Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL208W50249326140.0
Sklu_2251.1047949915220.0
Kwal_27.1150047549713161e-179
Scas_671.1248650312411e-168
CAGL0D04202g49950312221e-164
YIL090W49150012141e-163
KLLA0E08173g48649411811e-158
Scas_568.31001132711.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL208W
         (493 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL208W [1533] [Homologous to ScYIL090W - SH] complement(337120....  1011   0.0  
Sklu_2251.10 YIL090W, Contig c2251 10810-12249 reverse complement     590   0.0  
Kwal_27.11500                                                         511   e-179
Scas_671.12                                                           482   e-168
CAGL0D04202g 414049..415548 similar to sp|P40499 Saccharomyces c...   475   e-164
YIL090W (YIL090W) [2585] chr9 (193592..195067) Protein of unknow...   472   e-163
KLLA0E08173g complement(740213..741673) similar to sp|P40499 Sac...   459   e-158
Scas_568.3                                                             32   1.3  

>ADL208W [1533] [Homologous to ScYIL090W - SH]
           complement(337120..338628) [1509 bp, 502 aa]
          Length = 502

 Score = 1011 bits (2614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/493 (100%), Positives = 493/493 (100%)

Query: 1   MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAA 60
           MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAA
Sbjct: 1   MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAA 60

Query: 61  TRGDEWKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNMN 120
           TRGDEWKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNMN
Sbjct: 61  TRGDEWKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNMN 120

Query: 121 ESLLQLLGRSRDDRATMAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGETG 180
           ESLLQLLGRSRDDRATMAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGETG
Sbjct: 121 ESLLQLLGRSRDDRATMAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGETG 180

Query: 181 RWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVFGL 240
           RWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVFGL
Sbjct: 181 RWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVFGL 240

Query: 241 GLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLPKNS 300
           GLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLPKNS
Sbjct: 241 GLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLPKNS 300

Query: 301 LLAYYKNFILNAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKSQQLWS 360
           LLAYYKNFILNAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKSQQLWS
Sbjct: 301 LLAYYKNFILNAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKSQQLWS 360

Query: 361 FTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQRATGGT 420
           FTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQRATGGT
Sbjct: 361 FTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQRATGGT 420

Query: 421 QSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCFPWLQSEANRDRWVVDAWG 480
           QSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCFPWLQSEANRDRWVVDAWG
Sbjct: 421 QSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCFPWLQSEANRDRWVVDAWG 480

Query: 481 FWNWCNLFFTLLI 493
           FWNWCNLFFTLLI
Sbjct: 481 FWNWCNLFFTLLI 493

>Sklu_2251.10 YIL090W, Contig c2251 10810-12249 reverse complement
          Length = 479

 Score =  590 bits (1522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/499 (58%), Positives = 369/499 (73%), Gaps = 37/499 (7%)

Query: 1   MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAA 60
           M+P+ L++S+R  L +FYL LVLIT+PISFQ+GGLYCGLSFTVTLF LYF+TTTLKI + 
Sbjct: 1   MLPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSFTVTLFNLYFLTTTLKIVSK 60

Query: 61  TRGDEWKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNMN 120
                +  I S +YYLQHF++PS+LFLFLSGFNND+L++++              DG++N
Sbjct: 61  KYNRLYYSITSFVYYLQHFIIPSLLFLFLSGFNNDELKRQI--------------DGDVN 106

Query: 121 ---ESLLQLLGRSRDDRATMAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIG 177
              ESL+  L       + + Y +YY++ V+PWQ++LLH+TP FTL EGFFTVL IQ IG
Sbjct: 107 LPRESLVNFLRNKSGKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIG 166

Query: 178 ETGRWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLV 237
           ET +WLRY +NS  W+I SL++SG VITTS+YYLYRIYVTP+W LS+ TA+LLGFTLS+V
Sbjct: 167 ETNKWLRYHKNSNTWIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIV 226

Query: 238 FGLGLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLP 297
            GLGLYGI+SGKGS IESSLFFAY+V CIYEISPQLA +AM EIF++V +TWQ  QG LP
Sbjct: 227 CGLGLYGIVSGKGSVIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNLP 286

Query: 298 KNSLLAYYKNFIL-NAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKSQ 356
            ++LL+YY+N +L N E +WD +++K           +PS+           Q  W + Q
Sbjct: 287 TDNLLSYYRNVVLKNGEMIWDAIVQKTG-------TTSPSTT----------QMVWLRLQ 329

Query: 357 QLWSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQR- 415
            LW FTKNF+  +P SI EIF VTL +A ES+   VV NLVFR++VFYSATRIIPALQ+ 
Sbjct: 330 PLWKFTKNFTISVPSSIREIFRVTLKMATESVTPTVVINLVFRILVFYSATRIIPALQKD 389

Query: 416 -ATGGTQSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCFPWLQSEANRDRW 474
              G   SR+LMR+IYWYSPCIVIAMYTH+IL+YSGELNN+LC+WGCFPW  +     + 
Sbjct: 390 NPNGRKSSRRLMRLIYWYSPCIVIAMYTHLILQYSGELNNDLCLWGCFPWSHTNDPSSKV 449

Query: 475 VVDAWGFWNWCNLFFTLLI 493
           VVDAWGFWNWCN+F TL I
Sbjct: 450 VVDAWGFWNWCNVFCTLAI 468

>Kwal_27.11500
          Length = 475

 Score =  511 bits (1316), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 274/497 (55%), Positives = 356/497 (71%), Gaps = 37/497 (7%)

Query: 1   MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAA 60
           M+P+ +L+S+R  L SFYL L+LIT+PI+FQ+GGLYCGLSFTVTLF LY +TTTLKI A 
Sbjct: 1   MIPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60

Query: 61  TRGDEWKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNM- 119
            RG  +  +AS  YY QHF +PS+LFLFLSGF+ND+L+ ++              D N  
Sbjct: 61  ARG--FAKLASAAYYAQHFFIPSLLFLFLSGFSNDELKHQI--------------DTNTR 104

Query: 120 -NESLLQLLGRSRDDRATMAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGE 178
            +ESL+ LL  S   +  + Y +YY YVVRPWQ++LL +TP FTL EGFFTVL IQ +GE
Sbjct: 105 PDESLIDLLRSSTHSQPWIFYYYYYHYVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGE 164

Query: 179 TGRWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVF 238
           T RWL     S  WVIS LM SG VIT ++YYLYRIYVTPIW LSV TA+LLGFT S+V 
Sbjct: 165 TNRWLSRGHGSNVWVISGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVS 224

Query: 239 GLGLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTL-P 297
           GLG++GI+SG+GS IESSLFFAY+V C+YEISPQLA +AM EI  +V +TW  Q  +L  
Sbjct: 225 GLGIFGIVSGRGSTIESSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRS 284

Query: 298 KNSLLAYYKNFIL-NAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKSQ 356
            ++ LAYY++ IL N E +WD +L +     +V +  A     +           W++ Q
Sbjct: 285 SDTFLAYYRDIILKNGEMIWDAVLART----NVNVSGAGPVAWIS----------WHRVQ 330

Query: 357 QLWSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQRA 416
            LW F K+F++ +P SI EIF++TL +ARE+I  AVV NL FR+++FYSATRIIPALQR 
Sbjct: 331 PLWKFVKHFTSSVPSSIQEIFLLTLSMAREAIAPAVVINLCFRILIFYSATRIIPALQRK 390

Query: 417 TGGTQSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCFPWLQSEANRDRWVV 476
               +SR+ MR++YWYSPCIVIAMYTH+I++YSG+++N+LC+WGCFPW   E ++   VV
Sbjct: 391 H-KRRSRRFMRMLYWYSPCIVIAMYTHLIMQYSGQISNDLCLWGCFPWSPPEGSKV--VV 447

Query: 477 DAWGFWNWCNLFFTLLI 493
           D+WGFWNWCN+F T+ I
Sbjct: 448 DSWGFWNWCNIFCTMAI 464

>Scas_671.12
          Length = 486

 Score =  482 bits (1241), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 256/503 (50%), Positives = 339/503 (67%), Gaps = 41/503 (8%)

Query: 1   MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAA 60
           M+    +R +R   A+FYL   LI++PISF+IGGL+CGL+FTV+LFILYF++TTL I A 
Sbjct: 1   MISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWAR 60

Query: 61  TRGDEWKHIAST--LYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGN 118
             G    HI  T  LYY QHF++ S+L+LFLSGF+N+QL   L   +        IF  N
Sbjct: 61  KYGSR-IHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKN 119

Query: 119 MNESLLQLLGRSRDDRATMAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGE 178
           +  S              + Y +YYR+ V+PWQ++L ++TP FTL+EGFFT+LAIQ IGE
Sbjct: 120 VASS---------TQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGE 170

Query: 179 TGRWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVF 238
           T +WL Y+ NS  WVISSL+ SG VIT S+YYLYRIYVTPIW LSV TA+LLGFTLSLV 
Sbjct: 171 TNKWLVYEINSNTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVG 230

Query: 239 GLGLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLPK 298
           GLG+YGI++ KGS IESS+FFAY+V CIYEISP+LA TA  EI +V    WQ  Q  L  
Sbjct: 231 GLGIYGIVTDKGSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTS 290

Query: 299 -NSLLAYYKNFIL-NAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKSQ 356
            N+LL+YY N +L N E +W+     +F ++      + S+  V    +           
Sbjct: 291 PNNLLSYYHNVVLKNIETIWE-----SFKINDNSFITSFSTERVITIFM----------- 334

Query: 357 QLWSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQRA 416
            +W   K F+  +P SI+E+  VT  +A ESI+ AV+ NL FRV++FYSATRIIPALQR 
Sbjct: 335 PIWKLLKTFTITVPSSINELCFVTYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRR 394

Query: 417 TGGT--QSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGC----FPWLQSEAN 470
                 +SR++M+++YWYSPCI+IAMY H+IL+YSGEL +ELC+WGC    FP     ++
Sbjct: 395 DDNELRKSRRIMKVLYWYSPCILIAMYAHLILQYSGELKDELCLWGCNSKIFP-----SD 449

Query: 471 RDRWVVDAWGFWNWCNLFFTLLI 493
           + + +VD+WGFWNWCN+FFT+L+
Sbjct: 450 QPKIIVDSWGFWNWCNIFFTILV 472

>CAGL0D04202g 414049..415548 similar to sp|P40499 Saccharomyces
           cerevisiae YIL090w, start by similarity
          Length = 499

 Score =  475 bits (1222), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 246/503 (48%), Positives = 351/503 (69%), Gaps = 31/503 (6%)

Query: 1   MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAA 60
           ++ +G+ RS+R + A+ YL L L+++PISF+IGGL CGLSFTVTLF LY ++TTL + A 
Sbjct: 3   LITEGVQRSIRISSAALYLVLTLVSIPISFKIGGLQCGLSFTVTLFNLYLISTTLSVLAR 62

Query: 61  TRGDE-WKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNM 119
              +  +    S LYY QH ++  +LFLFLSGF+N++  + L    P G+      DG+ 
Sbjct: 63  RSCNRGYVFATSILYYSQHLVIAPLLFLFLSGFSNEEFNRFL---SPVGSYQELDPDGSF 119

Query: 120 NESL---LQLLGRSRDDRATMAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVI 176
            + L   + +   + + +    Y +Y++++V+PWQ++L ++TP FTL EGFFT+LAIQ I
Sbjct: 120 LDLLKHRILMATTAENSKNWTLYYYYFKFIVQPWQWLLSYSTPFFTLLEGFFTILAIQAI 179

Query: 177 GETGRWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSL 236
           GET +WL Y+ NS  W+I+SL+VSG VIT S+YYLYRIYVTPIW L++ +A+LLGF LS+
Sbjct: 180 GETNKWLSYEMNSNTWIITSLLVSGGVITGSLYYLYRIYVTPIWKLTIQSASLLGFVLSI 239

Query: 237 VFGLGLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQM-QQGT 295
           VF LGLYGIIS KGS IESSLFFAY+V CIYEISP+LA  A  EI  +V + WQ  Q+  
Sbjct: 240 VFCLGLYGIISRKGSVIESSLFFAYIVRCIYEISPKLATRATEEILDLVKDVWQTHQRNL 299

Query: 296 LPKNSLLAYYKNFIL-NAENLWD-VLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWN 353
           L +++LLAYY N +L NAE +W+  +L ++  L+++E                 + ++W 
Sbjct: 300 LNRDNLLAYYHNVVLKNAEMVWESFILPRSRSLNAME-----------------KIRFWL 342

Query: 354 KSQQLWSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPAL 413
               +W F KNF+  +P SI E+  VT  +A ES++ AV+ NL FR+++FYSATRIIPAL
Sbjct: 343 DVTPVWKFFKNFTVSVPSSIVELVSVTYKMASESLSPAVIVNLCFRILIFYSATRIIPAL 402

Query: 414 QRAT--GGTQSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCFP-WLQSEAN 470
           QR++     QSR++++++YWYSPC++IAMYTH+IL+YSGEL  ELC+WGC   W  S+ +
Sbjct: 403 QRSSYKEQRQSRRILKLLYWYSPCVLIAMYTHLILQYSGELKRELCLWGCTSNWFGSK-D 461

Query: 471 RDRWVVDAWGFWNWCNLFFTLLI 493
           + R V D+W FWNWCN+F+T+L+
Sbjct: 462 QPRIVTDSWSFWNWCNIFWTVLV 484

>YIL090W (YIL090W) [2585] chr9 (193592..195067) Protein of unknown
           function, has low similarity to uncharacterized C.
           albicans Orf6.4010p [1476 bp, 491 aa]
          Length = 491

 Score =  472 bits (1214), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 254/500 (50%), Positives = 334/500 (66%), Gaps = 30/500 (6%)

Query: 2   VPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAAT 61
           + K  ++S R   A FYL   L+++PISF++GGL CGLSFTVTLF LYF+TTTL + A  
Sbjct: 4   LSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLARR 63

Query: 62  RGDE-WKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNMN 120
            G   +    + LYY QHF++ S+L+LFLSGF+ND+L   L                N +
Sbjct: 64  HGGRLYIFFTNCLYYSQHFIIASLLYLFLSGFSNDELGNVLKN------------KYNES 111

Query: 121 ESLLQLLGRSRDDRATMAYLHYY--RYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGE 178
           ES L+ L  S +       L+YY  R+VV+PWQ++L  +TP FTL+EGFFT+LAIQ +GE
Sbjct: 112 ESFLEALKNSLNSNQINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGE 171

Query: 179 TGRWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVF 238
           T RWL    NS  W+ISSL+ SG VIT S+YYLYRIYVTPIWPLS+ TA+LLG  LS+V 
Sbjct: 172 TNRWLSNDLNSNTWIISSLLTSGGVITASLYYLYRIYVTPIWPLSIQTASLLGLVLSMVC 231

Query: 239 GLGLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLP- 297
           GLGLYGI+S KGS IESSLFFAY+V CIYEISP+LA TA  EI  +  + WQ  Q  LP 
Sbjct: 232 GLGLYGIVSQKGSVIESSLFFAYIVRCIYEISPKLATTATDEILNLFKDVWQKHQRNLPT 291

Query: 298 KNSLLAYYKNFIL-NAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKSQ 356
            ++LL Y+ N IL NAE LW   + +     + +      S++  + + L+       S+
Sbjct: 292 ADNLLCYFHNVILKNAEVLWGSFIPRG-RKKTGDFHDKLISILSFEKVSLI-------SK 343

Query: 357 QLWSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQRA 416
             W F KNF+  +P SI+E   VT+ +A ES++ A+V NL FRV++FYSATRIIPALQR 
Sbjct: 344 PFWKFFKNFTFSVPLSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRK 403

Query: 417 TGGT--QSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCF-PWLQSEANRDR 473
                 +SR++M+ +YWYSPCI+IAMYTH+IL+YSGEL  +LCIWGC   W     ++  
Sbjct: 404 NDKQLRKSRRIMKGLYWYSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFG--VDQPE 461

Query: 474 WVVDAWGFWNWCNLFFTLLI 493
            +VD+WGFWNWCN+F T+L+
Sbjct: 462 IIVDSWGFWNWCNIFCTILV 481

>KLLA0E08173g complement(740213..741673) similar to sp|P40499
           Saccharomyces cerevisiae YIL090w singleton, start by
           similarity
          Length = 486

 Score =  459 bits (1181), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 243/494 (49%), Positives = 323/494 (65%), Gaps = 60/494 (12%)

Query: 1   MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAA 60
           ++ K +L++LR  L + YLFLVLIT+PISFQ+GGL CGLSFTVTLF LYFV+TT K+   
Sbjct: 42  LIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLL 101

Query: 61  TRGDEWKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNMN 120
            RG     +++ +YYLQH L+PSILF+FLS F N       + SD   +    +F     
Sbjct: 102 DRGSA---LSTLIYYLQHLLIPSILFMFLSYFEN-------IDSDTVDSEYFKVF----- 146

Query: 121 ESLLQLLGRSRDDRATMAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGETG 180
                                 +  +V+PWQ  L+H+TP FTL EG FT+LAIQ IGET 
Sbjct: 147 ----------------------WNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETE 184

Query: 181 RWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVFGL 240
           RWL+  R S  WVI SL++SG +IT S++Y YRIYVTP+W LS  +A+LLGFT S+V G+
Sbjct: 185 RWLKMSRRSNQWVILSLLISGGIITLSLFYFYRIYVTPMWELSTPSASLLGFTFSIVCGI 244

Query: 241 GLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLPKNS 300
           GLYG I+G GS +ESSLFFAYMV  +YEISP++A+ AM EIF +V  TW++ Q  LPK  
Sbjct: 245 GLYG-INGSGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKK- 302

Query: 301 LLAYYKNFILNAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKSQQLWS 360
                       +NL +++ K    + S  ++  P +   K   ++ Q +W      LW+
Sbjct: 303 ------------DNLLELMTKNYRAIWSQIVEHTPRN--HKYIKMMDQCKW--ILNPLWN 346

Query: 361 FTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQRATGGT 420
             KNF+  +P SI EIF+VT  +A+ES+  AVV NLVFR+++FYSATRIIP LQR T   
Sbjct: 347 SVKNFTKSVPISIQEIFVVTFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQRNTKER 406

Query: 421 QS-RKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCFPWLQSEANRDRWVVDAW 479
           +S R++M  +YWYSPCI+IAMYTH+ILRYSG+L N+LCIWGCFP+        + VVD+W
Sbjct: 407 RSFRRIMNFVYWYSPCIIIAMYTHLILRYSGQLKNDLCIWGCFPY----ETEPKIVVDSW 462

Query: 480 GFWNWCNLFFTLLI 493
            FWNWCN++ T+LI
Sbjct: 463 SFWNWCNIYSTMLI 476

>Scas_568.3
          Length = 1001

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 50/132 (37%), Gaps = 25/132 (18%)

Query: 98  QKKLVGSDPKGARGGFIFDGNMN----ESL--LQLLGRSRDDRATMAYLHYYRYVVRPWQ 151
            K L   D  G  G ++ D        E L  L +L RS+       Y H Y Y  R  +
Sbjct: 410 HKLLTDPDAPGNTGRYVLDPKTTLIIIEKLKELNMLFRSK------KYTHSYPYDWRSKK 463

Query: 152 YMLLHATPCFTLTEGFFTVLAIQVIGE---------TGRWLRYKRNSTAWVISSLMVSGV 202
            +++ ATP + L       LA++ + +           R L + +N   W IS     GV
Sbjct: 464 PVIIRATPQWFLNLAKMKQLAVESLNDKVNFFPERGKTRLLSFIKNRNEWCISRQRAWGV 523

Query: 203 VITTSMYYLYRI 214
            I       YRI
Sbjct: 524 PIPA----FYRI 531

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.328    0.140    0.447 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,960,130
Number of extensions: 610140
Number of successful extensions: 1920
Number of sequences better than 10.0: 16
Number of HSP's gapped: 1934
Number of HSP's successfully gapped: 17
Length of query: 493
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 387
Effective length of database: 12,926,601
Effective search space: 5002594587
Effective search space used: 5002594587
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 64 (29.3 bits)