDDVDQIDVTFRALG-TPT-DKDW 228
               +    +D WS+G+I +  +   +P+    D+VD++   ++ +   PT D D+
Sbjct: 200 ERKPYEGYKIDTWSLGIILYTMIHGTMPF----DEVDEVKTKYKIVHYNPTYDNDY 251

>Scas_201.1*
          Length = 274

 Score = 75.5 bits (184), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 77/151 (50%), Gaps = 8/151 (5%)

Query: 53  EVKYLQEIRHANVIELVDLFMAQENLNLVLEFLPAD--LEMLIKDSSLLFTQADIKSWLL 110
           E+  LQ + H N++   D F +++   +V +        + +IK     FT+ D  + ++
Sbjct: 84  ELSILQRLHHPNIVAFKDWFESRDKFYIVTQLATGGELFDRIIKKGK--FTEVDAVNIMV 141

Query: 111 MTLRGVHHCHRSFILHRDLKPNNLLL---APDGQLKIADFGLARTLAAPHEFMTSNVVTR 167
             L  V + H   I+HRDLKP N+L    + + QL IADFG+A+ L +  + +     + 
Sbjct: 142 QLLDAVKYIHSQNIVHRDLKPENVLYLDPSDESQLVIADFGIAKELKSNDDLIFKGAGSL 201

Query: 168 WYRAPELLFGARHYTAAVDLWSVGVIFAELM 198
            Y APE+L    H     D+WS+GVI   L+
Sbjct: 202 GYVAPEVLTKEGH-GKPCDIWSLGVITYTLL 231

>AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W
           (SKM1) - SH] complement(246871..249252) [2382 bp, 793
           aa]
          Length = 793

 Score = 77.0 bits (188), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/223 (26%), Positives = 108/223 (48%), Gaps = 32/223 (14%)

Query: 10  KKVGEGTYAVVYLGHR------------------QTDGRQIAIKE-IKTSQFKDGLDMSA 50
           +K G+G    VYL  R                     G ++AIK+ I + Q +  L    
Sbjct: 502 EKAGQGASGSVYLAQRLKIPPYDENSGVSQHELNDNIGDKVAIKQMILSKQPRKEL---I 558

Query: 51  IREVKYLQEIRHANVIELVDLFMAQEN-LNLVLEFLPA-DLEMLIKDS------SLLFTQ 102
           + E+  +++ +H N++  ++ ++  E+ L +V+E++    L  +I++S          T+
Sbjct: 559 VNEILVMKDSQHKNIVNFLEAYLKTEDDLWVVMEYMEGGSLTDVIENSIGSDASESPMTE 618

Query: 103 ADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTS 162
             I   +  T +G+   H   I+HRD+K +N+LL   G++KI DFG    L        +
Sbjct: 619 PQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTHGRVKITDFGFCAKLTDKRSKRAT 678

Query: 163 NVVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELML-RIPYL 204
            V T ++ APE++   R Y   VD+WS+G++  E++    PYL
Sbjct: 679 MVGTPYWMAPEVV-KQREYDEKVDVWSLGIMTIEMLEGEPPYL 720

>Kwal_55.21545
          Length = 865

 Score = 77.0 bits (188), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 96/199 (48%), Gaps = 5/199 (2%)

Query: 6   YTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHA-N 64
           + + + +G G + VVY G+     +  AIK +      D ++    +E+++L  ++   N
Sbjct: 19  FKRTEVIGRGKFGVVYKGYYTKTKQVCAIKVLNLDSADDEVE-DVQKEIQFLSSLKQVPN 77

Query: 65  VIELVDLFMAQENLNLVLEFLPA-DLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSF 123
           +      ++    L +++E+     L  L++   +   +  I   +   L  + H H+  
Sbjct: 78  ITHYYGSYLNDTKLWVIMEYCAGGSLRTLLRPGKI--GEQYIGVIMRELLTALMHIHKDG 135

Query: 124 ILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTA 183
           ++HRD+K  N+L+  DG +K+ DFG+A  L+       +   T ++ APE++    +Y  
Sbjct: 136 VIHRDIKAANVLITNDGHIKLCDFGVAAQLSQTKIRRQTMAGTPYWMAPEVIMEGVYYDT 195

Query: 184 AVDLWSVGVIFAELMLRIP 202
            VD+WS+G+   E+    P
Sbjct: 196 KVDIWSLGITAYEIATGNP 214

>Scas_700.28
          Length = 896

 Score = 77.0 bits (188), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/201 (29%), Positives = 98/201 (48%), Gaps = 21/201 (10%)

Query: 5   NYTKEKKVGEGTYAVVYLG-HRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHA 63
           NY    ++GEG++  VYL  HR T  + +    +K+S   D  D + +REV Y ++  + 
Sbjct: 37  NYKILDQIGEGSFGKVYLAQHRPTHTKVV----LKSS---DKNDPNIVREVFYHRQFDYP 89

Query: 64  NVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTL-RGVHHCHRS 122
            + +L ++ + +  + + LE+ P   E+  +  S+     D    L   +  GVH+ H  
Sbjct: 90  YITKLYEVIITETKVWMALEYCPGK-ELYDRVLSMHRVPTDECVQLFAQIVGGVHYAHSL 148

Query: 123 FILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVV-----TRWYRAPELLFG 177
             +HRDLK  N+LL   G  K+ DFG  R      E MT   +     T  Y APEL+  
Sbjct: 149 NCVHRDLKLENILLDKSGDAKLTDFGFTR------ECMTKTTLETICGTTVYMAPELIER 202

Query: 178 ARHYTAAVDLWSVGVIFAELM 198
             +    +D+WS+GVI   ++
Sbjct: 203 KSYDGFKIDIWSLGVILYTMI 223

>YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase,
           required for metaphase DNA-damage checkpoint [1584 bp,
           527 aa]
          Length = 527

 Score = 76.6 bits (187), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 65/212 (30%), Positives = 105/212 (49%), Gaps = 13/212 (6%)

Query: 12  VGEGTYAVVYLGHRQTDGRQI-AIKEIKTSQFKD-GLDMSAIREVKYLQE--IRHANVIE 67
           VG+G +A V   H Q D   I A+K I     K  GL    I +   LQ    +H NV+ 
Sbjct: 21  VGQGAFACVKNAHLQMDPSIILAVKFIHVPTCKKMGLSDKDITKEVVLQSKCSKHPNVLR 80

Query: 68  LVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTL-RGVHHCH-RSFIL 125
           L+D  +++E + ++LE      ++  K    +   +D+  +    L   +++ H    + 
Sbjct: 81  LIDCNVSKEYMWIILEMADGG-DLFDKIEPDVGVDSDVAQFYFQQLVSAINYLHVECGVA 139

Query: 126 HRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRW---YRAPELLFGARHYT 182
           HRD+KP N+LL  +G LK+ADFGLA         +  ++  R    Y APE+L+    Y 
Sbjct: 140 HRDIKPENILLDKNGNLKLADFGLASQFRRKDGTLRVSMDQRGSPPYMAPEVLYSEEGYY 199

Query: 183 A-AVDLWSVGV-IFAELMLRIPY-LPGRDDVD 211
           A   D+WS+G+ +F  L  + P+ LP  ++ D
Sbjct: 200 ADRTDIWSIGILLFVLLTGQTPWELPSLENED 231

>ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH]
           complement(731433..736142) [4710 bp, 1569 aa]
          Length = 1569

 Score = 77.0 bits (188), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 81/152 (53%), Gaps = 8/152 (5%)

Query: 5   NYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHAN 64
           +Y   K + +G Y  VYL +++  G   AIK ++ S       ++ ++  + +  ++   
Sbjct: 681 DYDIIKPISKGAYGSVYLAYKRITGEYFAIKVLRKSDMIAKNQVTNVKSERVIMMVQSEK 740

Query: 65  --VIELVDLFMAQENLNLVLEFLPA-DLEMLIKDSSLLFTQAD--IKSWLLMTLRGVHHC 119
             V +L   F  +ENL LV+E+L   DL  LIK   ++    D   K ++   + GV   
Sbjct: 741 PYVAKLYATFQNKENLFLVMEYLSGGDLATLIK---MMGNLPDKWAKQYITEVIIGVDDM 797

Query: 120 HRSFILHRDLKPNNLLLAPDGQLKIADFGLAR 151
           H S I+H DLKP+NLL+  +G +K+ DFGL+R
Sbjct: 798 HMSGIIHHDLKPDNLLIDSNGHVKLTDFGLSR 829

>CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces
           cerevisiae YBR274w CHK1 regulats inhibitory Cdk
           phosphorylation of PDS1, start by similarity
          Length = 528

 Score = 76.6 bits (187), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 101/208 (48%), Gaps = 11/208 (5%)

Query: 12  VGEGTYAVVYLGHRQTDGRQI-AIKEIKT-SQFKDGLDMSAI-REVKYLQEI-RHANVIE 67
           +GEG++  V     + D   + A+K +   +  + GL    + REV    +  +HANV+ 
Sbjct: 20  IGEGSFGCVRSARLKFDSSVVVAVKFVHLPTCAESGLSQKDVSREVVLHSKCSKHANVLR 79

Query: 68  LVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTL-RGVHHCHRSFILH 126
           ++D  +  E L ++LE      ++  K    +    D+  +    L R +++ H   + H
Sbjct: 80  VIDCNVGGEYLWIMLEMADGG-DLFDKIEPDVGVDPDVAQFYFQQLIRALNYLHDVGVAH 138

Query: 127 RDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRW---YRAPELLFGARHYTA 183
           RD+KP N+LL   G LK+ADFGLA         +  +   R    Y APE+L    +Y  
Sbjct: 139 RDIKPENILLDKKGNLKLADFGLASQFRRKDGTLRVSTDQRGSPPYMAPEILSSQGYYAN 198

Query: 184 AVDLWSVGV-IFAELMLRIPY-LPGRDD 209
             D+WS GV +F  L   IP+ +P ++D
Sbjct: 199 ITDIWSAGVLLFVLLTGEIPWSIPAKED 226

>YFL033C (RIM15) [1651] chr6 complement(69113..74425)
           Serine/threonine protein kinase, positive regulator of
           IME2 expression and of sporulation [5313 bp, 1770 aa]
          Length = 1770

 Score = 77.0 bits (188), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 56/161 (34%), Positives = 84/161 (52%), Gaps = 17/161 (10%)

Query: 10  KKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHANVIE-- 67
           K + +G Y  VYL  ++  G   AIK ++ S      DM A  +V  ++  R   +++  
Sbjct: 798 KPISKGAYGSVYLARKKLTGDYFAIKVLRKS------DMIAKNQVTNVKSERAIMMVQSD 851

Query: 68  ------LVDLFMAQENLNLVLEFLPA-DLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCH 120
                 L   F  ++NL LV+E+LP  DL  LIK    L  Q   K +L   + GV+  H
Sbjct: 852 KPYVARLFASFQNKDNLFLVMEYLPGGDLATLIKMMGYLPDQW-AKQYLTEIVVGVNDMH 910

Query: 121 RSFILHRDLKPNNLLLAPDGQLKIADFGLART-LAAPHEFM 160
           ++ I+H DLKP NLL+   G +K+ DFGL+R  L   H+F+
Sbjct: 911 QNGIIHHDLKPENLLIDNAGHVKLTDFGLSRAGLIRRHKFV 951

 Score = 34.7 bits (78), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 42/109 (38%), Gaps = 22/109 (20%)

Query: 169  YRAPELLFGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDW 228
            Y APE + G        D WSVG IF EL+L  P        +  D  F+ + +   + W
Sbjct: 1153 YLAPETIEGKGEDNKQCDWWSVGCIFFELLLGYPPF----HAETPDAVFKKILSGVIQ-W 1207

Query: 229  PEVSSFSAYNKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKR 277
            PE  +     +                   T  A DL+  +L +DP KR
Sbjct: 1208 PEFKNEEEEREF-----------------LTPEAKDLIEKLLVVDPAKR 1239

>YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine protein
           kinase involved in sensitivity to salt [1812 bp, 603 aa]
          Length = 603

 Score = 76.3 bits (186), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 91/200 (45%), Gaps = 19/200 (9%)

Query: 12  VGEGTYAVVYLGHRQT----DGRQ----IAIKEIK--TSQFKDGLDMSAIREVKYLQEIR 61
           +G+G + VV +  ++     DG +     A+KE K  TS+  +        E      + 
Sbjct: 322 LGKGAFGVVRICQKKNVSSQDGNKSEKLYAVKEFKRRTSESAEKYSKRLTSEFCISSSLH 381

Query: 62  HANVIELVDLFM-AQENLNLVLEFLPAD--LEMLIKDSSLLFTQADIKSWLLMTLRGVHH 118
           H N++  +DLF  A+     V+E+        +++    L + +AD   +    +RGV +
Sbjct: 382 HTNIVTTLDLFQDAKGEYCEVMEYCAGGDLFTLVVAAGKLEYMEADC--FFKQLIRGVVY 439

Query: 119 CHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHE---FMTSNVV-TRWYRAPEL 174
            H   + HRDLKP NLLL  DG LKI DFG +       E    ++  V  +  Y APE 
Sbjct: 440 MHEMGVCHRDLKPENLLLTHDGVLKITDFGNSECFKMAWEKNIHLSGGVCGSSPYIAPEE 499

Query: 175 LFGARHYTAAVDLWSVGVIF 194
                     VD+W+ GVI+
Sbjct: 500 YIKEEFDPRPVDIWACGVIY 519

>CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces
           cerevisiae YPL209c IPL1 ser/thr protein kinase, start by
           similarity
          Length = 358

 Score = 75.5 bits (184), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 104/198 (52%), Gaps = 11/198 (5%)

Query: 10  KKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIR----HANV 65
           +K+G+G +  VY    +  G   A+K I+ ++    L  + ++++K   +I+    H N+
Sbjct: 104 RKLGKGKFGKVYCVRHKKSGFICALKAIEKNEI---LQFNLLKQLKREVDIQLGMDHPNI 160

Query: 66  IELVDLFMAQENLNLVLEF-LPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFI 124
           I+L   F  ++ + L++E  +  +L   +K++   F       ++      +H+ H+  I
Sbjct: 161 IKLYAHFHDEKRVYLLMEHSINGELYKSLKNNGP-FNDVLASHYIYQIADALHYMHKKRI 219

Query: 125 LHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAA 184
           +HRD+KP N+L+  D  +K+ADFG +  L        +   T  Y +PE++   R Y   
Sbjct: 220 IHRDVKPENVLIGFDNVVKLADFGWS-ILNPEGSKRKTLCGTIDYLSPEMI-TPREYDEQ 277

Query: 185 VDLWSVGVIFAELMLRIP 202
           VD+W++GV+  EL++ +P
Sbjct: 278 VDVWALGVLAYELVVGVP 295

>KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062
           Saccharomyces cerevisiae YPL141c, start by similarity
          Length = 909

 Score = 76.3 bits (186), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 53/194 (27%), Positives = 94/194 (48%), Gaps = 8/194 (4%)

Query: 12  VGEGTYAVVYLGHRQT---DGRQIAIKEIKTSQFKDGLD--MSAIREVKYLQEIRHANVI 66
           +GEG +  V LG  ++   + + +AIK I+        +  +   RE+  L+ + H N++
Sbjct: 62  LGEGEFGKVKLGWSKSNSDESKNVAIKLIRRDTIPKNSEKEVKIYREINALKHLAHPNIV 121

Query: 67  ELVDLFMAQENLNLVLEFLPA-DLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFIL 125
            L ++    + + +VL +    +    I+    L   A  + +  + + GVH+ H   + 
Sbjct: 122 TLEEVLQNSKYIGIVLHYASGGEFYKYIQKKRRLKEPAACRLFAQL-ISGVHYMHHKGLA 180

Query: 126 HRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTA-A 184
           HRDLK  NLLL     L I DFG     ++ ++ M ++  +  Y APEL+   + Y A  
Sbjct: 181 HRDLKLENLLLDEHENLIITDFGFVNEFSSRNDLMKTSCGSPCYAAPELVVTTKAYEARK 240

Query: 185 VDLWSVGVIFAELM 198
            D+WS GVI   ++
Sbjct: 241 ADVWSCGVILYAML 254

>Scas_628.9
          Length = 621

 Score = 76.3 bits (186), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 57/197 (28%), Positives = 91/197 (46%), Gaps = 17/197 (8%)

Query: 12  VGEGTYAVVYLGHRQTDGRQ-----IAIKEIK--TSQFKDGLDMSAIREVKYLQEIRHAN 64
           +G+G +  V + H++ D +Q      A+KE K  +S+  +        E      + H N
Sbjct: 341 LGKGAFGTVRICHKK-DPKQEKELLFAVKEFKKKSSEPFEKYSKRLTSEFCISSSLHHIN 399

Query: 65  VIELVDLFM-AQENLNLVLEFLPAD--LEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHR 121
           ++  +DLF  A+     V+E+        +++    L + +AD   +    +RGV + H 
Sbjct: 400 IVTTLDLFQDAKGEYCEVMEYCSGGDLFSLIVSAGKLEYAEADC--FFKQLMRGVVYMHD 457

Query: 122 SFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHE---FMTSNVV-TRWYRAPELLFG 177
             + HRDLKP NLLL  DG LKI DFG +       E    ++  V  +  Y APE    
Sbjct: 458 MGVSHRDLKPENLLLTSDGVLKITDFGNSECFKMAWEDDIHLSGGVCGSSPYIAPEEYIK 517

Query: 178 ARHYTAAVDLWSVGVIF 194
                  VD+W+ GVI+
Sbjct: 518 EEFDPRCVDIWACGVIY 534

>ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..683847)
            [3450 bp, 1149 aa]
          Length = 1149

 Score = 76.3 bits (186), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 70/262 (26%), Positives = 122/262 (46%), Gaps = 16/262 (6%)

Query: 10   KKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYL----QEIRHANV 65
            K +G+G +  V L   +   R  AIK +K        D+ + R  K +     + +H  +
Sbjct: 826  KVLGKGNFGKVLLARSKNTDRLCAIKVLKKDHIIQNHDIESARAEKKVFLLATKAKHPFL 885

Query: 66   IELVDLFMAQENLNLVLEFLPA-DLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFI 124
              L   F  +  +   +EF+   DL   +++  L   +A  K +    L  + + H + I
Sbjct: 886  TNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQRLSVRRA--KFYAAEVLLALKYFHDNGI 943

Query: 125  LHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAA 184
            ++RDLK  N+LL  +G +KIAD+GL +         ++   T  + APE+L   + YT A
Sbjct: 944  IYRDLKLENILLTLEGHIKIADYGLCKDEMWFGNRTSTFCGTPEFMAPEIL-REQAYTKA 1002

Query: 185  VDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDWPEVSSFSAYNKIQVYP 244
            VD W+ GV+  +++L      G DD D++   F A+ T    D P      A + +Q++ 
Sbjct: 1003 VDWWAFGVLLYQMLLCQSPFSG-DDEDEV---FNAILT----DEPLYPIDMAGDIVQIFQ 1054

Query: 245  PPSRSELRSRFIAATENALDLM 266
                 +   R  A + +AL++M
Sbjct: 1055 GLLTKDPEKRLGAGSRDALEVM 1076

>Kwal_27.9773
          Length = 406

 Score = 75.9 bits (185), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 103/236 (43%), Gaps = 43/236 (18%)

Query: 10  KKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHANVIELV 69
           +++G G++  V         R +  KEIK            I E   L +++H N++E  
Sbjct: 23  EEIGRGSFGSVRKVVHVPTNRVLVRKEIKYGHMNSKERQQLISECAILSQLKHENIVEFY 82

Query: 70  DLFMAQENLNLVLEFLP-ADLEMLI---KDSSLLFTQADIKSWLLMTLRGVHHCH----- 120
           +     + L   +E+    DL  +I   K       +  + S ++  L  ++ CH     
Sbjct: 83  EWDSDVDVLYFYMEYCSNGDLSQMISHFKKERKYIPERLVWSVMVQVLVALYRCHYGSDL 142

Query: 121 ----------------RSFILHRDLKPNNLLLA----PDGQL------------KIADFG 148
                            + ++HRDLKP N+ L+    PD ++            K+ DFG
Sbjct: 143 APLETIYDRMKPPVKGSNVVIHRDLKPGNIFLSTERVPDARVALQAFDYSKISVKLGDFG 202

Query: 149 LARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELM-LRIPY 203
           LA++L A  EF T+ V T +Y +PE+L   + Y+   D+WS+G +  E+  LR P+
Sbjct: 203 LAKSLGASVEFATTYVGTPYYMSPEVLMD-QPYSPLSDIWSLGCVIYEMCTLRPPF 257

>Scas_653.25
          Length = 666

 Score = 76.3 bits (186), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 99/209 (47%), Gaps = 15/209 (7%)

Query: 10  KKVGEGTYAVVYLGHRQTDGRQIAIKEIK---TSQFKDGLDMSAIREVKYLQEIRHANVI 66
           +K+G G    V      ++ ++ A+K  K     +         I+E      + H N+I
Sbjct: 273 QKLGSGANGCVVQLQNHSNDKRFAMKTFKPNPNGETTKQYQKRCIKEFILSSHLSHPNII 332

Query: 67  ELVDLFMAQE-NLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFIL 125
           E +D+F      ++ ++E+ P D   ++   + L T+ +   +      GV + H   I 
Sbjct: 333 ETLDIFYNPSGQISEIMEWCPHDFFNIVMSRTHLLTRRETFCYFKQLCNGVRYLHTLGIA 392

Query: 126 HRDLKPNNLLLAPDGQLKIADFG------LARTLAAPHEFMTSN--VVTRWYRAPELLFG 177
           HRDLK +N ++  +G LK+ DFG      L ++     E + S   V +  Y APE+L  
Sbjct: 393 HRDLKLDNCVITYNGILKLIDFGSATIFQLNKSTEEKPELIPSRGIVGSDPYLAPEVLLS 452

Query: 178 AR-HYTAAV-DLWSVGVIFAELML-RIPY 203
               Y A++ D+WS+G+IF  +ML R P+
Sbjct: 453 KEIPYDASLADVWSLGIIFCAIMLKRFPW 481

>Kwal_56.24059
          Length = 353

 Score = 75.5 bits (184), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 93/193 (48%), Gaps = 11/193 (5%)

Query: 10  KKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIR----EVKYLQEIRHANV 65
           + +G G++  V+L     +GR  AIK +K  Q    + M  I     E + L+ + H  +
Sbjct: 47  RTLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQV---IRMKQIEHTNDERRMLKLVDHPFL 103

Query: 66  IELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFIL 125
           I +   F    NL +V++++       +   S  F     K +    +  + + H   I+
Sbjct: 104 IRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHSHDII 163

Query: 126 HRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAAV 185
           +RDLKP N+LL  +G +KI DFG A+ +      +     T  Y APE++   + Y  +V
Sbjct: 164 YRDLKPENILLDRNGHIKITDFGFAKEVDTVTWTLCG---TPDYIAPEVI-ATKPYNKSV 219

Query: 186 DLWSVGVIFAELM 198
           D WS+G++  E++
Sbjct: 220 DWWSLGILIFEML 232

>CAGL0M02519g complement(290723..292993) highly similar to tr|Q03002
           Saccharomyces cerevisiae YPL141c or sp|Q01919
           Saccharomyces cerevisiae YOR233w KIN4, hypothetical
           start
          Length = 756

 Score = 76.3 bits (186), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 90/189 (47%), Gaps = 7/189 (3%)

Query: 30  RQIAIKEIKTSQF-KDGLDMSAI-REVKYLQEIRHANVIELVDLFMAQENLNLVLEFLPA 87
           +Q+AIK IK     KD    + I RE+  L+ + H N+++L ++    + + +VLE+   
Sbjct: 92  KQVAIKLIKRDFITKDPSKETKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYAAG 151

Query: 88  -DLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAPDGQLKIAD 146
            +    I+    L      + +  + +  VH+ H   ++HRDLK  NLLL  +  L I D
Sbjct: 152 GEFYKFIQRKRRLKENHACRLFSQL-ISAVHYIHSKGLVHRDLKLENLLLDNEENLIITD 210

Query: 147 FGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTA-AVDLWSVGVIFAELMLRIPYLP 205
           FG        +  M ++  +  Y APEL+   R Y A   D WS G+I   ++    YLP
Sbjct: 211 FGFVNEFLRQNGMMKTSCGSPCYAAPELVVSNRPYDARKADTWSCGIILFAML--AGYLP 268

Query: 206 GRDDVDQID 214
             DD    D
Sbjct: 269 WDDDPKNPD 277

>Kwal_23.5290
          Length = 819

 Score = 76.3 bits (186), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 60/222 (27%), Positives = 107/222 (48%), Gaps = 31/222 (13%)

Query: 10  KKVGEGTYAVVYLGHRQT-----------------DGRQIAIKE-IKTSQFKDGLDMSAI 51
           +K G+G    VYL  R                    G ++AIK+ I + Q +  L    +
Sbjct: 529 EKAGQGASGSVYLAQRTQLPAYGEGGLNEQIGEPEIGDKVAIKQMILSKQPRKEL---IV 585

Query: 52  REVKYLQEIRHANVIELVDLFMAQEN-LNLVLEFLPA-DLEMLIKDSSL------LFTQA 103
            E+  +++ +H N++  ++ ++  E+ L +V+E++    L  LI++S          T+ 
Sbjct: 586 NEILVMKDSQHKNIVNFLEAYLKTEDDLWVVMEYMEGGSLTDLIENSPANGSSHSPLTEP 645

Query: 104 DIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSN 163
            I   +  T +G+   H   I+HRD+K +N+LL    ++KI DFG    L        + 
Sbjct: 646 QIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDNRARVKITDFGFCAKLTDKRSKRATM 705

Query: 164 VVTRWYRAPELLFGARHYTAAVDLWSVGVIFAELML-RIPYL 204
           V T ++ APE++   R Y   VD+WS+G++  E++    PYL
Sbjct: 706 VGTPYWMAPEVV-KQREYDEKVDVWSLGIMTIEMLEGEPPYL 746

>Scas_700.35
          Length = 439

 Score = 75.5 bits (184), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 109/237 (45%), Gaps = 28/237 (11%)

Query: 12  VGEGTYAVVYLGHRQTDGRQI-AIKEIKTSQFKDGLDMSAIREVKYLQEIRHANVIELVD 70
           +GEG    V     + +  Q+ A+K I T            RE+++ +  +   ++    
Sbjct: 155 LGEGAGGSVAKCRLRKNSSQVFALKTINTLNTDPEFQKQLFRELEFNKSFKSNYIVTYYG 214

Query: 71  LFMAQEN--LNLVLEFLPA-DLEMLIKDSSLLFTQADIKSWLL-----MTLRGVHHCHRS 122
           +F    N  + + +E++    L+ + K  SLL     I   +L       LRG+ + H  
Sbjct: 215 MFNDTLNGSIYIAMEYMGGQSLDTIYK--SLLSRGGRIGEKILGKIAESVLRGLSYLHER 272

Query: 123 FILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYT 182
            I+HRD+KP N+LL  +G++K+ DFG++    A +   T+   T +Y APE + G   Y+
Sbjct: 273 KIIHRDIKPQNILLNEEGEVKLCDFGVSG--EAVNSLATTFTGTSFYMAPERIQG-HPYS 329

Query: 183 AAVDLWSVGVIFAELML-RIPYLPGRDDVDQIDVTFRALG--------TPTDKDWPE 230
              D+WS+G+   E+   R P+     D D+I  T   +         TP  KD PE
Sbjct: 330 VTCDVWSLGLTILEVAQGRFPF-----DSDKITTTIAPIDLLMLILTFTPELKDEPE 381

>Kwal_47.18307
          Length = 621

 Score = 75.5 bits (184), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 104/223 (46%), Gaps = 30/223 (13%)

Query: 11  KVGEGTYAVVYLG-HRQTDGRQIAIKEIKTSQFKDGLDMSAIRE--VKY----------L 57
           ++G+G+Y+ VY    R   GR  AIK               IRE  VKY          L
Sbjct: 15  RLGQGSYSTVYRAVERSNSGRNYAIKVCSKKHI--------IREKKVKYVTIEKDLLNML 66

Query: 58  QEIRHANVIELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTL-RGV 116
            +  H  +++L   F   ENL  VLE++    E+L     L     D+   +   L   V
Sbjct: 67  AKGGHLGIVKLFCTFHDIENLYFVLEYVSGG-ELLALIQRLGRLTEDLSRHITAQLVDTV 125

Query: 117 HHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEF-----MTSNVVTRWYRA 171
            + H   ++HRDLKP N+LL+ +G++ I DFG A T AA  +F       S V T  Y +
Sbjct: 126 DYMHSKGVIHRDLKPENVLLSQEGRVVITDFGAACT-AADRKFENTKRTASFVGTAEYVS 184

Query: 172 PELLFGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQID 214
           PELL  ++   ++ D+W++G I  +L    P   G +++   +
Sbjct: 185 PELLLHSQCGFSS-DIWALGCIIYQLNQGKPPFRGENELQTFE 226

>KLLA0D07304g 623352..624749 some similarities with sp|P32491
           Saccharomyces cerevisiae YPL140c MKK2 protein kinase of
           the map kinase kinase (MEK) family, hypothetical start
          Length = 465

 Score = 75.1 bits (183), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 96/194 (49%), Gaps = 14/194 (7%)

Query: 12  VGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHANVIELVDL 71
           +GEGT   V     +   +  A+K I T +  DG +    RE+++ +  +   ++    +
Sbjct: 185 LGEGTGGSVTKCKLRNGSKIFALKTIATIE-NDGSEKQIFRELQFNKSCKSDFIVRYYGM 243

Query: 72  FMAQEN--LNLVLEFLPA-DLEMLIKDSSLLFTQADIKSWLL-----MTLRGVHHCHRSF 123
           F  +E   + + +E++    L+ + K   LL     I   +L       LRG+ + H   
Sbjct: 244 FACEETSTIFIAMEYMGGRSLDSVYKH--LLSKGGRIGEKVLGKIAESVLRGLFYLHERK 301

Query: 124 ILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTA 183
           I+HRD+KP N+L    GQ+K+ DFG++    A +   T+   T +Y APE + G + Y+ 
Sbjct: 302 IIHRDIKPQNILFNEIGQIKLCDFGVSG--EAVNSLATTFTGTSYYMAPERIQG-QPYSV 358

Query: 184 AVDLWSVGVIFAEL 197
             D+WS+G+   E+
Sbjct: 359 TSDVWSLGLTLLEV 372

>AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH]
           (1005431..1006945) [1515 bp, 504 aa]
          Length = 504

 Score = 75.1 bits (183), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 91/195 (46%), Gaps = 14/195 (7%)

Query: 12  VGEGTYAVVYLGHRQ-TDGRQI--AIKEIKTSQFKDGLDMSA--IREVKYLQEIRHANVI 66
           +G+G + VV + H++  +G +   A+KE K    +D    S     E      ++H N+I
Sbjct: 228 IGKGAFGVVRICHKKDANGTEALYAVKEFKKRPSEDQEKYSRRLTSEFCLSSSLKHTNII 287

Query: 67  ELVDLFM-AQENLNLVLEFLPAD--LEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSF 123
             +DLF  A+ +   V+E+        +++    L + +AD   +    +RGV + H   
Sbjct: 288 NTLDLFQDAKGDYCEVMEYCSGGDLFSLIVTAGKLEYMEADC--FFKQMIRGVVYMHDMG 345

Query: 124 ILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHE---FMTSNVV-TRWYRAPELLFGAR 179
           + HRDLKP NL+L  +G LKI DFG         E    ++  V  +  Y APE      
Sbjct: 346 VCHRDLKPENLILTANGVLKITDFGNGECFRMAWEKDIHLSGGVCGSSPYIAPEEYSMEE 405

Query: 180 HYTAAVDLWSVGVIF 194
                VD+W+ G I+
Sbjct: 406 FDPRPVDIWACGTIY 420

>KLLA0D03190g 267933..269051 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, start by similarity
          Length = 372

 Score = 74.7 bits (182), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 92/193 (47%), Gaps = 11/193 (5%)

Query: 10  KKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIR----EVKYLQEIRHANV 65
           + +G G++  V+L     +GR  AIK +K  Q    + M  I     E + L+ + H  +
Sbjct: 66  RTLGTGSFGRVHLVRSVHNGRYYAIKVLKKHQI---IRMKQIEHTNDERRMLKLVEHPFL 122

Query: 66  IELVDLFMAQENLNLVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCHRSFIL 125
           I +   F    NL +V++++       +   S  F     K +       + + H   I+
Sbjct: 123 IRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHSHNII 182

Query: 126 HRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLFGARHYTAAV 185
           +RDLKP N+LL  +G +KI DFG A+ +      +     T  Y APE++   + Y  +V
Sbjct: 183 YRDLKPENILLDRNGHIKITDFGFAKEVITVTWTLCG---TPDYIAPEVI-TTKPYNKSV 238

Query: 186 DLWSVGVIFAELM 198
           D WS+G++  E++
Sbjct: 239 DWWSLGILIFEML 251

>Scas_685.24
          Length = 515

 Score = 75.1 bits (183), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 55/213 (25%), Positives = 105/213 (49%), Gaps = 9/213 (4%)

Query: 3   AVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRH 62
           A NY  ++ VG G +  VY    +T  + +AIK +      + L++ A +E+ +L E++ 
Sbjct: 19  AHNYIVKECVGRGNFGDVYRAIDRTTNKVVAIKVVDLENTNERLEVLA-QEIFFLAELKS 77

Query: 63  ANVIELVDLFMAQENLNLVLEFLP----ADLEMLIKDSSLLFTQADIKSWLLMTLRGVHH 118
             +I  +   +   ++ +V+E+      +DL     ++ L   +  +       L+G+ +
Sbjct: 78  PYIINYITTLLEDASMWIVMEYCGGGSCSDLLKYYFNNGL--PEKKVAYITREILKGLQY 135

Query: 119 CHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAPHEFMTSNVVTRWYRAPELLF-G 177
            H    +HRD+K  N+LL  +G +K+ DFG++  L +     T  V T ++ APE+    
Sbjct: 136 LHEQKKIHRDIKAANILLTEEGHVKLGDFGVSGQLKSTLRRGTI-VGTPYWMAPEVASQN 194

Query: 178 ARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDV 210
              Y   +D+WS+G+   EL+  +P L   D +
Sbjct: 195 IEGYDEKIDIWSLGITVFELLKGVPPLVKLDPI 227

>CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces
           cerevisiae YFL033c RIM15 protein kinase involved in
           expression of meiotic genes, hypothetical start
          Length = 1682

 Score = 75.5 bits (184), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 78/151 (51%), Gaps = 16/151 (10%)

Query: 10  KKVGEGTYAVVYLGHRQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHANVIE-- 67
           K + +G Y  VYL  ++  G   AIK ++ S      DM A  +V  ++  R   +++  
Sbjct: 786 KPISKGAYGSVYLARKKLTGDYFAIKVLRKS------DMIAKNQVTNVKSERAIMMVQSD 839

Query: 68  ------LVDLFMAQENLNLVLEFLPA-DLEMLIKDSSLLFTQADIKSWLLMTLRGVHHCH 120
                 L   F  ++NL LV+E+LP  DL  L+K    L  +  +K +L   + GV   H
Sbjct: 840 KPYVARLYATFQNKDNLFLVMEYLPGGDLATLLKMMGCLPDEW-VKQYLSEIIIGVEDMH 898

Query: 121 RSFILHRDLKPNNLLLAPDGQLKIADFGLAR 151
            + I+H DLKP NLL+   G LK+ DFGL+R
Sbjct: 899 NNGIIHHDLKPENLLIDVSGHLKLTDFGLSR 929

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 40/109 (36%), Gaps = 23/109 (21%)

Query: 169  YRAPELLFGARHYTAAVDLWSVGVIFAELMLRIPYLPGRDDVDQIDVTFRALGTPTDKDW 228
            Y APE + G        D WSVG I  E++   P        +  D  FR +      DW
Sbjct: 1109 YLAPETIEGTGE-DNQCDWWSVGCILFEMVFGYPPF----HAETPDQVFRNI-LEGKIDW 1162

Query: 229  PEVSSFSAYNKIQVYPPPSRSELRSRFIAATENALDLMCGMLTMDPHKR 277
            P    F +  + + Y  P               A DL+   L  DPHKR
Sbjct: 1163 P---IFDSIEEEREYISPE--------------AKDLIMKFLITDPHKR 1194

>Scas_651.19
          Length = 801

 Score = 74.7 bits (182), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 65/228 (28%), Positives = 102/228 (44%), Gaps = 45/228 (19%)

Query: 12  VGEGTYAVVYLGHRQ-------------TDGRQI--AIKEIK--------------TSQF 42
           +G G Y VV +  R              ++G+++  A+KE+K              TS+F
Sbjct: 495 IGHGAYGVVKVCARPLNPNIDETPLQTFSNGQKLFFAVKELKLKNATQTEKFSTRITSEF 554

Query: 43  KDGLDMSAIREVKYLQEIRHANVIELVDLFMAQENLNLVLEFLPA-DLEMLIKDSSLLFT 101
             G  +S  R  K    +   N+++++DL    +    V+EF P+ DL  L+   S   T
Sbjct: 555 IIGHSLS--RSHKKGDRVS-PNILKIIDLLENNDTFFEVMEFCPSGDLYSLLTRKSKNGT 611

Query: 102 -----QADIKSWLLMTLRGVHHCHRSFILHRDLKPNNLLLAPDGQLKIADFGLARTLAAP 156
                +AD   ++   L GV + H   + H DLKP N+L  PDG LKI DFG +      
Sbjct: 612 ALHPLEADC--FMKQLLHGVKYMHDHGVAHCDLKPENILFHPDGLLKICDFGTSCVFQTA 669

Query: 157 HE----FMTSNVVTRWYRAPELLFGARHYTAA-VDLWSVGVIFAELML 199
            E    F +  + +  Y APE     + Y    VD WS GV++  +++
Sbjct: 670 WEKHVHFQSGAMGSEPYVAPEEFISGKEYDPRLVDCWSCGVVYCTMVM 717

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.137    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,530,788
Number of extensions: 377170
Number of successful extensions: 2568
Number of sequences better than 10.0: 647
Number of HSP's gapped: 1570
Number of HSP's successfully gapped: 697
Length of query: 300
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 199
Effective length of database: 13,099,691
Effective search space: 2606838509
Effective search space used: 2606838509
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)