Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL282W37236519450.0
Sklu_1484.137634510271e-139
KLLA0E14784g3793509631e-129
Kwal_23.34753823248861e-117
YDL107W (MSS2)3513506276e-79
Scas_613.123483356277e-79
CAGL0H10296g3733355757e-71
CAGL0D01364g1148196701.3
KLLA0D04136g38282672.3
Kwal_14.214134269663.2
CAGL0M00924g130347654.6
Kwal_14.2369725113645.7
YDR347W (MRP1)32167636.2
Sklu_2276.350580637.2
Scas_516.750880637.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL282W
         (365 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL282W [1459] [Homologous to ScYDL107W (MSS2) - SH] complement(...   753   0.0  
Sklu_1484.1 YDL107W, Contig c1484 197-1327 reverse complement         400   e-139
KLLA0E14784g complement(1321041..1322180) similar to sp|P40990 S...   375   e-129
Kwal_23.3475                                                          345   e-117
YDL107W (MSS2) [762] chr4 (268921..269976) Protein involved in t...   246   6e-79
Scas_613.12                                                           246   7e-79
CAGL0H10296g complement(1004900..1006021) similar to sp|P40990 S...   226   7e-71
CAGL0D01364g 152033..155479 similar to sp|P14922 Saccharomyces c...    32   1.3  
KLLA0D04136g 350976..352124 weakly similar to sp|Q9USQ4 Schizosa...    30   2.3  
Kwal_14.2141                                                           30   3.2  
CAGL0M00924g 102735..106646 similar to tr|Q06673 Saccharomyces c...    30   4.6  
Kwal_14.2369                                                           29   5.7  
YDR347W (MRP1) [1174] chr4 (1169168..1170133) Mitochondrial ribo...    29   6.2  
Sklu_2276.3 YBR126C, Contig c2276 3772-5289                            29   7.2  
Scas_516.7                                                             29   7.2  

>ADL282W [1459] [Homologous to ScYDL107W (MSS2) - SH]
           complement(206313..207431) [1119 bp, 372 aa]
          Length = 372

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/365 (100%), Positives = 365/365 (100%)

Query: 1   MLTPMTNPLRLIGAGCRFLSTNNRPPLHKIFPSKKLVNRMLFDLDSRLTFRKLLPVYEQV 60
           MLTPMTNPLRLIGAGCRFLSTNNRPPLHKIFPSKKLVNRMLFDLDSRLTFRKLLPVYEQV
Sbjct: 1   MLTPMTNPLRLIGAGCRFLSTNNRPPLHKIFPSKKLVNRMLFDLDSRLTFRKLLPVYEQV 60

Query: 61  YTQLDSSTGDLVVPRGVRAHDVMIMKKVLEKTRRRTKSSNRHLLALENELLYMAAQMGHK 120
           YTQLDSSTGDLVVPRGVRAHDVMIMKKVLEKTRRRTKSSNRHLLALENELLYMAAQMGHK
Sbjct: 61  YTQLDSSTGDLVVPRGVRAHDVMIMKKVLEKTRRRTKSSNRHLLALENELLYMAAQMGHK 120

Query: 121 DAAALLAFDTLCNPASQTAADMEYAKLMVKDFYRSGHPLTLKLTGDLSLANGDNTTAEEY 180
           DAAALLAFDTLCNPASQTAADMEYAKLMVKDFYRSGHPLTLKLTGDLSLANGDNTTAEEY
Sbjct: 121 DAAALLAFDTLCNPASQTAADMEYAKLMVKDFYRSGHPLTLKLTGDLSLANGDNTTAEEY 180

Query: 181 YMKFLKKEADTFLAGEVYGQLGRISFLRSHFAQAEERFLQAIKLTPLEYSVQSYFYLGQL 240
           YMKFLKKEADTFLAGEVYGQLGRISFLRSHFAQAEERFLQAIKLTPLEYSVQSYFYLGQL
Sbjct: 181 YMKFLKKEADTFLAGEVYGQLGRISFLRSHFAQAEERFLQAIKLTPLEYSVQSYFYLGQL 240

Query: 241 YMNSDPLKARSLLESAASQGFKESFKTLGHLEMNYFCDLTKAREWFKLGMELGELECMIG 300
           YMNSDPLKARSLLESAASQGFKESFKTLGHLEMNYFCDLTKAREWFKLGMELGELECMIG
Sbjct: 241 YMNSDPLKARSLLESAASQGFKESFKTLGHLEMNYFCDLTKAREWFKLGMELGELECMIG 300

Query: 301 CFDCAITLGDLALAHRASKSLEALAKTDKIYQALYTQFADYRHEKLSLLEEYKAEKALDV 360
           CFDCAITLGDLALAHRASKSLEALAKTDKIYQALYTQFADYRHEKLSLLEEYKAEKALDV
Sbjct: 301 CFDCAITLGDLALAHRASKSLEALAKTDKIYQALYTQFADYRHEKLSLLEEYKAEKALDV 360

Query: 361 SGSIY 365
           SGSIY
Sbjct: 361 SGSIY 365

>Sklu_1484.1 YDL107W, Contig c1484 197-1327 reverse complement
          Length = 376

 Score =  400 bits (1027), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 195/345 (56%), Positives = 250/345 (72%), Gaps = 2/345 (0%)

Query: 17  RFLSTN--NRPPLHKIFPSKKLVNRMLFDLDSRLTFRKLLPVYEQVYTQLDSSTGDLVVP 74
           R +S N   RPP + +FP KKLVN++LF+LDSRLTF KL P+YE +Y  +D +   + VP
Sbjct: 11  RLISHNASRRPPFYDVFPQKKLVNKLLFELDSRLTFPKLYPLYESLYNTMDDAQSQVKVP 70

Query: 75  RGVRAHDVMIMKKVLEKTRRRTKSSNRHLLALENELLYMAAQMGHKDAAALLAFDTLCNP 134
             V A D+M+MKKVLEK R RTKS N++LLALENE+L  AA+MG+ DA +LLAFDTL + 
Sbjct: 71  TSVTASDIMVMKKVLEKLRHRTKSINKNLLALENEILNKAAEMGNNDAISLLAFDTLKDS 130

Query: 135 ASQTAADMEYAKLMVKDFYRSGHPLTLKLTGDLSLANGDNTTAEEYYMKFLKKEADTFLA 194
            S +  D+ YAK ++K+ Y+  HPLT+KLTGDL+  N D   AE+YY  FL  E DTFLA
Sbjct: 131 DSNSHEDIAYAKTLIKELYQLRHPLTVKLTGDLTFKNNDLINAEKYYKDFLALEDDTFLA 190

Query: 195 GEVYGQLGRISFLRSHFAQAEERFLQAIKLTPLEYSVQSYFYLGQLYMNSDPLKARSLLE 254
           GEVYGQLG+ISF + +  +AE+ FL++IKL PLEYSV SYFYLGQ+YMNS PLKAR+LLE
Sbjct: 191 GEVYGQLGQISFRKPNLFKAEDYFLKSIKLCPLEYSVHSYFYLGQMYMNSQPLKARALLE 250

Query: 255 SAASQGFKESFKTLGHLEMNYFCDLTKAREWFKLGMELGELECMIGCFDCAITLGDLALA 314
           S A+QGFKESFK LG LEMNYF D +KA+EWFKLGMEL E+EC +G FDC + L +   A
Sbjct: 251 STATQGFKESFKILGFLEMNYFEDYSKAQEWFKLGMELFEMECFVGYFDCCVKLEEWVNA 310

Query: 315 HRASKSLEALAKTDKIYQALYTQFADYRHEKLSLLEEYKAEKALD 359
            R   S+  L +++  Y+ +Y+ F   R +KL  LE+Y     +D
Sbjct: 311 KRCFNSMTTLLQSNTNYEPVYSNFVTTRKDKLEKLEKYSTNVVMD 355

>KLLA0E14784g complement(1321041..1322180) similar to sp|P40990
           Saccharomyces cerevisiae YDL107w MSS2 ser/thr protein
           kinase singleton, start by similarity
          Length = 379

 Score =  375 bits (963), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 181/350 (51%), Positives = 255/350 (72%), Gaps = 3/350 (0%)

Query: 17  RFLST--NNRPPLHKIFPSKKLVNRMLFDLDSRLTFRKLLPVYEQVYTQLDSSTGDLVVP 74
           R +S+  N RPPLH+IFP KK+V+R+LF+LDSRL + KL P+YE++Y  LD+   D+ +P
Sbjct: 14  RLISSLANKRPPLHEIFPQKKMVSRILFELDSRLAYNKLYPMYEKLYEGLDTG-NDVDIP 72

Query: 75  RGVRAHDVMIMKKVLEKTRRRTKSSNRHLLALENELLYMAAQMGHKDAAALLAFDTLCNP 134
             ++  D+MIMKKVLEK R +TK+ N++LLALEN LL  AA++G  DA +LL FD L +P
Sbjct: 73  NSIKGKDLMIMKKVLEKVRHKTKAINKNLLALENVLLDRAAEIGDNDAISLLCFDVLKDP 132

Query: 135 ASQTAADMEYAKLMVKDFYRSGHPLTLKLTGDLSLANGDNTTAEEYYMKFLKKEADTFLA 194
            S T  D+ +AK ++K+ Y+  HPLT+KLT D++L N D+ TAE YYMKFL  + DTFLA
Sbjct: 133 DSNTEDDVSHAKKLIKNLYQMNHPLTVKLTADIALKNHDDATAEVYYMKFLDLQNDTFLA 192

Query: 195 GEVYGQLGRISFLRSHFAQAEERFLQAIKLTPLEYSVQSYFYLGQLYMNSDPLKARSLLE 254
           GEVYGQLG+I F + +  +AE+ FL++IKL P++YSV+SYF LGQ+Y+N+D  KAR L+E
Sbjct: 193 GEVYGQLGQIHFRKPNLIEAEKCFLKSIKLCPIDYSVRSYFLLGQMYVNNDIFKARYLIE 252

Query: 255 SAASQGFKESFKTLGHLEMNYFCDLTKAREWFKLGMELGELECMIGCFDCAITLGDLALA 314
           S+A+QGFKESF+TLG LEMNYF +  KA+EWFKLGMEL + EC +G FDC +   +L LA
Sbjct: 253 SSATQGFKESFRTLGLLEMNYFKNYPKAQEWFKLGMELYDTECFVGYFDCTMKNNELLLA 312

Query: 315 HRASKSLEALAKTDKIYQALYTQFADYRHEKLSLLEEYKAEKALDVSGSI 364
            R  +S+E LA+ ++    L+  F+ +R   +  ++EY    +++   S+
Sbjct: 313 KRCYESMEKLAENNQDVNRLFEDFSSHRASDIQKIKEYSPNASINTWQSL 362

>Kwal_23.3475
          Length = 382

 Score =  345 bits (886), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 169/324 (52%), Positives = 227/324 (70%)

Query: 24  RPPLHKIFPSKKLVNRMLFDLDSRLTFRKLLPVYEQVYTQLDSSTGDLVVPRGVRAHDVM 83
           RPP +++FP KK+VN++LF LDS+LTF KL PV+E +Y    +     ++P   +A DVM
Sbjct: 26  RPPFYEVFPQKKMVNKILFQLDSKLTFPKLYPVFESLYDNAGNRDPSELIPTSFKASDVM 85

Query: 84  IMKKVLEKTRRRTKSSNRHLLALENELLYMAAQMGHKDAAALLAFDTLCNPASQTAADME 143
           IMKKVLEK R RTKS+N++L+ LENELL  AA+MG  DA ALLAF  L NP      D+ 
Sbjct: 86  IMKKVLEKIRHRTKSTNKNLIGLENELLETAAEMGDNDAIALLAFSFLKNPGKHAPEDVL 145

Query: 144 YAKLMVKDFYRSGHPLTLKLTGDLSLANGDNTTAEEYYMKFLKKEADTFLAGEVYGQLGR 203
           +AK ++K+ Y+  HPLT+KLT DL++ +     AE YY+ FL+ E++T  AGEVYGQLG 
Sbjct: 146 HAKNLIKELYQLQHPLTIKLTADLAVKSNHFEDAERYYLHFLELESETPRAGEVYGQLGL 205

Query: 204 ISFLRSHFAQAEERFLQAIKLTPLEYSVQSYFYLGQLYMNSDPLKARSLLESAASQGFKE 263
           I F R +  +AE  FL +I+L PLE    SY++L QLYM+S+PLKARSL+ESAAS+GF+E
Sbjct: 206 IYFRRPNLKEAERCFLSSIRLCPLEAVTHSYYHLAQLYMDSEPLKARSLMESAASEGFRE 265

Query: 264 SFKTLGHLEMNYFCDLTKAREWFKLGMELGELECMIGCFDCAITLGDLALAHRASKSLEA 323
           SF+ LG LEMNYF D  KA +WF+LGMEL + EC IG FDC+I + DL  A     SL+ 
Sbjct: 266 SFQLLGFLEMNYFHDYAKALQWFRLGMELYQFECYIGYFDCSIKMQDLKKARNCLTSLQK 325

Query: 324 LAKTDKIYQALYTQFADYRHEKLS 347
           L+KT+ ++ + +  F D R E ++
Sbjct: 326 LSKTNDLFASAFKSFVDSRQETIN 349

>YDL107W (MSS2) [762] chr4 (268921..269976) Protein involved in
           translocation of the Cox2p C-terminal end across the
           mitochondrial inner membrane [1056 bp, 351 aa]
          Length = 351

 Score =  246 bits (627), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 140/350 (40%), Positives = 214/350 (61%), Gaps = 23/350 (6%)

Query: 17  RFLSTNNRPPLHK----IFPSKKLVNRMLFDLDSRLTFRKLLPVYEQVYTQLDSSTGDLV 72
           +F+ST   PP+ K    IFP K+ VN++LF LD+RLT+ ++ P++ QV      +T +  
Sbjct: 7   KFVST---PPVPKKFQEIFPKKRTVNKILFQLDTRLTYHEMYPIFLQV----SQNTNEEN 59

Query: 73  VPRG-----VRAHDVMIMKKVLEKTRRRTKSSNRHLLALENELLYMAAQMGHKDAAALLA 127
           +P       +R+ D+M M+ VL   R + K  ++ LLA+E++LL +AA++G+ DA ++L+
Sbjct: 60  IPWRKKYPYIRSSDIMQMRNVLITLRTQNKFVHKDLLAMEDKLLNIAAELGNNDAISILS 119

Query: 128 FDTLC-----NPASQTAADMEYAKLMVKDFYRSGHPLTLKLTGDLSLANGDNTTAEEYYM 182
           F+ +      N  S    D+E A   +K  Y   H LT+KL GDL   N     AE+YY 
Sbjct: 120 FNVIHEYKKENVKSSYEKDIETANEFIKKLYARNHHLTVKLIGDLFFENKTYDKAEKYYQ 179

Query: 183 KFLKKEADTFLAGEVYGQLGRISFLRSH-FAQAEERFLQAIKLTPLEYSVQSYFYLGQLY 241
           +FLK E  T LAGEV+G+LG I   + + F +AE+ +L  I+L  +E S + YF L +LY
Sbjct: 180 EFLKLENSTKLAGEVHGKLGEIQIKQVNGFLKAEKSWLSCIELLEIERSSRWYFLLARLY 239

Query: 242 MNSDPLKARSLLESAASQGFKESFKTLGHLEMNYFCDLTKAREWFKLGMELGELECMIGC 301
           M+S+P+KA++LLE+ AS GFKE FKTLG LE+NYF +  +A+EWFK GME+ +LEC  G 
Sbjct: 240 MSSEPMKAKALLENCASIGFKECFKTLGFLELNYFNNYERAKEWFKTGMEIMDLECFFGF 299

Query: 302 FDCAITLGDLALAHRASKSLEALAKTDKIYQALYTQFADYRHEKLSLLEE 351
           FDC +   +   A    +S++ L   DK  + +   F + R + + LL++
Sbjct: 300 FDCCVKEENFKGARDCLESVKKLG-NDKDKKTMINVFLESRKDSIKLLDK 348

>Scas_613.12
          Length = 348

 Score =  246 bits (627), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 129/335 (38%), Positives = 202/335 (60%), Gaps = 14/335 (4%)

Query: 20  STNNRPPLHKIFPSKKLVNRMLFDLDSRLTFRKLLPVYEQVYTQLDSSTGDLVVPRGVRA 79
           ST+   P H+IFP K+L+NR+LF+LDS  T++ L P +E +Y + +       +P  V  
Sbjct: 13  STSTLRPFHEIFPRKRLINRILFELDSNDTYKTLYPNFETLYLKHE-------LPSTVSG 65

Query: 80  HDVMIMKKVLEKTRRRTKSSNRHLLALENELLYMAAQMGHKDAAALLAFDTLCNPASQTA 139
             +++M +VL +  ++ K  N  L+ +  ELL +AA  G  DA + + ++ L +P   + 
Sbjct: 66  PQLLLMDRVLLEVSKQQKMINEVLMKMRGELLELAAGKGENDAISTVCYNILSSPKDDSK 125

Query: 140 ADMEYAKLMVKDFYRSGHPLTLKLTGDLSLANGDNTTAEEYYMKFLK-------KEADTF 192
            D E A  ++ +  ++G+ LT K  GDLS   GD   A+ +Y KF++       + +D  
Sbjct: 126 GDAEDASRLIGELVKAGNVLTFKHLGDLSRLKGDINEAKLWYDKFMECVDQDETRVSDVS 185

Query: 193 LAGEVYGQLGRISFLRSHFAQAEERFLQAIKLTPLEYSVQSYFYLGQLYMNSDPLKARSL 252
           + G+V  +LG I F +S    AE+ +L AI  + LE SV+SYFYL ++Y+NS+PLK+R L
Sbjct: 186 IIGQVLERLGEIEFNQSRVLGAEKYWLDAIARSKLEDSVKSYFYLSKVYLNSEPLKSRVL 245

Query: 253 LESAASQGFKESFKTLGHLEMNYFCDLTKAREWFKLGMELGELECMIGCFDCAITLGDLA 312
           LE+ A+QGF+ESFK LG+LE+NYF +L KA EWF+LGMEL E+EC  G FD    L +  
Sbjct: 246 LENCATQGFRESFKELGYLELNYFKNLVKANEWFRLGMELFEIECFFGFFDSCYQLKEYK 305

Query: 313 LAHRASKSLEALAKTDKIYQALYTQFADYRHEKLS 347
              +  KSLE     ++ Y+ + ++F  +R  K++
Sbjct: 306 SCSKCLKSLETFKNINESYKNMVSEFVSHRENKIN 340

>CAGL0H10296g complement(1004900..1006021) similar to sp|P40990
           Saccharomyces cerevisiae YDL107w MSS2 ser/thr protein
           kinase, hypothetical start
          Length = 373

 Score =  226 bits (575), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 136/335 (40%), Positives = 204/335 (60%), Gaps = 22/335 (6%)

Query: 31  FPSKKLVNRMLFDLDSRLTFRKLLPVYEQVYTQLDSSTGDLVVPRGVRAHDVMIMKKVLE 90
           FP KK +N++LFDL+SRLT++KL P+Y  +Y  +       ++  GV+  D+++M+ VLE
Sbjct: 28  FPKKKTINKLLFDLNSRLTYKKLYPIYVGLYHGVPVPQQQKLLD-GVKGSDLIVMRNVLE 86

Query: 91  KTRRRTKSSNRHLLALENELLYMAAQMGHKDAAALLAFDTLC-NPASQTAAD-----MEY 144
           K R RT+ +   +L LE++LL +AA++G+ DA A+L+F ++  N  + +AA+     +  
Sbjct: 87  KVRNRTRYARPDMLKLEDKLLELAAELGNNDAIAILSFRSIRENMGTNSAAEANNEEVTI 146

Query: 145 AKLMVKDFYRSGHPLTLKLTGDLSLANGDNTTAEEYYMKFLKK---------EADTFLAG 195
           AK + KD Y   H L +KL GDL+L   +   A  +Y K++             +  L G
Sbjct: 147 AKKLFKDLYNINHLLAIKLLGDLALEANNWEEALTFYNKYINIAVKDNGHLLTGNDDLTG 206

Query: 196 EVYGQLGRISFLR-SHFAQAEERFLQAIKLTPLEYSVQSYFYLGQLYMNSDPLKARSLLE 254
           EVYG+LG I F   ++  +AEE + + ++LT +E SV+ YF   Q+YM+S+PLK+R LLE
Sbjct: 207 EVYGKLGEIEFTYLANMTKAEEYWQKCLELTSVEDSVRWYFLAAQIYMSSEPLKSRILLE 266

Query: 255 SAASQGFKESFKTLGHLEMNYFCDLTKAREWFKLGMELGELECMIGCFDCAITLGDLALA 314
            AASQGFKES  +LG LEMNYF D  +A+EWFKLGME+ EL+  IG FDC +   D   A
Sbjct: 267 KAASQGFKESLTSLGFLEMNYFRDYGRAKEWFKLGMEVFELQSYIGFFDCCVKNEDWIAA 326

Query: 315 HRASKSLEALAK-----TDKIYQALYTQFADYRHE 344
            +  KS+E +       +D   +A  + F + R E
Sbjct: 327 LKCLKSIEKIGTMESFGSDNTNKATVSNFMNSRAE 361

>CAGL0D01364g 152033..155479 similar to sp|P14922 Saccharomyces
           cerevisiae YBR112c CYC8 general repressor of
           transcription, hypothetical start
          Length = 1148

 Score = 31.6 bits (70), Expect = 1.3,   Method: Composition-based stats.
 Identities = 56/196 (28%), Positives = 85/196 (43%), Gaps = 36/196 (18%)

Query: 90  EKTRRRTKSSNRHLLALENELLYMAAQMGHKDAAALLAFDTLCNPA-SQTAADMEYAKLM 148
           + T +   SS + L +L +  LY +  M  K AA L       NP  S   A + +  LM
Sbjct: 72  DATLQHNASSTKGLTSLAH--LYRSRDMFQK-AAELYECALQVNPELSDVWATLGHCYLM 128

Query: 149 VKDFYRS-----------GHPLTLKL---TGDLSLANGDNTTAEEYYMKFLKKEADTFLA 194
           + D  R+            +P   KL    G L    G    AEE + K L+ +     A
Sbjct: 129 LDDLQRAYNAYQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPHFEKA 188

Query: 195 GEVYGQLGRISFLRSHFAQAEE--RFLQAIKLTPL-EYSVQSYFYLGQLYMNSDPLKARS 251
            E+Y +LG I   +  ++QA E  R++ A   TPL E+ +  +F LG            S
Sbjct: 189 NEIYFRLGIIYKHQGKWSQALECFRYILAQPPTPLQEWDI--WFQLG------------S 234

Query: 252 LLESAAS-QGFKESFK 266
           +LES    QG +E+++
Sbjct: 235 VLESMGEWQGAREAYE 250

>KLLA0D04136g 350976..352124 weakly similar to sp|Q9USQ4
           Schizosaccharomyces pombe Hypothetical coiled-coil
           protein, possible histone binding, start by similarity
          Length = 382

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 34/82 (41%), Gaps = 12/82 (14%)

Query: 177 AEEYYMKFLKKEADT----FLAGEVYGQLGRISFLRSHFAQAEERFLQAIKL-------- 224
           A  YY   LK+  D         E Y  LG +S    +F+QA   F + +KL        
Sbjct: 189 ARSYYESSLKETPDNEDLKLKLSECYDLLGEVSLECENFSQASHDFEECLKLRRELFETK 248

Query: 225 TPLEYSVQSYFYLGQLYMNSDP 246
            P++ S+   +Y   L +  DP
Sbjct: 249 DPIDRSIIESYYKISLALEFDP 270

>Kwal_14.2141
          Length = 342

 Score = 30.0 bits (66), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 10/69 (14%)

Query: 196 EVYGQLGRISFLRSHFAQAEERFLQAIKLTPLEYS---------VQSYFYLGQLYMNSDP 246
           E Y  LG IS    +FAQA+E F + ++L    Y          ++SY+ +  L +  DP
Sbjct: 179 ETYDILGEISLETENFAQAKEDFTKCLELRLAAYGSQDKTHRLIIESYYKIS-LALEFDP 237

Query: 247 LKARSLLES 255
            +A +  E+
Sbjct: 238 SQATACQEN 246

>CAGL0M00924g 102735..106646 similar to tr|Q06673 Saccharomyces
           cerevisiae YLR436c ECM30 involved in cell wall
           biogenesis and architecture, start by similarity
          Length = 1303

 Score = 29.6 bits (65), Expect = 4.6,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 3/47 (6%)

Query: 147 LMVKDFYRSGHPLTLKLTGDLSL---ANGDNTTAEEYYMKFLKKEAD 190
           L ++DF  S    T + TGDL++    NG NT    YY +F+  +A+
Sbjct: 236 LFIEDFTVSSSSDTSQKTGDLTMILWENGINTYDTSYYTQFVHLDAN 282

>Kwal_14.2369
          Length = 725

 Score = 29.3 bits (64), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 56/113 (49%), Gaps = 9/113 (7%)

Query: 247 LKARSLLESAASQGFKESFKTLGHLEMNYFCDLTKAREWFKLGMELGELECMIGCFDCAI 306
           LKAR+L  ++A    +E+        +    DL  + +    G+E+ ++  ++  FD A+
Sbjct: 403 LKARALFPNSALWLLQEARMLSSRGRLQEAVDLMDSIDVS--GIEMRQVRALM-IFDRAM 459

Query: 307 TLGDLALAHRASKSLEALAKTDKIYQALYTQFAD------YRHEKLSLLEEYK 353
           TL  L    RA++ L +L   ++   ALYT FA       +R  ++ LLE+ +
Sbjct: 460 TLVHLHEFERAAEDLLSLLDINEWSHALYTYFAGCCYLELFRMCQMGLLEDSR 512

>YDR347W (MRP1) [1174] chr4 (1169168..1170133) Mitochondrial
           ribosomal protein of the small subunit [966 bp, 321 aa]
          Length = 321

 Score = 28.9 bits (63), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 29/67 (43%), Gaps = 4/67 (5%)

Query: 141 DMEYAKLMVKDFYRSGHPLTLKLTGDLSLANGDNTTAEEYYMKFLKKEADTFLAGEVYGQ 200
           D+EY KL + + Y +G P     +G ++  N   T  E    K   KEA      E+  +
Sbjct: 190 DIEYDKLFILNTYNAGTPFNFSTSGVMNELNNQYTNME----KQRAKEAGNLEDSEMTAK 245

Query: 201 LGRISFL 207
             +  F+
Sbjct: 246 QAKTKFI 252

>Sklu_2276.3 YBR126C, Contig c2276 3772-5289
          Length = 505

 Score = 28.9 bits (63), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 34/80 (42%), Gaps = 5/80 (6%)

Query: 146 KLMVKDFYRSGHPLTLKLTGDLSLANGDNTTAEEY-YMKFLKKEADTFLAGEVYGQLGRI 204
           KL   + + + HP  +     + +A       EEY Y++ +  E    L G + GQ G +
Sbjct: 314 KLHAMEIFLNEHPEWIGKVVLVQVAVPSRGDVEEYQYLRSVVNE----LVGRINGQFGTV 369

Query: 205 SFLRSHFAQAEERFLQAIKL 224
            F+  HF      F + I L
Sbjct: 370 EFVPIHFMHRSIPFQELISL 389

>Scas_516.7
          Length = 508

 Score = 28.9 bits (63), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 33/80 (41%), Gaps = 5/80 (6%)

Query: 146 KLMVKDFYRSGHPLTLKLTGDLSLANGDNTTAEEY-YMKFLKKEADTFLAGEVYGQLGRI 204
           KL   + +   HP  +     + LA       EEY Y++ +  E    L G + GQ G I
Sbjct: 314 KLHAMEVFLQEHPEWVGKVVLVQLAIPSRGDVEEYQYLRSVVNE----LVGRINGQFGTI 369

Query: 205 SFLRSHFAQAEERFLQAIKL 224
            F+  HF      F + I L
Sbjct: 370 EFVPIHFMHRSIPFEELISL 389

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.135    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,949,296
Number of extensions: 429777
Number of successful extensions: 1332
Number of sequences better than 10.0: 20
Number of HSP's gapped: 1337
Number of HSP's successfully gapped: 20
Length of query: 365
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 262
Effective length of database: 13,030,455
Effective search space: 3413979210
Effective search space used: 3413979210
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 62 (28.5 bits)