Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL279W49348424730.0
Sklu_2101.356845513750.0
Kwal_23.348850246313141e-178
KLLA0D10065g46642612861e-175
CAGL0F07799g58047212031e-161
YMR171C55048011291e-150
Scas_669.1058553510741e-141
Sklu_2430.75393703281e-32
KLLA0B12760g5422313112e-30
YKL124W (SSH4)5793743077e-30
CAGL0M06545g5873653078e-30
Scas_721.1265732373015e-29
ABL026W4802092872e-27
Kwal_26.76655512962821e-26
AFR242C82361780.17
CAGL0I04114g910167750.43
CAGL0F07007g48568701.5
Kwal_47.1917383625683.1
CAGL0J00693g1884126673.7
Scas_712.2397394674.5
YDR439W (LRS4)34751655.9
YGL227W (VID30)95844656.9
KLLA0E17633g109053658.0
Scas_688.22187650648.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL279W
         (484 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL279W [1462] [Homologous to ScYMR171C - SH] complement(212401....   957   0.0  
Sklu_2101.3 YMR171C, Contig c2101 5004-6710                           534   0.0  
Kwal_23.3488                                                          510   e-178
KLLA0D10065g complement(851283..852683) similar to sp|Q03212 Sac...   499   e-175
CAGL0F07799g complement(760681..762423) similar to sp|Q03212 Sac...   468   e-161
YMR171C (YMR171C) [4126] chr13 complement(603867..605519) Protei...   439   e-150
Scas_669.10                                                           418   e-141
Sklu_2430.7 YKL124W, Contig c2430 12905-14524                         130   1e-32
KLLA0B12760g 1114942..1116570 some similarities with sp|P32343 S...   124   2e-30
YKL124W (SSH4) [3142] chr11 (210239..211978) Protein that confer...   122   7e-30
CAGL0M06545g 677238..679001 similar to sp|P32343 Saccharomyces c...   122   8e-30
Scas_721.126                                                          120   5e-29
ABL026W [566] [Homologous to ScYKL124W (SSH4) - SH] complement(3...   115   2e-27
Kwal_26.7665                                                          113   1e-26
AFR242C [3434] [Homologous to ScYGL227W (VID30) - SH] (873480..8...    35   0.17 
CAGL0I04114g 360592..363324 similar to sp|P53076 Saccharomyces c...    33   0.43 
CAGL0F07007g 687174..688631 highly similar to sp|P53170 Saccharo...    32   1.5  
Kwal_47.19173                                                          31   3.1  
CAGL0J00693g complement(61246..66900) similar to sp|P08964 Sacch...    30   3.7  
Scas_712.23                                                            30   4.5  
YDR439W (LRS4) [1260] chr4 (1339664..1340707) Protein involved i...    30   5.9  
YGL227W (VID30) [1771] chr7 (69670..72546) Protein that regulate...    30   6.9  
KLLA0E17633g complement(1562195..1565467) some similarities with...    30   8.0  
Scas_688.22                                                            29   8.8  

>ADL279W [1462] [Homologous to ScYMR171C - SH]
           complement(212401..213882) [1482 bp, 493 aa]
          Length = 493

 Score =  957 bits (2473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/484 (96%), Positives = 465/484 (96%)

Query: 1   MFNIAIWFLVRGARGMPVTLQRVARRSATVFPDDNELDMDFVLFTFSLVFMLLCYGMMVL 60
           MFNIAIWFLVRGARGMPVTLQRVARRSATVFPDDNELDMDFVLFTFSLVFMLLCYGMMVL
Sbjct: 1   MFNIAIWFLVRGARGMPVTLQRVARRSATVFPDDNELDMDFVLFTFSLVFMLLCYGMMVL 60

Query: 61  IYLGLRYVVRRCFTRRIALXXXXXXRANSGDVPTVLDDELEVRHKLAQLSPEEQFYYKQG 120
           IYLGLRYVVRRCFTRRIAL      RANSGDVPTVLDDELEVRHKLAQLSPEEQFYYKQG
Sbjct: 61  IYLGLRYVVRRCFTRRIALSSSDSSRANSGDVPTVLDDELEVRHKLAQLSPEEQFYYKQG 120

Query: 121 EEFIKQNPPALMPYQTVAGGGSHGEPADVFDPVINDQTLRYIEEEGAQAWEFQPSPSLPP 180
           EEFIKQNPPALMPYQTVAGGGSHGEPADVFDPVINDQTLRYIEEEGAQAWEFQPSPSLPP
Sbjct: 121 EEFIKQNPPALMPYQTVAGGGSHGEPADVFDPVINDQTLRYIEEEGAQAWEFQPSPSLPP 180

Query: 181 DFVKVENRTELTFMNSNSDVSVATNLPIPLANKVYYFECKIFELCDRLGRPVSHLSENQI 240
           DFVKVENRTELTFMNSNSDVSVATNLPIPLANKVYYFECKIFELCDRLGRPVSHLSENQI
Sbjct: 181 DFVKVENRTELTFMNSNSDVSVATNLPIPLANKVYYFECKIFELCDRLGRPVSHLSENQI 240

Query: 241 VSFGLATSPYPYFRLPGRHHHSVAYDSNGARRLNNSFKLPQELSSLFPRCEKGDVIGIGY 300
           VSFGLATSPYPYFRLPGRHHHSVAYDSNGARRLNNSFKLPQELSSLFPRCEKGDVIGIGY
Sbjct: 241 VSFGLATSPYPYFRLPGRHHHSVAYDSNGARRLNNSFKLPQELSSLFPRCEKGDVIGIGY 300

Query: 301 RTRSGTVFFTRNGKKLNEKRIGGHIKGWKIKYLYPIVGANVPCKIHVNFGTYGFVYIEAN 360
           RTRSGTVFFTRNGKKLNEKRIGGHIKGWKIKYLYPIVGANVPCKIHVNFGTYGFVYIEAN
Sbjct: 301 RTRSGTVFFTRNGKKLNEKRIGGHIKGWKIKYLYPIVGANVPCKIHVNFGTYGFVYIEAN 360

Query: 361 VKKWGYAKLNGMKLPPPAYEDYDRDVLLESSYEDEVSEGETNSFVEXXXXXXXXXXXXXF 420
           VKKWGYAKLNGMKLPPPAYEDYDRDVLLESSYEDEVSEGETNSFVE             F
Sbjct: 361 VKKWGYAKLNGMKLPPPAYEDYDRDVLLESSYEDEVSEGETNSFVEHLHDGHLLPPPPGF 420

Query: 421 EFSTTPTSNCDQFTLNTLPTEPPGYMSDVNAGSKHNGRGVGRSENVQSDAPNAELLNANT 480
           EFSTTPTSNCDQFTLNTLPTEPPGYMSDVNAGSKHNGRGVGRSENVQSDAPNAELLNANT
Sbjct: 421 EFSTTPTSNCDQFTLNTLPTEPPGYMSDVNAGSKHNGRGVGRSENVQSDAPNAELLNANT 480

Query: 481 FANQ 484
           FANQ
Sbjct: 481 FANQ 484

>Sklu_2101.3 YMR171C, Contig c2101 5004-6710
          Length = 568

 Score =  534 bits (1375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/455 (57%), Positives = 332/455 (72%), Gaps = 18/455 (3%)

Query: 4   IAIWFLVRGARGMPVTLQRVARR-SATVFPDDNELDMDFVLFTFSLVFMLLCYGMMVLIY 62
           I + F+ +   G P++    +   SA  F DD E DMD  +  FS+ FMLL Y ++ LIY
Sbjct: 64  IVLAFIPKLTIGAPISEGTYSEHPSAPGFQDDYEDDMDMAMLFFSMAFMLLSYILLTLIY 123

Query: 63  LGLRYVVRRCFTRRIALXXXXX---XRANSGDVPTVLDDELEVRHKLAQLSPEEQFYYKQ 119
             +R+V+++ F+ RI+L            S   P+ LDDE  V+ KL +LSPEEQFYYKQ
Sbjct: 124 FSVRFVIKKYFSTRISLNNNNSPNIRTTTSNSWPSSLDDEEAVKDKLVKLSPEEQFYYKQ 183

Query: 120 GEEFIKQNPPALMPYQTVAGGGSHGEPADVFDPVINDQTLRYIEEEGAQAWEFQPSPSLP 179
           GEE+IKQNPP L+P+++    G       + DP+INDQT+R+IEEEG  AWEFQP P+LP
Sbjct: 184 GEEYIKQNPPLLIPHRSEDSQG-------MLDPIINDQTIRFIEEEGVHAWEFQPDPNLP 236

Query: 180 PDFVKVENRTELTFMNSNSDVSVATNLPIPLANKVYYFECKIFELCDRLGRPVSHLSENQ 239
            D + +EN+TE+TF+N N D SV TNLP+P  N+VYYFECKIFEL        ++LS+N+
Sbjct: 237 NDTILIENKTEITFLNYNYDASVMTNLPVPRVNRVYYFECKIFELNTSRSDN-NYLSDNE 295

Query: 240 IVSFGLATSPYPYFRLPGRHHHSVAYDSNGARRLNNSFKLPQELSSLFPRCEKGDVIGIG 299
           ++SFGL++SPYPYFRLPGRHHHS+AYDS G RR N+SF+L  EL+S+FPR +KGD+IGIG
Sbjct: 296 MISFGLSSSPYPYFRLPGRHHHSIAYDSTGGRRFNDSFELSAELASIFPRYQKGDIIGIG 355

Query: 300 YRTRSGTVFFTRNGKKLNEKRIGGHIKGWKIKYLYPIVGANVPCKIHVNFGTYGFVYIEA 359
           YRT SGTVFFTRNGKKLNEK IGGHIKGWK+KYLYPIVGANVPCK+HVNFG+YGFV+IEA
Sbjct: 356 YRTNSGTVFFTRNGKKLNEKPIGGHIKGWKLKYLYPIVGANVPCKVHVNFGSYGFVFIEA 415

Query: 360 NVKKWGYAKLNGMKLPPPAYEDYDRDVLLESSYEDEVSEGETNSFVEXXXXXXXXXXX-- 417
           NVKKWGYAK +G+KLPPP+Y++Y +DVLLESSYED++++ E+ S VE             
Sbjct: 416 NVKKWGYAKSHGVKLPPPSYDEYGQDVLLESSYEDDITDNESVSTVEGDIVDSDGELLPP 475

Query: 418 -XXFEFSTTPTSN---CDQFTLNTLPTEPPGYMSD 448
              FEFSTTP S     DQ TL++LP +PP Y SD
Sbjct: 476 PPGFEFSTTPQSRGNIGDQITLDSLPAQPPSYSSD 510

>Kwal_23.3488
          Length = 502

 Score =  510 bits (1314), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 263/463 (56%), Positives = 323/463 (69%), Gaps = 21/463 (4%)

Query: 34  DNELDMDFVLFTFSLVFMLLCYGMMVLIYLGLRYVVRRCFTRRIALXXXXXXR---ANSG 90
           D E D+D  L  FSL FM+  Y  + L+YL +++++RR F   I+L          A + 
Sbjct: 47  DYEDDLDIGLMMFSLAFMVFSYFALTLVYLVVKFLLRRYFRTGISLSEGESRVIGPAVNA 106

Query: 91  DVPTVLDDELEVRHKLAQLSPEEQFYYKQGEEFIKQNPPALMPYQTVAGGGSHGEPADVF 150
             P+ LDD   VR KLA++S EEQFYYKQGEEFIKQNPP L+P ++  G       A+  
Sbjct: 107 RWPSALDDADAVRDKLARMSAEEQFYYKQGEEFIKQNPPLLLPDRSPVG-------AETV 159

Query: 151 DPVINDQTLRYIEEEGAQAWEFQPSPSLPPDFVKVENRTELTFMNSNSDVSVATNLPIPL 210
           DP+IN+QTL++I+EEGA AWEFQP P LP D V VEN++E+TF+N N DVSV TNLPIP 
Sbjct: 160 DPIINEQTLQFIDEEGAHAWEFQPDPKLPNDSVLVENKSEITFLNYNYDVSVMTNLPIPR 219

Query: 211 ANKVYYFECKIFELCDRLGRPVSHLSENQIVSFGLATSPYPYFRLPGRHHHSVAYDSNGA 270
            N+VYY E KIFEL        ++ S+N+++SFGL+TSPYPYFRLPGRHHHS+AYDS G 
Sbjct: 220 LNRVYYCEFKIFEL--NTAGSNNNSSQNEMLSFGLSTSPYPYFRLPGRHHHSIAYDSTGG 277

Query: 271 RRLNNSFKLPQELSSLFPRCEKGDVIGIGYRTRSGTVFFTRNGKKLNEKRIGGHIKGWKI 330
           RR N+SF+L  EL+S+FPRCEKGDVIGIGYRT SGTVFFTRNGKKLNEK IGGHIKGWK 
Sbjct: 278 RRFNDSFELSPELASIFPRCEKGDVIGIGYRTNSGTVFFTRNGKKLNEKSIGGHIKGWKF 337

Query: 331 KYLYPIVGANVPCKIHVNFGTYGFVYIEANVKKWGYAKLNGMKLPPPAYEDYDRDVLLES 390
           KY+YPIVG+N+PCK+HVNFGTYGFV+IEANVKKWGYAK NGMKLPPP+YEDY +DVLLES
Sbjct: 338 KYVYPIVGSNIPCKVHVNFGTYGFVFIEANVKKWGYAKSNGMKLPPPSYEDYSQDVLLES 397

Query: 391 SYEDEVSEGETNSFVEXXXXXXXXXXX---XXFEFSTTPT-SNCDQFTLNTLPTEPPGYM 446
           SYED+ ++ E+ S ++                FE+S +P  S   QFTLN+LP EPP Y 
Sbjct: 398 SYEDDATDNESTSTIDGDIIDSEGHLLPPPPGFEYSVSPQPSAAGQFTLNSLPPEPPRYA 457

Query: 447 SDVNAGSKHNGRGVGRSENVQSDAPNAEL-----LNANTFANQ 484
           SD    ++    G    +         E+     L  NT ANQ
Sbjct: 458 SDTPEDAEEAETGQQLEQLAHDVEEGNEIYAGNELGKNTMANQ 500

>KLLA0D10065g complement(851283..852683) similar to sp|Q03212
           Saccharomyces cerevisiae YMR171c, start by similarity
          Length = 466

 Score =  499 bits (1286), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 245/426 (57%), Positives = 313/426 (73%), Gaps = 18/426 (4%)

Query: 32  PDDNELDMDFVLFTFSLVFMLLCYGMMVLIYLGLRYVVRRCFTRRIALXXXXXXRANSGD 91
           P D ++DMD ++FT  ++FM L Y + +L+Y   R++V+R FT RI+L           D
Sbjct: 30  PSDPDVDMDLIVFT--MMFMFLSYLLSILVYFVTRWLVKRLFTARISLHEEGTMNGGQSD 87

Query: 92  VPT--VLDDELEVRHKLAQLSPEEQFYYKQGEEFIKQNPPALMPYQTVAGGGSHGEPADV 149
           +     LDDE EV+  L  LSP+EQFYYKQGEE++KQNPP L+PY              +
Sbjct: 88  LSEDRYLDDESEVKEFLQNLSPKEQFYYKQGEEYVKQNPPLLVPY---LPNDPENREEVI 144

Query: 150 FDPVINDQTLRYIEEEGAQAWEFQPSPSLPPDFVKVENRTELTFMNSNSDVSVATNLPIP 209
            DP++N+QTL++IEEEGA AWEFQ  P+LP D V ++ RTELTF+N + D SV T LPIP
Sbjct: 145 PDPIVNEQTLQFIEEEGAAAWEFQADPNLPNDTVMIQERTELTFLNFSYDASVMTTLPIP 204

Query: 210 LANKVYYFECKIFELCDRLGRPVSHLSENQIVSFGLATSPYPYFRLPGRHHHSVAYDSNG 269
             NKVYY+ECKIFEL     +  +HLS+N+++S GL+TSPYPYFRLPGRHHHS++YDS+G
Sbjct: 205 RLNKVYYYECKIFEL----NQGKNHLSDNEMISIGLSTSPYPYFRLPGRHHHSISYDSDG 260

Query: 270 ARRLNNSFKLPQELSSLFPRCEKGDVIGIGYRTRSGTVFFTRNGKKLNEKRIGGHIKGWK 329
            RR+N+SF +  EL +LFPR EKGDVIGIGYRTRSGT+FFT NGKKLNEK++GGHIKGWK
Sbjct: 261 CRRMNSSFPMSAELQTLFPRFEKGDVIGIGYRTRSGTIFFTHNGKKLNEKKVGGHIKGWK 320

Query: 330 IKYLYPIVGANVPCKIHVNFGTYGFVYIEANVKKWGYAKLNGMKLPPPAYEDYDRDVLLE 389
           +KYLYPIVG+N+PCKIHVNFGTYGFVYIEANVKKWGY+K  G+KLPPP+YEDYD+DVLLE
Sbjct: 321 LKYLYPIVGSNIPCKIHVNFGTYGFVYIEANVKKWGYSKNAGIKLPPPSYEDYDQDVLLE 380

Query: 390 SSYEDEVSEGE---TNSFVEXXXXXXXXXX--XXXFEFSTTPTSN--CDQFTLNTLPTEP 442
           S++ED+VS+ E   ++S  E               FEFST+  S+   +  T+++LP EP
Sbjct: 381 SAFEDDVSDSESITSDSINEQITDQSGNILPPPPGFEFSTSVASDIPVESITMHSLPAEP 440

Query: 443 PGYMSD 448
           P Y +D
Sbjct: 441 PNYSAD 446

>CAGL0F07799g complement(760681..762423) similar to sp|Q03212
           Saccharomyces cerevisiae YMR171c, hypothetical start
          Length = 580

 Score =  468 bits (1203), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 253/472 (53%), Positives = 316/472 (66%), Gaps = 46/472 (9%)

Query: 34  DNELDMDFVLFTF-SLVFMLLCYGMMVLIYLGLRYVVRRCFTR--RIAL----------X 80
           D++LD++ +   F S++ M LC   + +IY   + VV R  TR  RI+L           
Sbjct: 63  DDQLDINVMFIYFGSMLVMYLC---ICIIYFTTKIVVTRLLTRHARISLLNEEGMATGLS 119

Query: 81  XXXXXRANSGDV--PTVLDDELEVRHKLAQLSPEEQFYYKQGEEFIKQNPPALMPYQTVA 138
                 A S +   P+ LDDE EV+ KL +LSPEEQFYYKQGEE+IKQNPP +     ++
Sbjct: 120 ARSRRLAESAESRWPSALDDENEVKSKLQKLSPEEQFYYKQGEEYIKQNPPLI-----IS 174

Query: 139 GGGSHGEPADVFDPVINDQTLRYIEEEGAQAWEFQPSPSLPPDFVKVENRTELTFMNSNS 198
            G   G+   V DP+INDQT ++IEEEGA AWEFQP+P+LP D + VEN+TE++F+N N 
Sbjct: 175 TGSRSGDQNTVNDPIINDQTRQFIEEEGALAWEFQPNPNLPNDTIIVENKTEISFLNYNY 234

Query: 199 DVSVATNLPIPLANKVYYFECKIFELCDRLGRPVSHLSENQIVSFGLATSPYPYFRLPGR 258
           D SV TNLPIP  N+VYY E KIFEL   +    + L +N+I+SFGL+TSPYPYFRLPGR
Sbjct: 235 DASVTTNLPIPCINRVYYCEFKIFELS--ITDDQTTLKDNEIISFGLSTSPYPYFRLPGR 292

Query: 259 HHHSVAYDSNGARRLNNSFKLPQELSSLFPRCEKGDVIGIGYRTRSGTVFFTRNGKKLNE 318
           HHHS+AYDSNGARR N+SFKL  EL+ LFP+C+KGD+IGIGYRTRSGTVFFTRNGKK++E
Sbjct: 293 HHHSIAYDSNGARRFNDSFKLEPELADLFPKCQKGDIIGIGYRTRSGTVFFTRNGKKISE 352

Query: 319 KRIGGHIKGWKIKYLYPIVGANVPCKIHVNFGTYGFVYIEANVKKWGYAKLNGMKLPPPA 378
           K +GGHIKGWK KYLYP+VGANVPCKIHVNFG+YGFV+IEANVKKWGYAK NG+KLPPP+
Sbjct: 353 KSVGGHIKGWKFKYLYPVVGANVPCKIHVNFGSYGFVFIEANVKKWGYAKPNGIKLPPPS 412

Query: 379 YEDYDRDVLLESSYEDEVSEGETNSFVEXXXXXXXXXXXXX---------------FEFS 423
           Y+DY +D LLES YED  +    +                                FEFS
Sbjct: 413 YDDYVQDTLLESGYEDNDNSDNDSDDESDTDNRRQHRSIKNTIIDIDGNLLPPPPGFEFS 472

Query: 424 TTPTSNC--DQFTLNTLPTEPPGYM---SDVNAGSKHNGR-GVGRSENVQSD 469
           T+P S+   ++  L++LP  PP Y    S     SK   R  VGRS+ +  D
Sbjct: 473 TSPHSHGTNEEINLDSLPMNPPSYSDEESKNQVKSKITPRDSVGRSDGLTQD 524

>YMR171C (YMR171C) [4126] chr13 complement(603867..605519) Protein
           containing a SPRY (SPla and RYanodine Receptor) domain,
           has moderate similarity to uncharacterized C. albicans
           Orf6.5491p [1653 bp, 550 aa]
          Length = 550

 Score =  439 bits (1129), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 238/480 (49%), Positives = 306/480 (63%), Gaps = 47/480 (9%)

Query: 33  DDNELDMDFVLFTFSLVFMLLC-------YGMMVLIYLGLRYVVRRCFTRRIALXXXXXX 85
           D +EL+MD +LF F  + ++         +   +   L   Y       +RI+L      
Sbjct: 38  DTDELNMDIMLFAFGTLIVVYIVICIVYFFTKQIATRLITAYYNEHGPGQRISLFSDYD- 96

Query: 86  RANSGDV-------------PTVLDDELEVRHKLAQLSPEEQFYYKQGEEFIKQNPPALM 132
             N+  V             P  LDD  EVR KLAQLSPEEQFYYKQGEE+IKQNPP L+
Sbjct: 97  -ENNAHVHSRRLMENMSLRWPNNLDDADEVRDKLAQLSPEEQFYYKQGEEYIKQNPPFLL 155

Query: 133 PYQTVAGGGSHGEPADVFDPVINDQTLRYIEEEGAQAWEFQPSPSLPPDFVKVENRTELT 192
               +             DP++N+QT +YI+EEGA AWEF P+P +P   V VEN+TE++
Sbjct: 156 NQGLLQQSEDSNPDTTREDPIMNEQTRQYIQEEGAYAWEFSPNPDMPNHTVIVENKTEVS 215

Query: 193 FMNSNSDVSVATNLPIPLANKVYYFECKIFELCDRLGRPVSHLSENQIVSFGLATSPYPY 252
           F+N N D S++TNLPIP  NKVYY E KIFE    L     ++S+  ++SFGL+T PYPY
Sbjct: 216 FLNYNYDASISTNLPIPCINKVYYCEFKIFETDGPLNSD-ENVSKG-VISFGLSTQPYPY 273

Query: 253 FRLPGRHHHSVAYDSNGARRLNNSFKLPQELSSLFPRCEKGDVIGIGYRTRSGTVFFTRN 312
           FRLPGRHHHS+AYDSNGARR N+SFKL ++L +LFP+CEKGD++GIGYR+RSGTVFFTRN
Sbjct: 274 FRLPGRHHHSIAYDSNGARRFNDSFKLNEQLRTLFPQCEKGDIVGIGYRSRSGTVFFTRN 333

Query: 313 GKKLNEKRIGGHIKGWKIKYLYPIVGANVPCKIHVNFGTYGFVYIEANVKKWGYAKLNGM 372
           GKKLNEK +GGHI+GWK +YLYPI+G+NVPC+IHVNFGTYGFVYIEANVKKWGYAK NG+
Sbjct: 334 GKKLNEKSVGGHIRGWKFQYLYPIIGSNVPCQIHVNFGTYGFVYIEANVKKWGYAKSNGI 393

Query: 373 KLPPPAYEDYDRDVLLESSYED-----EVSEGETNSFVEXXXXXXXXXXXXX-------- 419
           KLPPP+YEDY +D LLES  ED     + S+G++++                        
Sbjct: 394 KLPPPSYEDYGKDTLLESGGEDNDFDEDFSDGDSDNIAAGSTTNLNDDIIIRNGEILPPP 453

Query: 420 --FEFSTTPTSN----CDQFTLNTLPTEPPGYMSD----VNAGSKHNGRGVGRSENVQSD 469
             FEF+ +P +      ++  L++LP  PP Y  D     N  S  +GR +G S N+ +D
Sbjct: 454 PGFEFTMSPPTGKKIINEEINLDSLPMLPPSYSDDEHHSKNDKSAISGRIIGTSRNLITD 513

>Scas_669.10
          Length = 585

 Score =  418 bits (1074), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 253/535 (47%), Positives = 334/535 (62%), Gaps = 73/535 (13%)

Query: 1   MFNIAIWFLVRGARG--MPVTLQRVARRSATVFP--DDNELDMDFVLFTFSLVFMLLCYG 56
           +  +  ++L +   G  +P  L        T +P  DD + D+DF +  FSL+ M++ Y 
Sbjct: 8   LLQLLTFWLCQRVNGYVIPRDLPHSEESIGTPYPYEDDKDEDVDFHVMLFSLITMIIIYV 67

Query: 57  MMVLIYLGLRYVVRRCFTR---RIAL----XXXXXXRANSG---------------DVPT 94
           +++L+Y+ +++VV R  T    RI+L          R N+                D+ +
Sbjct: 68  LVILVYIVVKFVVTRMLTSNISRISLLNRTEVEESTRTNNEGTGRSRRSTRRDQRFDLES 127

Query: 95  VLDDELEVRHKLAQLSPEEQFYYKQGEEFIKQNPPALMPYQTVA------GGGSHGEPAD 148
            LDD   V+ KL+ L+PEEQFYYKQGEEFIKQNPP ++P              S+ E   
Sbjct: 128 FLDDPETVKSKLSLLNPEEQFYYKQGEEFIKQNPPIIIPPNNNNNSNDISTTDSNAED-- 185

Query: 149 VFDPVINDQTLRYIEEEGAQAWEFQPSPSLPPDFVKVENRTELTFMNSNSDVSVATNLPI 208
             DP++N QT ++IEEEGA AWEFQ  P+LP D + +EN+TE+TF+N N D SV TNLPI
Sbjct: 186 --DPIMNHQTKQFIEEEGASAWEFQADPNLPNDTILIENKTEITFLNYNYDASVMTNLPI 243

Query: 209 PLANKVYYFECKIFELCDRLGRPVSHLSENQIVSFGLATSPYPYFRLPGRHHHSVAYDSN 268
           P  N+VYY E KIFEL +   +  ++LS N+++S GLATSPYPYFRLPGRHHHS+AYDSN
Sbjct: 244 PCINRVYYCEFKIFELNNSPEQ--TNLSPNEVISMGLATSPYPYFRLPGRHHHSIAYDSN 301

Query: 269 GARRLNNSFKLPQELSSLFPRCEKGDVIGIGYRTRSGTVFFTRNGKKLNEKRIGGHIKGW 328
           GARR N+SF L  EL++LFP CE+GD+IG+GYRTRSGT FFTRNGKK++EK IGGHIKG 
Sbjct: 302 GARRFNDSFPLDPELANLFPVCERGDIIGVGYRTRSGTFFFTRNGKKVSEKSIGGHIKGC 361

Query: 329 KIKYLYPIVGANVPCKIHVNFGTYGFVYIEANVKKWGYAKLNGMKLPPPAYEDYDRDVLL 388
           KIKYLYPIVG NVPCK+HVNFGTYGFVYIEANVKKWGYAK +G+K+PPP+YE+Y +D L+
Sbjct: 362 KIKYLYPIVGTNVPCKVHVNFGTYGFVYIEANVKKWGYAKSHGLKVPPPSYEEYGKDALV 421

Query: 389 ESSYEDEVSEG-----------------------ETNSFVEXXXXXXXXXXXX----XFE 421
             SY+D + +G                       + N+  E                 FE
Sbjct: 422 -GSYQD-LEDGINDEEEDYEDEEEEDEEEDYDEEDDNTTTETDPLRDEYGQLLPPPPGFE 479

Query: 422 FSTTPTSNCDQ-----FTLNTLPTEPPGYMSDVNAGSKHNGRGVGRSEN-VQSDA 470
           FST+P SN  Q       LN+LP +PP Y  DV+  +       GRS++ +++DA
Sbjct: 480 FSTSPLSNFGQNEEEDINLNSLPYDPPRYSQDVSNRTNSFTLDEGRSKDFIENDA 534

>Sklu_2430.7 YKL124W, Contig c2430 12905-14524
          Length = 539

 Score =  130 bits (328), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 102/370 (27%), Positives = 165/370 (44%), Gaps = 98/370 (26%)

Query: 92  VPTVLDDELEVRHK-----LAQLSPEEQFYYKQGEEFIKQNPPALMPYQTVAGGGSHGEP 146
            P   DDE  V+ +       + S  E   Y++ +EF K NPP +  + T          
Sbjct: 106 TPGKFDDEQAVQEQEDECFKDKFSKFEIELYQRAKEFQKVNPPIVKSFGT---------- 155

Query: 147 ADVFDPVINDQTLRYIEEEGAQAWEFQPS--------PSLPPDFVKVENRTELTFMNSNS 198
              + P+ + Q    I++ G Q++ F PS         +  P F+ ++++ ++ F   N 
Sbjct: 156 ---YTPLKDKQL---IKDRGIQSYYFLPSINDNLDKAGNFLPSFL-IQDKLDIEFTKYNK 208

Query: 199 DVSVATNLPIPLANK-VYYFECKIFELCDRLGRPVSHLSENQIVSFGLATSPYPYFRLPG 257
             S   N P+P   K   YFE K+F+   +          N I + GL T PYPYFR+PG
Sbjct: 209 SSSAIMNFPLPYNRKDAVYFEVKVFKYPSK---------SNSIFTIGLITPPYPYFRMPG 259

Query: 258 RHHHSVAYDSNGARRLNNSFKLPQELSSLFPRCEKGDVIGIGYRTRSGTVFFTRNGKK-- 315
            + HS+AY+S G  R++N F      ++L P+ E+GDV+G GYR RSGT+F T NGKK  
Sbjct: 260 YNKHSIAYESTGKLRISNPFYA----NTLLPKLEEGDVVGFGYRFRSGTIFITHNGKKLL 315

Query: 316 --------------------------------------LNEKRIGGHIK---------GW 328
                                                 L+E+ +   +            
Sbjct: 316 DLTENIGVDLFIGLGAMNACYTKSYTLEGLLADPDNPGLHEQLVAAQLTPESDTTAAINP 375

Query: 329 KIKYLYPIVGANVPC---KIHVNFGTYGFVYIEANVKKWGYAKLNGMKLPPPAY--EDYD 383
           +++ ++     ++P    ++ VN G  GFV+IEANVKK+ +  + G    PP+Y  ++  
Sbjct: 376 QLERVHDYTTEDIPSDEIELQVNLGQLGFVFIEANVKKYVFGSVYGEIGIPPSYNGDEIK 435

Query: 384 RDVLLESSYE 393
           +D +L+   E
Sbjct: 436 QDTVLQKGEE 445

>KLLA0B12760g 1114942..1116570 some similarities with sp|P32343
           Saccharomyces cerevisiae YKL124w SSH4 suppressor of
           SHR3, hypothetical start
          Length = 542

 Score =  124 bits (311), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 79/231 (34%), Positives = 118/231 (51%), Gaps = 41/231 (17%)

Query: 97  DDELEVRH--KLAQLSPEEQFYYKQGEEFIKQNPPALMPYQTVAGGGSHGEPADVFDPVI 154
           D+ L+VR   +L ++S  E   Y++ +EF K +PP + P  +                 +
Sbjct: 111 DESLKVREAKELPKMSSFEVELYERTKEFQKMSPPMVKPLGSF----------------L 154

Query: 155 NDQTLRYIEEEGAQAWEFQPS--------PSLPPDFVKVENRTELTFMNSNSDVSVATNL 206
           N Q  + I++ G Q++ F PS         +  P F  VE++  ++F   N   S   N 
Sbjct: 155 NSQDKQVIKDRGIQSYFFLPSINDNVDINGAFLPSFF-VEDKLNVSFTKFNISSSAIMNY 213

Query: 207 PIPLANK-VYYFECKIFELCDRLGRPVSHLSENQIVSFGLATSPYPYFRLPGRHHHSVAY 265
           P+P+  K   YFE K+++              N I S GL T PYPYFR+PG   +S+AY
Sbjct: 214 PLPMNKKDAVYFEVKVYKF---------KTCSNSIFSIGLMTCPYPYFRIPGTAAYSIAY 264

Query: 266 DSNGARRLNNSFKLPQELSSLFPRCEKGDVIGIGYRTRSGTVFFTRNGKKL 316
           +S G  R+NN+F       +L P+ E+GDV+G GYR  SGT+F T NGKK+
Sbjct: 265 ESTGKLRINNAFG----ADTLLPKLEEGDVVGFGYRYSSGTIFITHNGKKM 311

 Score = 48.5 bits (114), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 34/53 (64%), Gaps = 2/53 (3%)

Query: 343 CKIHVNFGTYGFVYIEANVKKWGYAKLNGMKLPPPAY--EDYDRDVLLESSYE 393
            ++HVN G  GFV+IEANVKK+ +  + G    PPAY  +D  +D+LL+   E
Sbjct: 397 IELHVNLGQLGFVFIEANVKKYAFGSVYGDIGIPPAYNGDDIKQDMLLQKGDE 449

>YKL124W (SSH4) [3142] chr11 (210239..211978) Protein that confers
           resistance to immunosuppressive drug leflunomide upon
           overproduction [1740 bp, 579 aa]
          Length = 579

 Score =  122 bits (307), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 100/374 (26%), Positives = 161/374 (43%), Gaps = 92/374 (24%)

Query: 93  PTVLDDELEVRHK----LAQLSPEEQFYYKQGEEFIKQNPPALMPYQTVAGGGSHGEPAD 148
           P   DDE+ ++ +    L ++S  E   Y + +EF   +PP +  + T            
Sbjct: 113 PGGFDDEIVLQERELEELPKMSAYEVELYIRAKEFQMMSPPMVKDFGTY----------- 161

Query: 149 VFDPVINDQTLRYIEEEGAQAWEFQPS--------PSLPPDFVKVENRTELTFMNSNSDV 200
                ++    ++I++ G Q++   PS         +  P F+ V+++ ++ F   N   
Sbjct: 162 -----LDSDDQQFIKDRGIQSYFLLPSINDNIDEYGNFLPSFI-VQDKLDIQFSKFNKSS 215

Query: 201 SVATNLPIPLANK-VYYFECKIFELCDRLGRPVSHLSENQIVSFGLATSPYPYFRLPGRH 259
           S   N P+P   K   YFE KIF    +          N I S GL T PYPYFR+PG  
Sbjct: 216 STVMNYPLPHNRKDAVYFEVKIFRHIQK---------SNSIFSIGLTTVPYPYFRVPGMA 266

Query: 260 HHSVAYDSNGARRLNNSFKLPQELSSLFPRCEKGDVIGIGYRTRSGTVF----------- 308
            +S+AY+S G  R+NN F      S+L P+ E+GD +G GYR ++GT+F           
Sbjct: 267 KYSIAYESTGKLRINNPFTA----STLLPKLEEGDTVGFGYRYKTGTIFITHNGKKLMDV 322

Query: 309 ----------------------FTRNGKKLNEKRIG---GHIKGWKIKYLYPIVGANVP- 342
                                 +TR+G   +   +       +G  I+    +   + P 
Sbjct: 323 TQNIGIDLFIGIGAFNAAYTRTYTRDGLLEDPDNVSFREALSEGKDIEVAKDLQRVHDPH 382

Query: 343 ----------CKIHVNFGTYGFVYIEANVKKWGYAKLNGMKLPPPAYE--DYDRDVLLES 390
                      ++HVN G  GFV+IEANVKK+ +  + G    PPAY   +  +D +L+ 
Sbjct: 383 DESDEMTSDEVELHVNLGQVGFVFIEANVKKYAFGSVYGQIGIPPAYNGTEIKKDTILQK 442

Query: 391 SYEDEVSEGETNSF 404
             E      +T++F
Sbjct: 443 GEELPPRYADTDNF 456

>CAGL0M06545g 677238..679001 similar to sp|P32343 Saccharomyces
           cerevisiae YKL124w SSH4, hypothetical start
          Length = 587

 Score =  122 bits (307), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 107/365 (29%), Positives = 161/365 (44%), Gaps = 94/365 (25%)

Query: 93  PTVLDDELEV----RHKLAQLSPEEQFYYKQGEEFIKQNPPALMPYQTVAGGGSHGEPAD 148
           P   DD  E     R  L ++SP E   Y + +EF   +PPA+  + T            
Sbjct: 109 PGEFDDNEEFIEREREALIKMSPFEVDSYMRAKEFQIVSPPAVQEFGTY----------- 157

Query: 149 VFDPVINDQTLRYIEEEGAQAWEFQPSPS--------LPPDFVKVENRTELTFMNSNSDV 200
                ++ + L+ I++ G Q++ F PS +          P F+ V+++ E+ F   N   
Sbjct: 158 -----LDSKDLQMIKDRGIQSYYFIPSINDNVDKSGHFLPSFL-VQDKLEVEFTRWNKSS 211

Query: 201 SVATNLPIPLANK-VYYFECKIFELCDRLGRPVSHLSENQIVSFGLATSPYPYFRLPGRH 259
           S   N P+P   K   YFE K++       +P S    N I S GL T PYPYFR+PG  
Sbjct: 212 SAVLNYPLPYNKKDAVYFEVKVYN-----HKPNS----NSIFSIGLVTVPYPYFRIPGMC 262

Query: 260 HHSVAYDSNGARRLNNSFKLPQELSSLFPRCEKGDVIGIGYRTRSGTVF----------- 308
             S+AY+S G  R+N+ F  P   S+L P+  +GDV+G GYR ++GT+F           
Sbjct: 263 KFSIAYESTGKLRINDPF-FP---STLLPKLVEGDVVGFGYRFKTGTIFITHNGKKLMDV 318

Query: 309 ----------------------FTRNGKKLNEKRI---GGHIKGWKIKYLYPIVGANVP- 342
                                 +T++G   +   I       +G ++K    I   + P 
Sbjct: 319 TQNVSVELFIALGAMNASYTRTYTKDGLLEDPDNIELRNALAEGRELKLSKDIQNPHNPM 378

Query: 343 ------------CKIHVNFGTYGFVYIEANVKKWGYAKLNGMKLPPPAY--EDYDRDVLL 388
                        ++HVN G  GFV+IEANVKK+G+  + G    PPAY   D  +D L+
Sbjct: 379 DETKWDIIDSDEIELHVNLGQTGFVFIEANVKKYGFGSVFGEIGIPPAYNPNDIQKDKLI 438

Query: 389 ESSYE 393
           +   E
Sbjct: 439 QKGEE 443

>Scas_721.126
          Length = 573

 Score =  120 bits (301), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 82/237 (34%), Positives = 117/237 (49%), Gaps = 43/237 (18%)

Query: 93  PTVLDDELEVRHK----LAQLSPEEQFYYKQGEEFIKQNPPALMPYQTVAGGGSHGEPAD 148
           P   DDE E + +    L ++SP E   YK+  EF +  PP +                D
Sbjct: 112 PGQFDDECEHQEREHTELNRMSPFELELYKRSNEFQEVAPPHI----------------D 155

Query: 149 VFDPVINDQTLRYIEEEGAQAWEFQPS--------PSLPPDFVKVENRTELTFMNSNSDV 200
            F   +    L+ I++ G Q++   PS         +  P F+ ++++ ++ F   N   
Sbjct: 156 EFGTYLKATDLQVIKDRGIQSYFLLPSINDNVNKQGNFLPSFL-IQDKLDMVFTKYNKSS 214

Query: 201 SVATNLPIPLANK-VYYFECKIFELCDRLGRPVSHLSENQIVSFGLATSPYPYFRLPGRH 259
           S   N P+P   +   YFE K+F+      +PVS    N I S GL T PYPYFR+PG  
Sbjct: 215 STVMNYPLPYTKRDAVYFEVKVFK-----HQPVS----NTIFSIGLVTVPYPYFRIPGMA 265

Query: 260 HHSVAYDSNGARRLNNSFKLPQELSSLFPRCEKGDVIGIGYRTRSGTVFFTRNGKKL 316
             S+AY+S G  R+NN F      S+L P+  +GDV+G GYR  SGT+F T NGKKL
Sbjct: 266 KFSIAYESTGKLRINNPFM----ASTLLPKLVEGDVVGFGYRYSSGTIFITHNGKKL 318

>ABL026W [566] [Homologous to ScYKL124W (SSH4) - SH]
           complement(350985..352427) [1443 bp, 480 aa]
          Length = 480

 Score =  115 bits (287), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 109/209 (52%), Gaps = 37/209 (17%)

Query: 117 YKQGEEFIKQNPPALMPYQTVAGGGSHGEPADVFDPVINDQTLRYIEEEGAQAWEFQPS- 175
           Y + +EF   NPP +  +      G++  P D           + + + G QA+   PS 
Sbjct: 70  YLRAKEFQAMNPPLVKAF------GTYMCPED----------RQCVRDRGIQAYYLLPSI 113

Query: 176 -------PSLPPDFVKVENRTELTFMNSNSDVSVATNLPIPLANK-VYYFECKIFELCDR 227
                   +  P F+ V+++  +TF   N   S   N P+P   +   YFE K+++  + 
Sbjct: 114 NDNVDRRGNFLPSFL-VQDKLNVTFTKYNKSSSTIMNYPLPHNKRDAVYFEVKVYKFRN- 171

Query: 228 LGRPVSHLSENQIVSFGLATSPYPYFRLPGRHHHSVAYDSNGARRLNNSFKLPQELSSLF 287
                 +L+ N I S GL T PYPYF +PG   +S+AY+S G  R+NNSF      S+L 
Sbjct: 172 ------YLASNSIFSIGLVTCPYPYFVMPGMCQYSIAYESTGKLRINNSFY----ASTLL 221

Query: 288 PRCEKGDVIGIGYRTRSGTVFFTRNGKKL 316
           P+ ++GDV+G+GYR R+GTVF T NGKK+
Sbjct: 222 PKLQEGDVVGLGYRYRTGTVFITHNGKKM 250

>Kwal_26.7665
          Length = 551

 Score =  113 bits (282), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 85/296 (28%), Positives = 132/296 (44%), Gaps = 52/296 (17%)

Query: 43  LFTFSLVFMLLCYGMMVL-IYLGLRYVVRRCFTRRIALXXXXXXRANSGDV--------P 93
           L + S+ F +L   ++V+ +Y+         +   +A       R     V        P
Sbjct: 79  LISLSVTFAILMVMLIVIAVYVTFCGADESEYDEEVASAIPNMFRKKRSGVLLDGSFLTP 138

Query: 94  TVLDDELEVRHK----LAQLSPEEQFYYKQGEEFIKQNPPALMPYQTVAGGGSHGEPADV 149
              DDE  +  +    L ++S  E   Y++  EF K  PP +  + T             
Sbjct: 139 GQFDDEHALLEQEAVELPRMSRFEVELYQRCREFQKMCPPNVTEFGTYTSASDK------ 192

Query: 150 FDPVINDQTLRYIEEEGAQAWEFQPS--------PSLPPDFVKVENRTELTFMNSNSDVS 201
                     ++I++ G Q++ F PS         +  P F+ V+++ ++ F   N   S
Sbjct: 193 ----------QFIKDRGVQSYYFLPSINDNVDHYGNFLPSFI-VQDKLDVLFTKFNRSAS 241

Query: 202 VATNLPIPLANK-VYYFECKIFELCDRLGRPVSHLSENQIVSFGLATSPYPYFRLPGRHH 260
              N P+P   K   YFE K+F+   +          N I S GL T PYPYFR+PG   
Sbjct: 242 TIMNYPLPQNKKEAVYFEVKVFKFPAK---------SNSIFSCGLVTCPYPYFRIPGMAQ 292

Query: 261 HSVAYDSNGARRLNNSFKLPQELSSLFPRCEKGDVIGIGYRTRSGTVFFTRNGKKL 316
            S+AY+S G  R+NN F      ++L P+ ++GDVIG GYR ++GT+  T NGKKL
Sbjct: 293 FSIAYESTGKLRMNNPFY----ANTLLPKLQEGDVIGFGYRYKTGTILITHNGKKL 344

>AFR242C [3434] [Homologous to ScYGL227W (VID30) - SH]
           (873480..875951) [2472 bp, 823 aa]
          Length = 823

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 26/61 (42%), Gaps = 5/61 (8%)

Query: 292 KGDVIGIGYRTRSGTVFFTRNGKKLNEKRIGGHIKGWKIKYLYPIVGANVPCKIHVNFGT 351
           + DVIG G     GT+FFT+NG  L     G   K      L P V       I  NFG 
Sbjct: 404 RDDVIGCGINYVDGTIFFTKNGIHL-----GTAFKDVAHLDLVPYVSLKPANSIRTNFGL 458

Query: 352 Y 352
           Y
Sbjct: 459 Y 459

>CAGL0I04114g 360592..363324 similar to sp|P53076 Saccharomyces
           cerevisiae YGL227w VID30, start by similarity
          Length = 910

 Score = 33.5 bits (75), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 62/167 (37%), Gaps = 18/167 (10%)

Query: 292 KGDVIGIGYRTRSGTVFFTRNGKKLNEKRIGGHIKGWKIKYLYPIVGANVPCKIHVNFGT 351
           + DVIG G    +G+VFFT+NG  L     G  +         P +       +  NFG 
Sbjct: 504 RDDVIGCGINYVNGSVFFTKNGVFL-----GEAVSSLMNVNAIPYIALKSGNSVRTNFGL 558

Query: 352 Y-GFVY----IEANVKKWGYAKLNGMKLPPPAYEDYDRDVLLESSYE--DEVSEGETNSF 404
           Y  FV+     + N K+  Y  +    +    + D    ++ ES  E  D+  E + +  
Sbjct: 559 YEEFVFDINQYQKNWKRVAYKNIFKASITSHQFPDTKNTLIDESQMEIDDDADESQLSLL 618

Query: 405 VEXXXXXXXXXXXXXFEFSTTPTSNCDQFTLNTLPTEPPGYMSDVNA 451
            +                S       D   LNTL T+    +S++N 
Sbjct: 619 QKGLILGKDN------RISENMVLKPDDLLLNTLNTQDGSMISNLNV 659

>CAGL0F07007g 687174..688631 highly similar to sp|P53170
           Saccharomyces cerevisiae YGL059w, hypothetical start
          Length = 485

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 8/68 (11%)

Query: 218 ECKIFELCDRLGRPVSHLSENQIVSFG-----LATSPYPYFRLPGRHHHSV---AYDSNG 269
           E  +F +CDR G    H  +N I SFG      A S   + +LPG    S+    Y++  
Sbjct: 332 ESYLFRICDRAGGLAHHHDDNNIWSFGKTKEQAAQSISNFHKLPGLQTVSLYDHLYNNTE 391

Query: 270 ARRLNNSF 277
            R++N ++
Sbjct: 392 DRQVNRAY 399

>Kwal_47.19173
          Length = 836

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 16/25 (64%)

Query: 292 KGDVIGIGYRTRSGTVFFTRNGKKL 316
           + DVIG G     GT+FFT+NG  L
Sbjct: 441 RNDVIGCGVNYVDGTIFFTKNGLHL 465

>CAGL0J00693g complement(61246..66900) similar to sp|P08964
           Saccharomyces cerevisiae YHR023w MYO1, hypothetical
           start
          Length = 1884

 Score = 30.4 bits (67), Expect = 3.7,   Method: Composition-based stats.
 Identities = 29/126 (23%), Positives = 53/126 (42%), Gaps = 18/126 (14%)

Query: 176 PSLPPDFVKVENRTELTFMNSNSDVSVATNLPIPLANKVYYFECKIFELCDRLGRPVSHL 235
           P  P +F +V+N +ELT +N   + SV  NL     + + Y    +F +     + +S+L
Sbjct: 59  PVNPANFDRVDNMSELTHLN---EPSVLNNLENRYKDNLIYTYSGLFLVAINPYKEISNL 115

Query: 236 SENQIVS---------------FGLATSPYPYFRLPGRHHHSVAYDSNGARRLNNSFKLP 280
             N  +                F +A S Y   +   +    +    +GA +  N+ K+ 
Sbjct: 116 YSNSTIKSYHSSNEETSQKPHIFEVAESAYRDLKSKKQDQSILVTGESGAGKTENTKKIL 175

Query: 281 QELSSL 286
           Q L+S+
Sbjct: 176 QYLASI 181

>Scas_712.23
          Length = 973

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 39/94 (41%), Gaps = 10/94 (10%)

Query: 281 QELSSLFPRCEKGDVIGIGYRTRSGTVFFTRNGKKLNEKRIGGHIKGWKIKYLYPIVGAN 340
           ++ S +F R    D+IG G     GT+FFT+NG  L     G          + P +   
Sbjct: 574 KKYSQMFGR---DDIIGCGINYIDGTIFFTKNGVFL-----GTAFTNVYDLNVVPSIALK 625

Query: 341 VPCKIHVNFGTY-GFVYIEANVK-KWGYAKLNGM 372
               +  NFG Y  FV+   N +  W    LN +
Sbjct: 626 PGNSVRTNFGIYEEFVFDIGNYQNNWKNKSLNKI 659

>YDR439W (LRS4) [1260] chr4 (1339664..1340707) Protein involved in
           rDNA silencing [1044 bp, 347 aa]
          Length = 347

 Score = 29.6 bits (65), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 32/51 (62%), Gaps = 4/51 (7%)

Query: 88  NSGDVPTVLDDELEVRHKLAQLSPEEQFYYKQGEEF--IKQNPPALMPYQT 136
           N GD   V+D+ L ++ ++AQL+ + Q  +++ E+   +++N  AL  YQ+
Sbjct: 41  NKGDPKKVVDETLFLQRQIAQLNKQLQLSFQENEKLLSVQKNQKAL--YQS 89

>YGL227W (VID30) [1771] chr7 (69670..72546) Protein that regulates
           expression of genes that are involved in nitrogen
           metabolism [2877 bp, 958 aa]
          Length = 958

 Score = 29.6 bits (65), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 3/44 (6%)

Query: 273 LNNSFKLPQELSSLFPRCEKGDVIGIGYRTRSGTVFFTRNGKKL 316
           + NS +  +E +  F R    DVIG G     G++FFT+NG  L
Sbjct: 519 ITNSTEQSKEYAKPFGR---DDVIGCGINFIDGSIFFTKNGIHL 559

>KLLA0E17633g complement(1562195..1565467) some similarities with
           sp|P40317 Saccharomyces cerevisiae YDR006c SOK1 high
           copy suppressor of a cyclic AMP-dependent protein kinase
           mutant singleton, hypothetical start
          Length = 1090

 Score = 29.6 bits (65), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 26/53 (49%)

Query: 230 RPVSHLSENQIVSFGLATSPYPYFRLPGRHHHSVAYDSNGARRLNNSFKLPQE 282
           RP  H +++ IV+ GL T+     R+ G H H   Y  +  +  N+ F  P +
Sbjct: 104 RPRDHSNDSGIVAMGLNTNSDCSHRIVGHHSHLDDYVQDARQMGNHGFVTPSQ 156

>Scas_688.22
          Length = 1876

 Score = 29.3 bits (64), Expect = 8.8,   Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 4/50 (8%)

Query: 158 TLRYIEE-EGAQAWEFQPSPSLPPDFVKVENRTELTFMNSNSDVSVATNL 206
           T+R +E  E  Q  +   SPS P  F KV+N +ELT +N   + SV  NL
Sbjct: 41  TVRIMETGEELQIEKSNLSPSNPTSFDKVDNMSELTHLN---EASVLHNL 87

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.138    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,448,574
Number of extensions: 736311
Number of successful extensions: 1659
Number of sequences better than 10.0: 24
Number of HSP's gapped: 1638
Number of HSP's successfully gapped: 31
Length of query: 484
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 378
Effective length of database: 12,926,601
Effective search space: 4886255178
Effective search space used: 4886255178
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 63 (28.9 bits)