Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL281C59558428180.0
KLLA0E14762g60158614910.0
CAGL0F07843g61259314560.0
Scas_669.1159659214360.0
YGL142C (GPI10)61658814160.0
Kwal_23.347861858613780.0
Kwal_47.188425081601077e-05
Sklu_1475.25081621051e-04
KLLA0C06567g530156960.002
CAGL0K09548g496225950.002
Scas_714.36514139950.002
YOR149C (SMP3)516163940.003
Scas_660.3731736701.6
AAR043C537249674.6
CAGL0K08492g565108665.4
Sklu_1894.355141666.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL281C
         (584 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL281C [1460] [Homologous to ScYGL142C (GPI10) - SH] (207452..2...  1090   0.0  
KLLA0E14762g 1319163..1320968 similar to sp|P30777 Saccharomyces...   578   0.0  
CAGL0F07843g 766285..768123 similar to sp|P30777 Saccharomyces c...   565   0.0  
Scas_669.11                                                           557   0.0  
YGL142C (GPI10) [1845] chr7 complement(236272..238122) Protein i...   550   0.0  
Kwal_23.3478                                                          535   0.0  
Kwal_47.18842                                                          46   7e-05
Sklu_1475.2 YOR149C, Contig c1475 982-2508 reverse complement          45   1e-04
KLLA0C06567g complement(573595..575187) similar to sp|Q04174 Sac...    42   0.002
CAGL0K09548g complement(940088..941578) similar to sp|Q04174 Sac...    41   0.002
Scas_714.36                                                            41   0.002
YOR149C (SMP3) [4948] chr15 complement(609838..611388) Protein r...    41   0.003
Scas_660.37                                                            32   1.6  
AAR043C [229] [Homologous to ScYNR030W (ECM39) - SH] (418301..41...    30   4.6  
CAGL0K08492g 851478..853175 similar to sp|P34248 Saccharomyces c...    30   5.4  
Sklu_1894.3 YNL219C, Contig c1894 4461-6116 reverse complement         30   6.8  

>ADL281C [1460] [Homologous to ScYGL142C (GPI10) - SH]
           (207452..209239) [1788 bp, 595 aa]
          Length = 595

 Score = 1090 bits (2818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/584 (91%), Positives = 537/584 (91%)

Query: 1   MKERSILRTLFLWRLINALSIRSFFQADEYWQSLEPAHVKAFGYGGLTWEWQHGLRSYAF 60
           MKERSILRTLFLWRLINALSIRSFFQADEYWQSLEPAHVKAFGYGGLTWEWQHGLRSYAF
Sbjct: 1   MKERSILRTLFLWRLINALSIRSFFQADEYWQSLEPAHVKAFGYGGLTWEWQHGLRSYAF 60

Query: 61  PMLFEMSYYVAWILGVATRMALQGLAHATALCXXXXXXXXXXXXXMKAVWELPEAAQELV 120
           PMLFEMSYYVAWILGVATRMALQGLAHATALC             MKAVWELPEAAQELV
Sbjct: 61  PMLFEMSYYVAWILGVATRMALQGLAHATALCGAVVPSGAAGVAAMKAVWELPEAAQELV 120

Query: 121 EYYGVLYGPRVVMAAVAACGEFYSVLLVRKLYLRVXXXXXXXXXXXXPVSRLALMLTMTN 180
           EYYGVLYGPRVVMAAVAACGEFYSVLLVRKLYLRV            PVSRLALMLTMTN
Sbjct: 121 EYYGVLYGPRVVMAAVAACGEFYSVLLVRKLYLRVADKGDDQKGDAAPVSRLALMLTMTN 180

Query: 181 FFNCFFATRTFINSFEMTLTAVALYHWDWSGGLDVGSLGFSASLAVAAFACLQRPTNVLI 240
           FFNCFFATRTFINSFEMTLTAVALYHWDWSGGLDVGSLGFSASLAVAAFACLQRPTNVLI
Sbjct: 181 FFNCFFATRTFINSFEMTLTAVALYHWDWSGGLDVGSLGFSASLAVAAFACLQRPTNVLI 240

Query: 241 WAVLGLFLVLNLVRSRRWQXXXXXXXXXXXXXXXXXXXXXXIDYYFYGGVLLPLLRFIEF 300
           WAVLGLFLVLNLVRSRRWQ                      IDYYFYGGVLLPLLRFIEF
Sbjct: 241 WAVLGLFLVLNLVRSRRWQLLLTLVAKVAAAGALAVCANIAIDYYFYGGVLLPLLRFIEF 300

Query: 301 NVTTPLAAFYGRAPWHFHLLQSVPLIVGYALPFFVGALLTHNFRRGNAGLLGSPIMQIKC 360
           NVTTPLAAFYGRAPWHFHLLQSVPLIVGYALPFFVGALLTHNFRRGNAGLLGSPIMQIKC
Sbjct: 301 NVTTPLAAFYGRAPWHFHLLQSVPLIVGYALPFFVGALLTHNFRRGNAGLLGSPIMQIKC 360

Query: 361 VVVLNIALYSCIDHKEFRFLYPLQPLFLSLSALEMHTWLQHHHARGTAWLKRVQSLLYVL 420
           VVVLNIALYSCIDHKEFRFLYPLQPLFLSLSALEMHTWLQHHHARGTAWLKRVQSLLYVL
Sbjct: 361 VVVLNIALYSCIDHKEFRFLYPLQPLFLSLSALEMHTWLQHHHARGTAWLKRVQSLLYVL 420

Query: 421 PVLSITAALVLNTAHEAGVVSVMDYLHSAVPSAESIGFIMPCHSTPWQSHLHRNDLGKLW 480
           PVLSITAALVLNTAHEAGVVSVMDYLHSAVPSAESIGFIMPCHSTPWQSHLHRNDLGKLW
Sbjct: 421 PVLSITAALVLNTAHEAGVVSVMDYLHSAVPSAESIGFIMPCHSTPWQSHLHRNDLGKLW 480

Query: 481 AISCQPPLDLLHQEDAGDQLLTYMDESDHLYENIPEFIHKNFPPVFRRDLRSPGRQYAYE 540
           AISCQPPLDLLHQEDAGDQLLTYMDESDHLYENIPEFIHKNFPPVFRRDLRSPGRQYAYE
Sbjct: 481 AISCQPPLDLLHQEDAGDQLLTYMDESDHLYENIPEFIHKNFPPVFRRDLRSPGRQYAYE 540

Query: 541 WPEFLVVFEHMDEAFMKEYLKDSNYVEVKRFFNTLSHWDSRRAG 584
           WPEFLVVFEHMDEAFMKEYLKDSNYVEVKRFFNTLSHWDSRRAG
Sbjct: 541 WPEFLVVFEHMDEAFMKEYLKDSNYVEVKRFFNTLSHWDSRRAG 584

>KLLA0E14762g 1319163..1320968 similar to sp|P30777 Saccharomyces
           cerevisiae YGL142c GPI10 required for Glycosyl
           Phosphatdyl Inositol synthesis singleton, hypothetical
           start
          Length = 601

 Score =  578 bits (1491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/586 (46%), Positives = 383/586 (65%), Gaps = 6/586 (1%)

Query: 4   RSILRTLFLWRLINALSIRSFFQADEYWQSLEPAHVKAFGYGGLTWEWQHGLRSYAFPML 63
           + + + + + R + AL  R+FFQADE+WQSLEPAH  AFGYG LTWEW  GLRSYAFP++
Sbjct: 8   KRLFKVILVIRCVQALLTRTFFQADEFWQSLEPAHYMAFGYGELTWEWSFGLRSYAFPLI 67

Query: 64  FEMSYYVAWILGVATRMALQGLAHATALCXXXXXXXXXXXXXM-KAVWELPEAAQELVEY 122
           F++ Y +     ++  + +Q       L              M + +   PE  +  +EY
Sbjct: 68  FQIGYTLVKYAAISCELIVQTATDWVLLFVANVIPNSEFGWEMVQEMRSFPEEIRGFIEY 127

Query: 123 YGVLYGPRVVMAAVAACGEFYSVLLVRKLY---LRVXXXXXXXXXXXXPVSRLALMLTMT 179
            GV+Y P+++MA +AA GEF+ +LL  KLY   +               V    L+ T++
Sbjct: 128 QGVIYAPKLIMAVLAAIGEFHVILLAEKLYKLTMDKSDDSKGSDKKHSTVINFTLVATVS 187

Query: 180 NFFNCFFATRTFINSFEMTLTAVALYHWDWSGGLDVGSLGFSASLAVAAFACLQRPTNVL 239
           NFFNCFF TR+FINSFEM LT+V+LY+WDW+ G  + S  F  SL +  F  LQRPTN  
Sbjct: 188 NFFNCFFITRSFINSFEMILTSVSLYYWDWTSGEHIESFDFLKSLIIGTFTVLQRPTNAF 247

Query: 240 IWAVLGLFLVLNLVRSRRWQXXXXXXXXXXXXXXXXXXXXXXIDYYFYGGVLLPLLRFIE 299
           IW +LG +++LNLV S+RW+                      IDYYFYG + +P+L+FI+
Sbjct: 248 IWLILGGYMILNLVLSKRWRKLFSLLIKVICASFISISTNLCIDYYFYGYITIPVLKFIK 307

Query: 300 FNVTTPLAAFYGRAPWHFHLLQSVPLIVGYALPFFVGALLTHNFRRGNAGLLGSPIMQIK 359
           FN T+ L+ FYG APW+FH+ QS+P++ GY+LP  + +      ++     L +P +QIK
Sbjct: 308 FNCTSSLSKFYGVAPWNFHVFQSLPIVAGYSLPLLIHSFFCSLTKKRFLSPLVNPFLQIK 367

Query: 360 CVVVLNIALYSCIDHKEFRFLYPLQPLFLSLSALEMHTWLQHHHARGTA-WLKRVQSLLY 418
            VV+LN+ LYS I HKEFRF+YPLQP F+ LS  +    LQ + +  T   ++    +++
Sbjct: 368 TVVLLNVILYSLIPHKEFRFIYPLQPFFIILSVFDGIWLLQKYGSTATTRTMEFFSQVMW 427

Query: 419 VLPVLSITAALVLNTAHEAGVVSVMDYLHSAVPSAESIGFIMPCHSTPWQSHLHRNDLGK 478
           +LPV+S+ A+++L+T HE+G V+VMDYLHS + + +SIGFIMPCHSTPWQSH HRND+ +
Sbjct: 428 ILPVVSMVASMLLSTLHESGTVAVMDYLHS-IRNIDSIGFIMPCHSTPWQSHFHRNDVKE 486

Query: 479 LWAISCQPPLDLLHQEDAGDQLLTYMDESDHLYENIPEFIHKNFPPVFRRDLRSPGRQYA 538
           LWAI+C PPL LL   DA  +L  YMDESD+LY+NI +F++++FPPVFR+ LRSPG+QY 
Sbjct: 487 LWAITCSPPLHLLTDPDANAKLPFYMDESDYLYDNISKFMYQHFPPVFRKSLRSPGKQYT 546

Query: 539 YEWPEFLVVFEHMDEAFMKEYLKDSNYVEVKRFFNTLSHWDSRRAG 584
           YEWPE+LV+FE +D  FM +YL DS Y+E  RFFN+L HWD RR+G
Sbjct: 547 YEWPEYLVIFEDLDSQFMNDYLVDSMYIEETRFFNSLVHWDKRRSG 592

>CAGL0F07843g 766285..768123 similar to sp|P30777 Saccharomyces
           cerevisiae YGL142c GPI10 required for Glycosyl
           Phosphatdyl Inositol synthesis, hypothetical start
          Length = 612

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/593 (46%), Positives = 388/593 (65%), Gaps = 20/593 (3%)

Query: 2   KERSILRTLFLWRLINALSIRSFFQADEYWQSLEPAHVKAFGYGGLTWEWQHGLRSYAFP 61
           K  +I   L  +R+IN+L  R++FQADE+WQSLEPAH KAFGYG LTWEW+ GLRSYAFP
Sbjct: 21  KTSAIFPVLVGFRVINSLLTRTYFQADEFWQSLEPAHYKAFGYGELTWEWKVGLRSYAFP 80

Query: 62  MLFEMSYYVAWILGVATRMALQGLAHATA-LCXXXXXXXXXXXXXMKAVWELPEAAQELV 120
           MLFE+ Y +  +L +A++ AL  +    A L               + +  +P    E V
Sbjct: 81  MLFEIIYRLVKLLAIASKEALSIICSIGAGLMLLCFPQSKLATEVARDLLTIPNEYSETV 140

Query: 121 EYYGVLYGPRVVMAAVAACGEFYSVLLVRKLYLRVXXXXXXXXXXXXPVSRLALMLTMTN 180
           EYYGV+Y P++ MA +AA GE++++ L++K+YL+              ++++AL+LT+TN
Sbjct: 141 EYYGVIYAPKLFMALLAATGEYFTIKLIQKVYLKTVSKNDDQLPKLSNITKIALLLTLTN 200

Query: 181 FFNCFFATRTFINSFEMTLTAVALYHWDWSGGLDVGSLGFSASLAVAAFACLQRPTNVLI 240
           FFNCFF TRTFINSFEM LT++ALY+WDWSGG+++ +  F+ SL  A FAC+QRP+N +I
Sbjct: 201 FFNCFFITRTFINSFEMILTSIALYNWDWSGGIEINTRSFTKSLFFAMFACIQRPSNAII 260

Query: 241 WAVLGLFLVLNLVRSRRWQXXXXXXXXXXXXXXXXXXXXXXIDYYFYGGVLLPLLRFIEF 300
           W VLG FL +NL+  R +                       ID+YFY  ++ P+ +FI F
Sbjct: 261 WIVLGFFLTINLLLRRDYTLIGRLYAKILVVFTITMLVNVVIDFYFYNQIIFPVFKFINF 320

Query: 301 NVTTPLAAFYGRAPWHFHLLQSVPLIVGYALPFFVGALLTHNFRRGNAGLLGSPIMQIKC 360
           N T+ L+ FYG APWHFHLLQS+P+++GY+LP F+  L +++    N    G+ + QIK 
Sbjct: 321 NFTSILSEFYGVAPWHFHLLQSLPIMLGYSLPLFIYGLFSNDSTTKNNIRFGA-LRQIKF 379

Query: 361 VVVLNIALYSCIDHKEFRFLYPLQPLFLSLS---ALEMHTWLQHHHARGTAWLKRVQSLL 417
           V++LNI  YS + HKEFRF+YPLQPLF  LS   AL++   +Q++        + ++  +
Sbjct: 380 VLILNIIFYSYLKHKEFRFIYPLQPLFCLLSALGALKLAGKVQNY--------RYLKEYV 431

Query: 418 YVLPVLSITAALVLNTAHEAGVVSVMDYLHSAVPSAESIGFIMPCHSTPWQSHLHRNDLG 477
           +++P++S+  ++ + T  E+GV+ VM  LH+     +S+GF+MPCHSTPWQS+LHRND+ 
Sbjct: 432 WIIPLMSMIVSIFITTFQESGVIQVMKDLHNE-KDIDSVGFVMPCHSTPWQSYLHRNDIR 490

Query: 478 KLWAISCQPPLDLLHQEDAGDQLLTYMDESDHLYENIPEFIHKNFPPVFRR-DLRSPGR- 535
           +LWAISC+PPL LL + +A  +L TYMDESD+LYENI  FI KNFP      D+ +    
Sbjct: 491 QLWAISCEPPLHLLGKNNASIELQTYMDESDYLYENISGFIKKNFPKFTNSMDMENVNNN 550

Query: 536 ----QYAYEWPEFLVVFEHMDEAFMKEYLKDSNYVEVKRFFNTLSHWDSRRAG 584
               Q+ +EWP+FL++FE +D  FM  YL DS YV+  + FN+ SHWDSRR G
Sbjct: 551 ASMPQFPHEWPQFLIIFEQLDNEFMSRYLLDSGYVKYNKIFNSYSHWDSRRNG 603

>Scas_669.11
          Length = 596

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/592 (45%), Positives = 384/592 (64%), Gaps = 18/592 (3%)

Query: 1   MKERSILRTLFLWRLINALSIRSFFQADEYWQSLEPAHVKAFGYGGLTWEWQHGLRSYAF 60
           +   S+ R + ++R+ NAL  R+FFQADE+WQ+LEPAH+ AFGYG LTW+W+  +RSYAF
Sbjct: 4   LDNGSLFRAILVFRIANALLTRTFFQADEFWQALEPAHLMAFGYGELTWDWKFAIRSYAF 63

Query: 61  PMLFEMSYYVAWILGVATR-MALQGLAHATALCXXXXXXXXXXXXXMKAVWELPEAAQEL 119
           P +FE++Y +  ++   +R +       A+ L              +  +  LP      
Sbjct: 64  PFIFELTYRLVRLVVFMSRWLMELLSELASELLLLLFPSNEFVRLVVDDLVVLPSDMANS 123

Query: 120 VEYYGVLYGPRVVMAAVAACGEFYSVLLVRKLYLRVXXXXXXXXX------XXXPVSRLA 173
           +EY GV+YGP+VVM  +AA GE+Y++ L++KLYL                     ++++A
Sbjct: 124 LEYIGVIYGPKVVMTLIAATGEYYTIKLIQKLYLITSKSSKENDDEGGKGGSLQGITKIA 183

Query: 174 LMLTMTNFFNCFFATRTFINSFEMTLTAVALYHWDWSGGLDVGSLGFSASLAVAAFACLQ 233
            +L++TNFFNC+  TR+FINSFEMT TAVALY WDW+GGL + S  F+ SL +A F CLQ
Sbjct: 184 TVLSLTNFFNCYLITRSFINSFEMTTTAVALYFWDWTGGLTIESSEFTKSLVIAMFTCLQ 243

Query: 234 RPTNVLIWAVLGLFLVLNLV-RSRRWQXXXXXXXXXXXXXXXXXXXXXXIDYYFYGGVLL 292
           RPTN  IW VLG  L+ N++ R   ++                      ID+YFYG + +
Sbjct: 244 RPTNAFIWIVLGSLLITNMIKRGTDFKAYFILLRKIVLCFMAVFLLNVSIDFYFYGEITI 303

Query: 293 PLLRFIEFNVTTPLAAFYGRAPWHFHLLQSVPLIVGYALPFFVGALLTHNFRRGNAGLLG 352
           PL+ FI+FNVT+PLA FYG +PWHFHL QSVP+I+GY L FFV  +  H   +       
Sbjct: 304 PLINFIKFNVTSPLANFYGSSPWHFHLFQSVPIILGYNLLFFVPGMFCHLSHKKFTSFAT 363

Query: 353 SPIMQIKCVVVLNIALYSCIDHKEFRFLYPLQPLFLSLSALEMHTWLQHHHARGTAWLKR 412
           +P  QIK +++LN+ ++S   HKEFRF+YPLQP F+++S   +H    + ++R T     
Sbjct: 364 NPFFQIKMIILLNVLVFSLTTHKEFRFIYPLQPFFMTVSVFALHKLKWYQYSRMT----- 418

Query: 413 VQSLLYVLPVLSITAALVLNTAHEAGVVSVMDYLHSAVPSAESIGFIMPCHSTPWQSHLH 472
                ++LP+ S+  +L++++  E+G + VM +LH+     +S+GFIMPCHSTPWQS+LH
Sbjct: 419 -----WILPLASVVLSLLVSSFQESGSIEVMKFLHNEPFDLKSVGFIMPCHSTPWQSYLH 473

Query: 473 RNDLGKLWAISCQPPLDLLHQEDAGDQLLTYMDESDHLYENIPEFIHKNFPPVFRRDLRS 532
           R D+  LWAI+C+PPL LL   DA  +L +YMDESDHLY N   F+++NFPPVF+++LRS
Sbjct: 474 RQDIPDLWAITCEPPLHLLGDADATSKLQSYMDESDHLYANPARFLYENFPPVFKKELRS 533

Query: 533 PGRQYAYEWPEFLVVFEHMDEAFMKEYLKDSNYVEVKRFFNTLSHWDSRRAG 584
           PG+ Y +EWPE+L++FE +D+  M+EYLKDS+YVE  RFFN+ SHWDSRRAG
Sbjct: 534 PGKVYTHEWPEYLIIFEQLDDLIMREYLKDSSYVEYTRFFNSWSHWDSRRAG 585

>YGL142C (GPI10) [1845] chr7 complement(236272..238122) Protein
           involved in glycosylphosphatidylinositol (GPI)
           synthesis, transfers the third core mannose to the GPI
           core structure [1851 bp, 616 aa]
          Length = 616

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/588 (46%), Positives = 380/588 (64%), Gaps = 16/588 (2%)

Query: 8   RTLFLW-----RLINALSIRSFFQADEYWQSLEPAHVKAFGYGGLTWEWQHGLRSYAFPM 62
           RT   W     R++NA+  R+FFQADE+WQ+LEPAH KAF YG LTWEW+ G+RSY FPM
Sbjct: 14  RTQIFWVFLAFRVLNAVLTRTFFQADEFWQALEPAHWKAFKYGELTWEWKFGVRSYLFPM 73

Query: 63  LFEMSYYVAWILGVATRMALQGLAH-ATALCXXXXXXXXXXXXXMKAVWELPEAAQELVE 121
           +FE++Y +  +  +    AL  L+   + L               + +  LP       E
Sbjct: 74  IFELTYRLVSLSSILLHYALLLLSTIGSDLLILLLPKYELSWQVAEDLKRLPFDVTRSFE 133

Query: 122 YYGVLYGPRVVMAAVAACGEFYSVLLVRKLYLRVXXXXXXXXXX-----XXPVSRLALML 176
           YYGV+Y P++VMA +A+ GE+Y V  V+KLYL                    +++ AL+L
Sbjct: 134 YYGVIYAPKIVMAVLASIGEYYIVRFVQKLYLLTLDKRNEKEEEERRSGLSEITKFALLL 193

Query: 177 TMTNFFNCFFATRTFINSFEMTLTAVALYHWDWSGGLDVGSLGFSASLAVAAFACLQRPT 236
           ++TNFFNCFF TRTFINSFEM LT++ALY+WDW+GG  +    F+ SL  A  ACLQRP+
Sbjct: 194 SLTNFFNCFFITRTFINSFEMILTSIALYYWDWTGGQMIKESSFTKSLIFAFLACLQRPS 253

Query: 237 NVLIWAVLGLFLVLNLVRSRRWQXXXXXXXXXXXXXXXXXXXXXXIDYYFYGGVLLPLLR 296
           + LIW +  + L+LNLV  +++                       ID YFY  V  P  R
Sbjct: 254 SGLIWVIPSISLILNLVGKKQYHLLFITFSKVLRSFFLVFTANAIIDMYFYEKVTFPFFR 313

Query: 297 FIEFNVTTPLAAFYGRAPWHFHLLQSVPLIVGYALPFFVGALLTHNFRRGNAGLLGSPIM 356
           F++FN TTPL+ FYG APWHFH  QS+P+++G ++P F   L     +R       +P  
Sbjct: 314 FLKFNFTTPLSKFYGVAPWHFHFFQSLPIVLGASIPAFAFGLFFPLSKRSFPKKYLNPFF 373

Query: 357 QIKCVVVLNIALYSCIDHKEFRFLYPLQPLFLSLSALEMHTWLQHHHARGTAWLKRVQSL 416
           Q+K  ++LN+ +YS + HKEFRF++PLQPLF+ +S+  +    + +  R    L  ++SL
Sbjct: 374 QVKLTILLNLLVYSTLPHKEFRFIFPLQPLFILISSFGLLRLDRDYWKR----LSGLKSL 429

Query: 417 LYVLPVLSITAALVLNTAHEAGVVSVMDYLHSAVPSAESIGFIMPCHSTPWQSHLHRNDL 476
           L+++P +S+  AL+L+T HE+G + VM +LH   P  +S+GFIMPCHSTP QS+LHR+D+
Sbjct: 430 LWLVPFVSVFIALLLDTFHESGSIEVMKFLHEE-PEIDSLGFIMPCHSTPGQSYLHRSDI 488

Query: 477 GKLWAISCQPPLDLLHQEDAGDQLLTYMDESDHLYENIPEFIHKNFPPVFRRDLRSPGRQ 536
             LW+I+C PPL LL   +A  +L TYMDESDHLY++I  FI+KNFPP FR+DLRSPG+ 
Sbjct: 489 QDLWSITCNPPLHLLGDPEAYSKLETYMDESDHLYDDISAFIYKNFPPPFRKDLRSPGKT 548

Query: 537 YAYEWPEFLVVFEHMDEAFMKEYLKDSNYVEVKRFFNTLSHWDSRRAG 584
           Y++EWP +LVVFEHM+ AF+K++LKDS+Y+E  RFFN+L+HWDSRR+G
Sbjct: 549 YSHEWPTYLVVFEHMENAFLKDFLKDSSYIEYNRFFNSLAHWDSRRSG 596

>Kwal_23.3478
          Length = 618

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/586 (45%), Positives = 368/586 (62%), Gaps = 15/586 (2%)

Query: 5   SILRTLFLWRLINALSIRSFFQADEYWQSLEPAHVKAFGYGGLTWEWQHGLRSYAFPMLF 64
           SI + L ++R++++L + S+FQ DE+WQ+LEPAH +AFGYG LTWEW +GLRSYAFP +F
Sbjct: 31  SIQKVLIIFRVLSSLFVVSYFQPDEFWQTLEPAHHQAFGYGKLTWEWDYGLRSYAFPFIF 90

Query: 65  EMSYYVAWILGVATRMALQGLAHATALCXXXXXXXXXXXXXM-----KAVWELPEAAQEL 119
           E+ Y    ++ V + +A Q +A  T  C             +       +   P+  +  
Sbjct: 91  EILYR---LVSVVSTIAEQIVA-ITVDCFVFTVSRIIPGSELAWSMVNEMQHFPQEIKSF 146

Query: 120 VEYYGVLYGPRVVMAAVAACGEFYSVLLVRKLYLRVXXXXXXXXXXXXPVSRLA-LMLTM 178
           +EYYGV+  P+V+MA + A GE Y+   + KLY R              + ++A  +L+ 
Sbjct: 147 LEYYGVIIAPKVMMALIGAVGEMYAFAFIEKLYTREFSGDEKNKMQSGKLVKMAACLLST 206

Query: 179 TNFFNCFFATRTFINSFEMTLTAVALYHWDWSGGLDVGSLGFSASLAVAAFACLQRPTNV 238
           TNFFN F  TRTF N+ EM LT  ALY WDW+GG  V    F+ SL    F CLQRPTN 
Sbjct: 207 TNFFNNFMITRTFANTLEMDLTCAALYFWDWTGGACVSGRNFTISLYCGIFLCLQRPTNA 266

Query: 239 LIWAVLGLFLVLNLVRSRRWQXXXXXXXXXXXXXXXXXXXXXXIDYYFYGGVLLPLLRFI 298
           LIW  LGLFLVLNL   + ++                      ID+YFY  ++ P+ RFI
Sbjct: 267 LIWVPLGLFLVLNLTARKDFKNLTVLVRKLLLVFLQVLAVNLAIDFYFYRELIFPVFRFI 326

Query: 299 EFNVTTPLAAFYGRAPWHFHLLQSVPLIVGYALPFFVGALLTHNFRRGNAGLLGSPIMQI 358
           +FN T+ L++FYG APWHFHLLQS+PLI+G++ P F+         +G  GL  S ++Q 
Sbjct: 327 KFNYTSALSSFYGTAPWHFHLLQSLPLILGWSTPLFLYGFFCSKTEKGREGL-NSSMLQA 385

Query: 359 KCVVVLNIALYSCIDHKEFRFLYPLQPLFLSLSALEMHTWLQHHHARGTAWLKRVQSLLY 418
           + VV++NI  +S I HKEFRFLY L P FL  S++ +   +          LK    L++
Sbjct: 386 RIVVIINIIAFSLISHKEFRFLYILHPFFLLFSSIALGPKIPTLEKMSNGPLKY---LVW 442

Query: 419 VLPVLSITAALVLNTAHEAGVVSVMDYLHSAVPSAESIGFIMPCHSTPWQSHLHRNDLGK 478
             P  SI A+L++++ HE GV  V  YLH  +P   S+GFIMPCHSTPWQS++HRND+  
Sbjct: 443 APPFFSIIASLLVSSYHETGVTEVTKYLHH-IPRIHSVGFIMPCHSTPWQSYIHRNDIQD 501

Query: 479 LWAISCQPPLDLLHQEDAGDQLLTYMDESDHLYENIPEFIHKNFPPVFRRDLRSPGRQYA 538
           +W+I+C+PPL LL   DA   L +YMDESD LY+N+P+FI++N PPVFR++LRSP ++Y+
Sbjct: 502 IWSITCEPPLFLLEDPDAEKLLASYMDESDLLYDNVPKFIYQNMPPVFRKELRSPSKEYS 561

Query: 539 YEWPEFLVVFEHMDEAFMKEYLKDSNYVEVKRFFNTLSHWDSRRAG 584
           +EWPE+L++F+ +D+ FMK++LKDS Y E  RFFNT SHWDSRR+G
Sbjct: 562 HEWPEYLIIFQQLDDTFMKDFLKDSAYSEEARFFNTWSHWDSRRSG 607

>Kwal_47.18842
          Length = 508

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 69/160 (43%), Gaps = 28/160 (17%)

Query: 298 IEFNVTTPLAAFYGRAPWHFHLLQSVPLIVGYALPFFVGALLTHNFRRGNAGLLGSPIMQ 357
           + +N+     A +G  P + HLL +VP ++G  L FFV        RR    L  S +  
Sbjct: 246 LAYNLKNSNLAEHGLHPRYTHLLLNVPQMLGPLLIFFVS-------RRQRINL--SFLAC 296

Query: 358 IKCVVVLNIALYSCIDHKEFRFLYPLQPLFLSLSALEMHTWLQHHHARGTAWLKRVQSLL 417
           I  ++VL     S   H+E RFL PL PLF     L              AWL       
Sbjct: 297 ISGIIVL-----SMFQHQELRFLIPLLPLFCVSVDLSNFDKFVSSQLVNKAWL------- 344

Query: 418 YVLPVLSITAALVLNTAHEAGVVSVMDYLHSAVPSAESIG 457
                 ++   +++ + H+ GVV+V++ L  A P  E IG
Sbjct: 345 ----AFNVIFGVIMGSLHQRGVVTVIEEL--ARP-GEKIG 377

>Sklu_1475.2 YOR149C, Contig c1475 982-2508 reverse complement
          Length = 508

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 75/162 (46%), Gaps = 28/162 (17%)

Query: 293 PLLRFIEFNVTTPLAAFYGRAPWHFHLLQSVPLIVGYALPFFVGALLTHNFRRGNAGLLG 352
           PL  F  +N+     A +G  P + H+L +VP I+G AL FF         RR    L  
Sbjct: 242 PLNNF-SYNMDESNLATHGLHPRYTHILFNVPQILGPALIFFFS-------RRYKLAL-- 291

Query: 353 SPIMQIKCVVVLNIALYSCIDHKEFRFLYPLQPLF-LSLSALEMHTWLQHHHARGTAWLK 411
            P++   C+    + + S   H+E RFL PL PLF +S++       ++  H     WL 
Sbjct: 292 -PLLS--CIS--GLVILSLFKHQELRFLVPLLPLFCISMNLSNFDKVIKWEHVIK-LWL- 344

Query: 412 RVQSLLYVLPVLSITAALVLNTAHEAGVVSVMDYLHSAVPSA 453
                     + +I + +++   H+ GV+  +D+L ++  +A
Sbjct: 345 ----------LFNICSGIIMGGLHQRGVILAIDHLRTSSDTA 376

>KLLA0C06567g complement(573595..575187) similar to sp|Q04174
           Saccharomyces cerevisiae YOR149c SMP3 protein kinase C
           pathway protein singleton, start by similarity
          Length = 530

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 66/156 (42%), Gaps = 26/156 (16%)

Query: 290 VLLPLLRFIEFNVTTPLAAFYGRAPWHFHLLQSVPLIVGYALPFFVGALLTHNFRRGNAG 349
           V+ PL   + +N+     A +G  P + HLL ++PLI G  +  F+              
Sbjct: 266 VIAPLNNLL-YNMKVDNIAQHGLHPRYTHLLINLPLICGPIILLFI----------SQKA 314

Query: 350 LLGSPIMQIKCVVVLNIALYSCIDHKEFRFLYPLQPLFLSLSALEMHTWLQHHHARGTAW 409
           +L  P   + C+    I + S   H+E RF+ P+ PL  +   L+            T+W
Sbjct: 315 VLKLP--ALSCIS--GILMLSLFRHQELRFIIPVLPLLCASMNLDNFDTFFQAETIITSW 370

Query: 410 LKRVQSLLYVLPVLSITAALVLNTAHEAGVVSVMDY 445
           L           V +I   L++   H+AG++ ++ Y
Sbjct: 371 L-----------VFNIVMGLIMGVFHQAGIIPLISY 395

>CAGL0K09548g complement(940088..941578) similar to sp|Q04174
           Saccharomyces cerevisiae YOR149c SMP3 protein kinase C
           pathway protein, hypothetical start
          Length = 496

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 96/225 (42%), Gaps = 30/225 (13%)

Query: 173 ALMLTMTNFFNCFFATRTFINSFEMTLTAVALYHW-----DWSGGLDVGSLGFSASLAVA 227
           AL+  ++++    +   +F NS E  L  + L ++     + +G L + S GF  S  V 
Sbjct: 123 ALVFILSSYITWCYQCHSFSNSLETILLLLVLSNYTDILSNKAGLLQLVSTGFLIS--VG 180

Query: 228 AFACLQRPTNVLIWAVLGLFLVLNLVRSRRWQXXXXXXXXXXXXXXXXXXXXXXIDYYFY 287
            F  +  P  +L+ ++     VL     R+W                        D + Y
Sbjct: 181 TFTRISFPAFLLLPSIQVFLKVL----YRKW----IQMVVIAVSMTLSTSIIVYFDTFMY 232

Query: 288 GG--VLLPLLRFIEFNVTTPLAAFYGRAPWHFHLLQSVPLIVGYALPFFVGALLTHNFRR 345
               +++  L+ + +N+     A +G  P + HLL ++PLI+G       G L+  N + 
Sbjct: 233 ESDEIIIAPLKNVVYNLNVDNLAKHGLHPRYTHLLVNIPLILG------PGLLMIRNTKN 286

Query: 346 GNAGLLGSPIMQIKCVVVLNIALYSCIDHKEFRFLYPLQPLFLSL 390
                L  P++ I    + ++   S + H+E RFL P+ PLF +L
Sbjct: 287 ---DFLNLPLLSI----ISSLFFLSALRHQELRFLLPVVPLFSTL 324

>Scas_714.36
          Length = 514

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 64/139 (46%), Gaps = 19/139 (13%)

Query: 310 YGRAPWHFHLLQSVPLIVGYALPFFVGALLTHNFRRGNAGLLGSPIMQIKCVVVLNIALY 369
           +G  PW+ H+L ++P ++G  + F    LL  +       ++ S            +   
Sbjct: 266 HGLHPWYTHILVNLPQLLGPMIIFLPLILLKTSTTIPTLSIMSS------------MVTL 313

Query: 370 SCIDHKEFRFLYPLQPLFLSLSALEMHTWLQHHHARGTAWLKRVQSLLYVLPVLSITAAL 429
           S   H+EFRFL PL PL L   A  +   +Q      +++ + V  LL+VL   +I  A+
Sbjct: 314 SYFKHQEFRFLTPLVPLLLIQLAACIPNSIQQ-----SSFKRSVIRLLWVL--FNIIFAV 366

Query: 430 VLNTAHEAGVVSVMDYLHS 448
           ++   H++GV+  +    S
Sbjct: 367 IVGVFHQSGVIQSLSNFSS 385

>YOR149C (SMP3) [4948] chr15 complement(609838..611388) Protein
           required for addition of the fourth mannose in
           glycosylphosphotidylinositol biosynthesis, functions in
           the protein kinase C pathway and required for plasmid
           maintenance [1551 bp, 516 aa]
          Length = 516

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 75/163 (46%), Gaps = 29/163 (17%)

Query: 288 GGVLLPLLRFIEFNVTTPLAAFYGRAPWHFHLLQSVPLIVGYALPFFVGALLTHNFRRGN 347
           G V+ PL   +++N+       +G  P + HLL ++P IVG   P  + A+ +       
Sbjct: 241 GFVITPL-NNLKYNLNVQNLQVHGLHPRYTHLLVNLPQIVG---PVLLLAIFS------- 289

Query: 348 AGLLGSPIMQIKCVVVLNIALY-SCIDHKEFRFLYPLQPLFLS-LSALEMHTWLQHHHAR 405
               G  + ++    +++  L+ S   H+E RFL PL PL ++ L+   + + L +    
Sbjct: 290 ----GYKLDKLSTYAIISGLLFLSFFQHQELRFLVPLVPLLVTNLNWTPLSSTLVNKKIF 345

Query: 406 GTAWLKRVQSLLYVLPVLSITAALVLNTAHEAGVVSVM-DYLH 447
              WL           + +I  A ++  +H+AG++  + DY H
Sbjct: 346 KGTWL-----------LFNIIMAFIMGISHQAGIIQFLGDYFH 377

>Scas_660.37
          Length = 317

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%)

Query: 415 SLLYVLPVLSITAALVLNTAHEAGVVSVMDYLHSAV 450
           SL   LPV+ IT AL+ +T  + G V V+ YL S +
Sbjct: 53  SLNDQLPVMHITDALLTSTKQKCGFVDVVTYLESII 88

>AAR043C [229] [Homologous to ScYNR030W (ECM39) - SH]
           (418301..419914) [1614 bp, 537 aa]
          Length = 537

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 52/249 (20%), Positives = 102/249 (40%), Gaps = 27/249 (10%)

Query: 282 IDYYFYGGVLLPLLRFIEFNVTTPLAAFYGRAPWHFHLLQSVPLIVGYALPFFVGALLTH 341
           ID YF+G   +P +    FNV    +A +G  P   +  + +P +     P  V      
Sbjct: 240 IDSYFWGRSCVPEMDAFVFNVIGGQSAKWGTEPLLAYFTRYLPRLF---FPPMVTVFCIA 296

Query: 342 NFRRGNAGLLGSPIMQIKCVVVLNIALYSCIDHKEFRFL---YPLQPLFLSLSALEMHTW 398
             R     +  +P   +    +++I L S   HKE+RF+    P   L  S+ A  + + 
Sbjct: 297 GVR-----IASTPFRIVFAASLIHIMLLSLQPHKEWRFIIYSVPAITLLGSMGAAYLFSL 351

Query: 399 LQHHHARGTAWLKRVQSLLYVLPVLSITAALVLNTAHEAGVVSVMDYLHSAVPSAESIGF 458
                A G +    ++ L+ + P+L +  +++++       +S M+Y      SA +  +
Sbjct: 352 ANWRQANGFS----MRILILISPLLMLMHSVLMS------YISSMNYPGGYALSAFN-KY 400

Query: 459 IMPCHSTPWQSHLHRNDLGKLWAISCQPP--LDLLHQEDAGDQLLTYMDESDHLYENIPE 516
           ++  + +    HL          +  Q P    +++ +  GD+LL      D++    P 
Sbjct: 401 VLDNNISNATVHLDVFTCMTGATLFGQLPDSYGIIYDKTEGDELLDAWSSFDYVITTDP- 459

Query: 517 FIHKNFPPV 525
             + + PPV
Sbjct: 460 --NSSLPPV 466

>CAGL0K08492g 851478..853175 similar to sp|P34248 Saccharomyces
           cerevisiae YKL100c, hypothetical start
          Length = 565

 Score = 30.0 bits (66), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 21/108 (19%), Positives = 46/108 (42%), Gaps = 1/108 (0%)

Query: 389 SLSALEMHTWLQHHHARGTAWLKRVQSLLYVLPVLSITAALVLNTAHEAGVVSVMDYLHS 448
           + +A  ++ +L     R  ++L +   L  +LP   +T +      H+ G VS + Y + 
Sbjct: 196 TFAATFVYNYLIQSFIRNLSYLFKFNPL-KILPRCRLTVSDDNVEIHQTGAVSNLCYKNQ 254

Query: 449 AVPSAESIGFIMPCHSTPWQSHLHRNDLGKLWAISCQPPLDLLHQEDA 496
                +    +     T W+SH++R +L    ++     +  ++  DA
Sbjct: 255 ISGKIQEAKRVEKIKKTSWESHMYRRELKAPSSVKSDSQILNVYMSDA 302

>Sklu_1894.3 YNL219C, Contig c1894 4461-6116 reverse complement
          Length = 551

 Score = 30.0 bits (66), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 2/41 (4%)

Query: 26 QADEYWQSLEPAHVKAFGYGGLTWEW--QHGLRSYAFPMLF 64
            DE +   EP +V   G+G  TWE+  ++ +RS+AF + F
Sbjct: 30 DCDETFNYWEPLNVLVRGFGKQTWEYSPEYSIRSWAFLLPF 70

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.328    0.140    0.457 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,141,919
Number of extensions: 677330
Number of successful extensions: 1906
Number of sequences better than 10.0: 26
Number of HSP's gapped: 1904
Number of HSP's successfully gapped: 30
Length of query: 584
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 477
Effective length of database: 12,891,983
Effective search space: 6149475891
Effective search space used: 6149475891
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 64 (29.3 bits)