Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL206W37236516820.0
Sklu_2251.835931210451e-142
Kwal_27.114893573189711e-131
KLLA0E08129g3693659161e-122
YHL003C (LAG1)4112692748e-27
CAGL0K02739g4312462616e-25
Kwal_26.78864222632608e-25
CAGL0M10219g3972922545e-24
Scas_668.204252762521e-23
YKL008C (LAC1)4182812511e-23
Scas_717.234302762441e-22
Sklu_2243.44092702281e-20
ABR009W4132692211e-19
KLLA0B13497g4081702061e-17
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL206W
         (365 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL206W [1535] [Homologous to ScYHL003C (LAG1) - NSH] complement...   652   0.0  
Sklu_2251.8 , Contig c2251 7738-8817 reverse complement               407   e-142
Kwal_27.11489                                                         378   e-131
KLLA0E08129g complement(736008..737117) weakly similar to sp|P28...   357   e-122
YHL003C (LAG1) [2282] chr8 complement(100643..101878) Protein re...   110   8e-27
CAGL0K02739g complement(246652..247947) highly similar to sp|P38...   105   6e-25
Kwal_26.7886                                                          104   8e-25
CAGL0M10219g complement(1020895..1022088) similar to sp|P28496 S...   102   5e-24
Scas_668.20                                                           101   1e-23
YKL008C (LAC1) [3248] chr11 complement(426938..428194) Protein r...   101   1e-23
Scas_717.23                                                            99   1e-22
Sklu_2243.4 YHL003C, Contig c2243 7329-8558                            92   1e-20
ABR009W [600] [Homologous to ScYHL003C (LAG1) - SH; ScYKL008C (L...    90   1e-19
KLLA0B13497g 1181036..1182262 similar to sp|P28496 Saccharomyces...    84   1e-17

>ADL206W [1535] [Homologous to ScYHL003C (LAG1) - NSH]
           complement(340558..341676) [1119 bp, 372 aa]
          Length = 372

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/365 (87%), Positives = 321/365 (87%)

Query: 1   MSGQVRQRFAKDQHAGSQIEVEYGSKDAAFEADKSVXXXXXXXXXPIRGQLAVSKVDLYT 60
           MSGQVRQRFAKDQHAGSQIEVEYGSKDAAFEADKSV         PIRGQLAVSKVDLYT
Sbjct: 1   MSGQVRQRFAKDQHAGSQIEVEYGSKDAAFEADKSVELEEREELLPIRGQLAVSKVDLYT 60

Query: 61  VYASXXXXXXXXXXFLRQAAWCDKFLRLQYASVESPGKYDIGIDDAYIVGTFXXXXXXXX 120
           VYAS          FLRQAAWCDKFLRLQYASVESPGKYDIGIDDAYIVGTF        
Sbjct: 61  VYASGALLVALAVGFLRQAAWCDKFLRLQYASVESPGKYDIGIDDAYIVGTFVVVLCLVR 120

Query: 121 XXXXEFVLKPLAHYKFRISSGKIQQRYGEQSWSMLYYTASWVTGFYLYYHSPYFLNCDHI 180
               EFVLKPLAHYKFRISSGKIQQRYGEQSWSMLYYTASWVTGFYLYYHSPYFLNCDHI
Sbjct: 121 SSLLEFVLKPLAHYKFRISSGKIQQRYGEQSWSMLYYTASWVTGFYLYYHSPYFLNCDHI 180

Query: 181 YLNWPHDKMAGVFKVYYLVQIASWLQQIIVLNVEEKRKDYWQMFAHHIITVALTTGSYYY 240
           YLNWPHDKMAGVFKVYYLVQIASWLQQIIVLNVEEKRKDYWQMFAHHIITVALTTGSYYY
Sbjct: 181 YLNWPHDKMAGVFKVYYLVQIASWLQQIIVLNVEEKRKDYWQMFAHHIITVALTTGSYYY 240

Query: 241 YFNRIGHXXXXXXXXXXXXXSSAKILKYCGFSVACDYMFVVFLGFWVVLRHGVYNYILHH 300
           YFNRIGH             SSAKILKYCGFSVACDYMFVVFLGFWVVLRHGVYNYILHH
Sbjct: 241 YFNRIGHVILIIMDVVDILLSSAKILKYCGFSVACDYMFVVFLGFWVVLRHGVYNYILHH 300

Query: 301 AWAKSRGLMQNQRCGVHAPGTRCWTPLVIDIFVLLLAGLQLITVIWSFLIVKVFMKVIRG 360
           AWAKSRGLMQNQRCGVHAPGTRCWTPLVIDIFVLLLAGLQLITVIWSFLIVKVFMKVIRG
Sbjct: 301 AWAKSRGLMQNQRCGVHAPGTRCWTPLVIDIFVLLLAGLQLITVIWSFLIVKVFMKVIRG 360

Query: 361 SGAED 365
           SGAED
Sbjct: 361 SGAED 365

>Sklu_2251.8 , Contig c2251 7738-8817 reverse complement
          Length = 359

 Score =  407 bits (1045), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 195/312 (62%), Positives = 226/312 (72%)

Query: 54  SKVDLYTVYASXXXXXXXXXXFLRQAAWCDKFLRLQYASVESPGKYDIGIDDAYIVGTFX 113
           SKVD Y+V  S             +  +  KF  LQY    +PG+YDIGIDD Y+V TF 
Sbjct: 39  SKVDQYSVALSILMLSFLYLLHCFKPQYSYKFTHLQYQYASAPGRYDIGIDDTYMVMTFI 98

Query: 114 XXXXXXXXXXXEFVLKPLAHYKFRISSGKIQQRYGEQSWSMLYYTASWVTGFYLYYHSPY 173
                      E+VLKP+A YKF+I S K QQRY EQ WS+ YY+ SW  GFYLYY+SPY
Sbjct: 99  VALVLVRSFLLEYVLKPIAFYKFKIHSNKSQQRYAEQGWSLAYYSFSWCFGFYLYYNSPY 158

Query: 174 FLNCDHIYLNWPHDKMAGVFKVYYLVQIASWLQQIIVLNVEEKRKDYWQMFAHHIITVAL 233
           FLNCDHIYL WPHDK++G FKVYYL+QIASWLQQIIVLNVEE+RKD+WQMFAHHIIT  L
Sbjct: 159 FLNCDHIYLGWPHDKLSGTFKVYYLLQIASWLQQIIVLNVEERRKDHWQMFAHHIITCLL 218

Query: 234 TTGSYYYYFNRIGHXXXXXXXXXXXXXSSAKILKYCGFSVACDYMFVVFLGFWVVLRHGV 293
           TTGSYYYYF RIGH             SSAK+LKYCGFS ACDYMFV+FL FWV LRHG+
Sbjct: 219 TTGSYYYYFTRIGHVILILMDIVDVLLSSAKMLKYCGFSTACDYMFVIFLVFWVALRHGI 278

Query: 294 YNYILHHAWAKSRGLMQNQRCGVHAPGTRCWTPLVIDIFVLLLAGLQLITVIWSFLIVKV 353
           YNY+ +HAWAK+R LM   RCG+     RCWTP VID+F+ LL GLQ+IT+IW FLIVKV
Sbjct: 279 YNYVFYHAWAKARDLMAMGRCGLTPDQKRCWTPFVIDVFLGLLGGLQVITIIWMFLIVKV 338

Query: 354 FMKVIRGSGAED 365
            +KVI+G+GAED
Sbjct: 339 LIKVIKGAGAED 350

>Kwal_27.11489
          Length = 357

 Score =  378 bits (971), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 184/318 (57%), Positives = 219/318 (68%)

Query: 48  RGQLAVSKVDLYTVYASXXXXXXXXXXFLRQAAWCDKFLRLQYASVESPGKYDIGIDDAY 107
           R +   S+VD Y+   S             +     KF  LQY  V++P  YDIGIDDAY
Sbjct: 31  RQKKVASRVDQYSCLLSAAFLAILYLVGQVKPELTHKFTTLQYQYVDAPDAYDIGIDDAY 90

Query: 108 IVGTFXXXXXXXXXXXXEFVLKPLAHYKFRISSGKIQQRYGEQSWSMLYYTASWVTGFYL 167
           IV T             E+VLKP+A +KF I S K QQRY EQ WS++YYT SWV GFYL
Sbjct: 91  IVVTCIVALVLVRSFLLEYVLKPIALHKFHIRSHKSQQRYAEQGWSLVYYTFSWVLGFYL 150

Query: 168 YYHSPYFLNCDHIYLNWPHDKMAGVFKVYYLVQIASWLQQIIVLNVEEKRKDYWQMFAHH 227
           YY+SPYFLNCDHIYL WPHD+ +  FK+YYL+QIASWLQQI+VLNVEE+RKDYWQMFAHH
Sbjct: 151 YYNSPYFLNCDHIYLGWPHDRFSATFKIYYLLQIASWLQQIVVLNVEERRKDYWQMFAHH 210

Query: 228 IITVALTTGSYYYYFNRIGHXXXXXXXXXXXXXSSAKILKYCGFSVACDYMFVVFLGFWV 287
           IIT  LT GSYYYYFNRIGH             SSAK+LKYCGF+ ACDYMF VFL FWV
Sbjct: 211 IITCLLTLGSYYYYFNRIGHLILIMMDIVDVFLSSAKMLKYCGFTTACDYMFAVFLVFWV 270

Query: 288 VLRHGVYNYILHHAWAKSRGLMQNQRCGVHAPGTRCWTPLVIDIFVLLLAGLQLITVIWS 347
           +LRH  YNYI +HA  K+ GLM + +C   A   RCWTPL+ID+F+ LL GLQ+IT+IW 
Sbjct: 271 LLRHIAYNYIFYHAGTKAPGLMSHGQCMASAVQKRCWTPLIIDVFLWLLGGLQVITIIWM 330

Query: 348 FLIVKVFMKVIRGSGAED 365
            LI+KV +K+++G  AED
Sbjct: 331 ALIIKVLIKILKGGSAED 348

>KLLA0E08129g complement(736008..737117) weakly similar to sp|P28496
           Saccharomyces cerevisiae YKL008c LAC1 protein required
           with LAG1P for ER-to-Golgi transport of GPI-anchored
           proteins P2.313.f2.1, hypothetical start
          Length = 369

 Score =  357 bits (916), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 184/365 (50%), Positives = 229/365 (62%), Gaps = 7/365 (1%)

Query: 1   MSGQVRQRFAKDQHAGSQIEVEYGSKDAAFEADKSVXXXXXXXXXPIRGQLAVSKVDLYT 60
           MS ++RQR +    A S  E  +  K  A    ++                 VSKVD Y+
Sbjct: 1   MSSELRQRHSSGSAAPSLTEHRFDEKKQARSRSRTGSSSKHHFK-------PVSKVDRYS 53

Query: 61  VYASXXXXXXXXXXFLRQAAWCDKFLRLQYASVESPGKYDIGIDDAYIVGTFXXXXXXXX 120
           V  S                +  KF+ LQY   ++PGKYDIGIDD Y++ TF        
Sbjct: 54  VLLSSILLSLLFVGNSFYPEYTKKFVNLQYEYPDNPGKYDIGIDDGYVILTFIVVFCLVR 113

Query: 121 XXXXEFVLKPLAHYKFRISSGKIQQRYGEQSWSMLYYTASWVTGFYLYYHSPYFLNCDHI 180
               EFVLKP+   +F + S K  QR+GEQ WSM+YY  SW+ GFYLYYHSPY+ N DHI
Sbjct: 114 SFLLEFVLKPVGRNRFHMRSVKSLQRFGEQGWSMIYYLFSWIFGFYLYYHSPYYFNIDHI 173

Query: 181 YLNWPHDKMAGVFKVYYLVQIASWLQQIIVLNVEEKRKDYWQMFAHHIITVALTTGSYYY 240
           Y  WPHD+++G+FK YYL QIASW  QIIVLNVEE+RKD+WQMFAHHIITVALTTGSYYY
Sbjct: 174 YSGWPHDQLSGLFKTYYLFQIASWFHQIIVLNVEERRKDFWQMFAHHIITVALTTGSYYY 233

Query: 241 YFNRIGHXXXXXXXXXXXXXSSAKILKYCGFSVACDYMFVVFLGFWVVLRHGVYNYILHH 300
           YF RIG+             S AK+LKYCG+S  CDYMFVVFL +WV+LRH VYNY+ + 
Sbjct: 234 YFTRIGNVILILMDIVDVLLSFAKMLKYCGYSTLCDYMFVVFLFWWVMLRHVVYNYLTYQ 293

Query: 301 AWAKSRGLMQNQRCGVHAPGTRCWTPLVIDIFVLLLAGLQLITVIWSFLIVKVFMKVIRG 360
            W +++ LM +  C       RCWTP V++IF+ LL GLQ+IT IW +LI+KV +KVI+G
Sbjct: 294 TWLRAKNLMADGECIAGLAQKRCWTPTVVNIFLALLGGLQVITCIWMYLILKVLVKVIKG 353

Query: 361 SGAED 365
            GAED
Sbjct: 354 IGAED 358

>YHL003C (LAG1) [2282] chr8 complement(100643..101878) Protein
           required with Lac1p for ceramide synthesis and
           ER-to-Golgi transport of GPI-anchored proteins,
           indirectly affects cell longevity [1236 bp, 411 aa]
          Length = 411

 Score =  110 bits (274), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 83/269 (30%), Positives = 130/269 (48%), Gaps = 8/269 (2%)

Query: 93  VESPGKYDIGIDDAYIVGTFXXXXXXXXXXXXEFVLKPLAHYKFRISSGKIQQRYGEQSW 152
           V+    Y  GI D   V  +            + V++P   Y   ++S   Q+R  EQ +
Sbjct: 120 VDGTDSYAKGIKDLSFVFFYMIFFTFLREFLMDVVIRPFTVY-LNVTSEHRQKRMLEQMY 178

Query: 153 SMLYYTASWVTGFYLYYHSPYFL-NCDHIYLNWPHDKMAGVFKVYYLVQIASWLQQ--II 209
           ++ Y   S   G Y+ YHS  +L     +Y  +P      +FK++YL Q A W QQ  ++
Sbjct: 179 AIFYCGVSGPFGLYIMYHSDLWLFKTKPMYRTYPVITNPFLFKIFYLGQAAFWAQQACVL 238

Query: 210 VLNVEEKRKDYWQMFAHHIITVALTTGSYYYYFNRIGHXXXXXXXXXXXXXSSAKILKYC 269
           VL +E+ RKDY ++  HHI+T+ L   SY ++F ++G              S +K L Y 
Sbjct: 239 VLQLEKPRKDYKELVFHHIVTLLLIWSSYVFHFTKMGLAIYITMDVSDFFLSLSKTLNYL 298

Query: 270 GFSVACDYMFVVFLGFWVVLRHGVYNYILHHAWAKSRGLMQNQRCGVHAPGTRCWTPLVI 329
             SV   ++F +F+ FW+ LRH V   IL     + R    N          +CW  L I
Sbjct: 299 N-SVFTPFVFGLFVFFWIYLRHVVNIRILWSVLTEFRH-EGNYVLNFATQQYKCWISLPI 356

Query: 330 DIFVLLLAGLQLITVIWSFLIVKVFMKVI 358
            +FV L+A LQL+ + W FLI+++  ++I
Sbjct: 357 -VFV-LIAALQLVNLYWLFLILRILYRLI 383

>CAGL0K02739g complement(246652..247947) highly similar to sp|P38703
           Saccharomyces cerevisiae YHL003c longevity-assurance
           protein, hypothetical start
          Length = 431

 Score =  105 bits (261), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 79/246 (32%), Positives = 124/246 (50%), Gaps = 12/246 (4%)

Query: 125 EFVLKPLAHYKFRISSGKIQQRYGEQSWSMLYYTASWVTGFYLYYHSPYFL-NCDHIYLN 183
           + V++P+      I+S    +R  EQ +++ Y   S   G Y+ YHS  +L     +Y +
Sbjct: 159 DVVIRPITRI-LNITSRHKVKRMMEQMYALFYCGCSGPFGLYIMYHSDLWLFKTKEMYNS 217

Query: 184 WPHDKMAGVFKVYYLVQIASWLQQ--IIVLNVEEKRKDYWQMFAHHIITVALTTGSYYYY 241
           +P      ++KV+YL Q A W QQ  ++VL +E  RKDY ++  HHI+T+ L   SY ++
Sbjct: 218 YPDFTNPFLYKVFYLGQAAFWSQQACVLVLQLERPRKDYKELVFHHIVTLLLIWSSYVFH 277

Query: 242 FNRIGHXXXXXXXXXXXXXSSAKILKYCGFSVACDYMFVVFLGFWVVLRHGVYNYILHHA 301
           F ++G              S +KIL Y   S+    +F+VF+G W+ LRH V   IL   
Sbjct: 278 FTKMGLSIYITMDISDFFLSLSKILNYLD-SIFTPPVFLVFVGSWIYLRHVVNIRILWSV 336

Query: 302 WA--KSRGLMQNQRCGVHAPGTRCWTPLVIDIFVLLLAGLQLITVIWSFLIVKVFMKVIR 359
               K+ G   N          +CW    I +FVL+ A LQL+ + W FLI K+ +++I 
Sbjct: 337 LTEFKTEG---NYVLNFATSQYKCWISQPI-VFVLIFA-LQLVNLYWLFLIFKILLRLIF 391

Query: 360 GSGAED 365
               +D
Sbjct: 392 KGEQKD 397

>Kwal_26.7886
          Length = 422

 Score =  104 bits (260), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 82/263 (31%), Positives = 127/263 (48%), Gaps = 8/263 (3%)

Query: 99  YDIGIDDAYIVGTFXXXXXXXXXXXXEFVLKPLAHYKFRISSGKIQQRYGEQSWSMLYYT 158
           Y  GI D   V  +            E  L+PLA     +S  K   R  EQ++S++YY 
Sbjct: 120 YGKGIKDLLFVIFYMIFFTFLREFLMEVALRPLASALGVVSQHK-TNRIMEQTYSIIYYG 178

Query: 159 ASWVTGFYLYYHSPYFL-NCDHIYLNWPHDKMAGVFKVYYLVQIASWLQQ--IIVLNVEE 215
            S   G Y+ YHS  +L     +Y  +P      + KV+YL Q A W QQ  I+ L +E+
Sbjct: 179 ISGPFGLYIMYHSDLWLFKTAPMYATYPDLTNQFMTKVFYLGQAAFWTQQACILTLQLEK 238

Query: 216 KRKDYWQMFAHHIITVALTTGSYYYYFNRIGHXXXXXXXXXXXXXSSAKILKYCGFSVAC 275
            RKD+ ++  HHI+T+AL   SY ++F  +G              S +K L Y   ++A 
Sbjct: 239 PRKDFKELVFHHIVTLALIWLSYVFHFTNMGLAVYITMDVSDFFLSLSKTLNYLDSALAA 298

Query: 276 DYMFVVFLGFWVVLRHGVYNYILHHAWAKSRGLMQNQRCGVHAPGTRCWTPLVIDIFVLL 335
            + F++F+  WV LRH +   IL     + R +  +          +CW  L I +F  L
Sbjct: 299 PF-FMLFVCSWVYLRHYINIKILWSVLTEFRTI-GDYTLNFATQQYKCWISLPI-VFT-L 354

Query: 336 LAGLQLITVIWSFLIVKVFMKVI 358
           ++ LQL+ + W FLIV+V  +++
Sbjct: 355 ISALQLVNLYWLFLIVRVLYRIL 377

>CAGL0M10219g complement(1020895..1022088) similar to sp|P28496
           Saccharomyces cerevisiae YKL008c protein required with
           LAG1 or sp|P38703 Saccharomyces cerevisiae YHL003c LAG1,
           hypothetical start
          Length = 397

 Score =  102 bits (254), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 80/292 (27%), Positives = 136/292 (46%), Gaps = 8/292 (2%)

Query: 77  RQAAWCDKFLRLQYASVESPGKYDIGIDDAYIVGTFXXXXXXXXXXXXEFVLKPLAHYKF 136
           R   +   F+ + Y    +P  Y  GI D   V               + +++ +  +  
Sbjct: 94  RVKGFLHMFVAISYEQESNPQYYGKGIKDLAFVFFHMIFFTFLREFLMDVIIRRITQW-L 152

Query: 137 RISSGKIQQRYGEQSWSMLYYTASWVTGFYLYYHSP-YFLNCDHIYLNWPHDKMAGVFKV 195
            I+S    +R  EQ +S+ YY  S   G Y+ YHS  ++   + +Y  +P   +  +FK 
Sbjct: 153 NITSKYKIKRMMEQMFSIFYYGFSSPFGVYVMYHSDLWYFRTNTMYNTYPDILIPKLFKA 212

Query: 196 YYLVQIASWLQQ--IIVLNVEEKRKDYWQMFAHHIITVALTTGSYYYYFNRIGHXXXXXX 253
           +YL+Q A W QQ  ++VL +E+ RKD+ ++  HH++T+ L   SY ++F+++G       
Sbjct: 213 FYLIQAAFWAQQAFVLVLQLEKPRKDHKELCFHHVVTLLLIWSSYVFHFHKMGLAVYITM 272

Query: 254 XXXXXXXSSAKILKYCGFSVACDYMFVVFLGFWVVLRHGVYNYILHHAWAKSRGLMQNQR 313
                  + +K L Y   S   + +F +F+  W+ LRH +   IL     + R       
Sbjct: 273 DVSDFFLALSKTLNYID-SPLTEVVFGMFVLVWIYLRHVINGKILWSVLTEFRT-EGPYI 330

Query: 314 CGVHAPGTRCWTPLVIDIFVLLLAGLQLITVIWSFLIVKVFMKVIRGSGAED 365
                   +CW  L I +FVL+ A LQ++ + W FLI KV  K++     ED
Sbjct: 331 LNFATQQYKCWISLPI-VFVLIFA-LQVLNIYWLFLIFKVLYKIVWQGVTED 380

>Scas_668.20
          Length = 425

 Score =  101 bits (252), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 82/276 (29%), Positives = 128/276 (46%), Gaps = 8/276 (2%)

Query: 93  VESPGKYDIGIDDAYIVGTFXXXXXXXXXXXXEFVLKPLAHYKFRISSGKIQQRYGEQSW 152
           V+   +Y  GI D   V  +            + VL+P+       +S    +R  EQ +
Sbjct: 131 VDDTDEYAKGIKDLCFVFYYMIFFTFLREFLLDVVLRPIPDI-LHANSKHKSKRIIEQMF 189

Query: 153 SMLYYTASWVTGFYLYYHSPYFL-NCDHIYLNWPHDKMAGVFKVYYLVQIASWLQQ--II 209
            ++YY  S   G Y+ YHS  +L     +Y  +P      +FKV+YL Q A W QQ  ++
Sbjct: 190 YIVYYGFSAPFGLYVMYHSNLWLFKTAPMYETYPDLTNPFLFKVFYLGQAAFWAQQACVL 249

Query: 210 VLNVEEKRKDYWQMFAHHIITVALTTGSYYYYFNRIGHXXXXXXXXXXXXXSSAKILKYC 269
           VL +E+ RKD+ +M  HHI+T+ L   SY ++F RIG              S +KI  Y 
Sbjct: 250 VLQLEKPRKDHQEMIFHHIVTLLLVWSSYVFHFTRIGLAIYITMDISDFLLSLSKIFNYL 309

Query: 270 GFSVACDYMFVVFLGFWVVLRHGVYNYILHHAWAKSRGLMQNQRCGVHAPGTRCWTPLVI 329
             S     +F +F+  W+ LRH +   IL     + R +  +          +CW  L I
Sbjct: 310 D-SPFTPPVFFIFVTTWIYLRHYINIKILWSVLTEFRTV-GDYVLDFATQQYKCWISLPI 367

Query: 330 DIFVLLLAGLQLITVIWSFLIVKVFMKVIRGSGAED 365
            +F  L+A LQL+ + W FLI ++  +++     ED
Sbjct: 368 -VFT-LIAALQLVNLYWLFLIFRILYRMVWKGIVED 401

>YKL008C (LAC1) [3248] chr11 complement(426938..428194) Protein
           required with Lag1p for ceramide synthesis and
           ER-to-Golgi transport of GPI-anchored proteins [1257 bp,
           418 aa]
          Length = 418

 Score =  101 bits (251), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 83/281 (29%), Positives = 133/281 (47%), Gaps = 10/281 (3%)

Query: 84  KFLRLQYASVESPGKYDIGIDDAYIVGTFXXXXXXXXXXXXEFVLKPLAHYKFRISSGKI 143
           +F+ + Y  +     Y  GI+D   V  +            + V++P A  +  ++S   
Sbjct: 112 RFVAVSY-QIGDTNAYGKGINDLCFVFYYMIFFTFLREFLMDVVIRPFA-IRLHVTSKHR 169

Query: 144 QQRYGEQSWSMLYYTASWVTGFYLYYHSP-YFLNCDHIYLNWPHDKMAGVFKVYYLVQIA 202
            +R  EQ +++ Y   S   G Y  YHS  +F N   +Y  +P      +FKV+YL Q A
Sbjct: 170 IKRIMEQMYAIFYTGVSGPFGIYCMYHSDLWFFNTKAMYRTYPDFTNPFLFKVFYLGQAA 229

Query: 203 SWLQQ--IIVLNVEEKRKDYWQMFAHHIITVALTTGSYYYYFNRIGHXXXXXXXXXXXXX 260
            W QQ  I+VL +E+ RKD+ ++  HHI+T+ L   SY ++F ++G              
Sbjct: 230 FWAQQACILVLQLEKPRKDHNELTFHHIVTLLLIWSSYVFHFTKMGLPIYITMDVSDFLL 289

Query: 261 SSAKILKYCGFSVACDYMFVVFLGFWVVLRHGVYNYILHHAWAKSRGLMQNQRCGVHAPG 320
           S +K L Y    +A  + F +F+  W+ LRH +   IL     + R    N         
Sbjct: 290 SFSKTLNYLDSGLAF-FSFAIFVVAWIYLRHYINLKILWSVLTQFRT-EGNYVLNFATQQ 347

Query: 321 TRCWTPLVIDIFVLLLAGLQLITVIWSFLIVKVFMKVI-RG 360
            +CW  L I +FV L+  LQL+ + W FLI +V  +++ RG
Sbjct: 348 YKCWISLPI-VFV-LIGALQLVNLYWLFLIFRVLYRILWRG 386

>Scas_717.23
          Length = 430

 Score = 98.6 bits (244), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 76/276 (27%), Positives = 129/276 (46%), Gaps = 8/276 (2%)

Query: 93  VESPGKYDIGIDDAYIVGTFXXXXXXXXXXXXEFVLKPLAHYKFRISSGKIQQRYGEQSW 152
           +E   +Y  GI D   V  +            + V++P+   K  ++SG   +R  EQ++
Sbjct: 126 IEETDQYGKGIKDLCFVFFYMIFFTFLREFMMDMVIRPIT-IKLNVTSGHKMKRIMEQAF 184

Query: 153 SMLYYTASWVTGFYLYYHSPYFL-NCDHIYLNWPHDKMAGVFKVYYLVQIASWLQQ--II 209
            ++YY  S   G Y+ Y++  +L     +Y  +P      ++K++YL Q A W QQ  ++
Sbjct: 185 YIIYYGISGPFGLYIMYNTDLWLFETKTMYQTYPDFNNTFLYKLFYLGQAAFWAQQACVL 244

Query: 210 VLNVEEKRKDYWQMFAHHIITVALTTGSYYYYFNRIGHXXXXXXXXXXXXXSSAKILKYC 269
           VL +E+ RKD+ ++  HHI+T+ L   SY ++F R+G              +  K + Y 
Sbjct: 245 VLQLEKPRKDFKELVFHHIVTLLLIWSSYTFHFTRMGLAIYITMDVSDFFLALTKTVNYL 304

Query: 270 GFSVACDYMFVVFLGFWVVLRHGVYNYILHHAWAKSRGLMQNQRCGVHAPGTRCWTPLVI 329
             S     +F  F+  W+ LRH V   IL     + R    N          +CW  L I
Sbjct: 305 D-SKFTPPIFFTFIVVWIYLRHYVNIKILWSVLTEFRT-EGNYVLNFATQQYKCWISLPI 362

Query: 330 DIFVLLLAGLQLITVIWSFLIVKVFMKVIRGSGAED 365
            +F L+ A LQ++ + W FLI ++  ++I     +D
Sbjct: 363 -VFTLIFA-LQVVNLYWLFLIFRILYRLIFTGVQKD 396

>Sklu_2243.4 YHL003C, Contig c2243 7329-8558
          Length = 409

 Score = 92.4 bits (228), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 73/270 (27%), Positives = 129/270 (47%), Gaps = 8/270 (2%)

Query: 99  YDIGIDDAYIVGTFXXXXXXXXXXXXEFVLKPLAHYKFRISSGKIQQRYGEQSWSMLYYT 158
           Y  G+ D   V  +            E +L+PL+  K  I+     +R  EQ++S++YY 
Sbjct: 121 YGKGVKDLCFVFFYMIFFTFLREFLMELLLRPLS-IKLGITKEHKIRRMMEQAYSIIYYG 179

Query: 159 ASWVTGFYLYYHSPYFL-NCDHIYLNWPHDKMAGVFKVYYLVQIASWLQQ--IIVLNVEE 215
            S   G Y+ Y +  +L     +Y  +P      ++K++YL Q + W QQ  ++VL +E+
Sbjct: 180 ISGPFGLYIMYQTDLWLFATAPMYKTYPDMTNEYLYKIFYLGQASFWTQQACVLVLQLEK 239

Query: 216 KRKDYWQMFAHHIITVALTTGSYYYYFNRIGHXXXXXXXXXXXXXSSAKILKYCGFSVAC 275
            RKD+ ++  HHIIT+AL   SY ++F ++G              + +K   Y   ++  
Sbjct: 240 PRKDFKELVFHHIITLALIWLSYVFHFTKMGLAVYITMDVSDFFLALSKTFNYLDSTLTA 299

Query: 276 DYMFVVFLGFWVVLRHGVYNYILHHAWAKSRGLMQNQRCGVHAPGTRCWTPLVIDIFVLL 335
            + F +F+  W+ LRH V   IL     + R +  +          +CW    I +F L+
Sbjct: 300 PFFF-LFVVSWIYLRHYVNIKILWSVLTEFRTV-GDYTLNFATQQYKCWISQPI-VFALI 356

Query: 336 LAGLQLITVIWSFLIVKVFMKVIRGSGAED 365
            A LQL+ + W FLI+++  +++     +D
Sbjct: 357 FA-LQLVNLYWFFLILRILYRLVFKGIQKD 385

>ABR009W [600] [Homologous to ScYHL003C (LAG1) - SH; ScYKL008C
           (LAC1) - SH] complement(408462..409703) [1242 bp, 413
           aa]
          Length = 413

 Score = 89.7 bits (221), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 73/269 (27%), Positives = 125/269 (46%), Gaps = 8/269 (2%)

Query: 93  VESPGKYDIGIDDAYIVGTFXXXXXXXXXXXXEFVLKPLAHYKFRISSGKIQQRYGEQSW 152
           V +   Y  G+ D   V  +            E VL+PL  ++  ++     +R  EQ++
Sbjct: 116 VGNTNMYGKGVKDMCFVFYYMVFFTFLREFMMEMVLRPLT-FRLGVTKPHKVKRMMEQAY 174

Query: 153 SMLYYTASWVTGFYLYYHSPYFL-NCDHIYLNWPHDKMAGVFKVYYLVQIASWLQQ--II 209
           S  YY  S   G ++ Y +  +L     +Y  +P       +K++YL Q A W QQ  I+
Sbjct: 175 STFYYGLSGPFGLFVMYRTDLWLFKTAEMYKTYPDLTNEYYYKIFYLGQAAFWAQQACIL 234

Query: 210 VLNVEEKRKDYWQMFAHHIITVALTTGSYYYYFNRIGHXXXXXXXXXXXXXSSAKILKYC 269
           VL +E+ RKD+ ++  HHI+T+AL + SY ++F ++G              + +KI  Y 
Sbjct: 235 VLQLEKPRKDFRELVFHHIVTLALISLSYVFHFTKMGLAVYITMDVSDFFLALSKIFNYM 294

Query: 270 GFSVACDYMFVVFLGFWVVLRHGVYNYILHHAWAKSRGLMQNQRCGVHAPGTRCWTPLVI 329
             S     +F++F+  WV LRH V   IL     + R +  +          + W  L I
Sbjct: 295 ESSFTAP-LFLLFVSSWVYLRHYVNIKILWSVLTEFRTV-GDYTLNFATEQYKSWIALPI 352

Query: 330 DIFVLLLAGLQLITVIWSFLIVKVFMKVI 358
            +F L+ A L L+ + W  LI ++  +++
Sbjct: 353 -VFGLIFA-LHLVNLYWLALIFRILYRML 379

>KLLA0B13497g 1181036..1182262 similar to sp|P28496 Saccharomyces
           cerevisiae YKL008c LAC1 protein required with LAG1P for
           ER-to-Golgi transport of GPI-anchored proteins,
           hypothetical start
          Length = 408

 Score = 84.0 bits (206), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 89/170 (52%), Gaps = 5/170 (2%)

Query: 125 EFVLKPLAHYKFRISSGKIQQRYGEQSWSMLYYTASWVTGFYLYYHSPYFL-NCDHIYLN 183
           + +L+PL+         KI+ R  EQ +S+ YY+ S   G Y+ YH+  +L   D +Y  
Sbjct: 146 QVILRPLSIKMGSTRENKIR-RMMEQMYSIFYYSISGPFGLYIMYHTDLWLFRTDTMYKT 204

Query: 184 WPHDKMAGVFKVYYLVQIASWLQQ--IIVLNVEEKRKDYWQMFAHHIITVALTTGSYYYY 241
           +P      ++K++YL Q A W QQ  ++ L +E+ RKD+ ++  HHI+T+AL   SY ++
Sbjct: 205 YPDFNNEYLYKIFYLGQAAFWTQQSCVLTLQLEKPRKDFQELIFHHIVTLALIWLSYVFH 264

Query: 242 FNRIGHXXXXXXXXXXXXXSSAKILKYCGFSVACDYMFVVFLGFWVVLRH 291
           F ++G              S +K   Y   S+   + F+ F+  WV LRH
Sbjct: 265 FTKMGLSVYVTMDVSDFFLSLSKTFNYLDSSLTPPF-FLFFIVSWVYLRH 313

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.328    0.140    0.457 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,070,626
Number of extensions: 364536
Number of successful extensions: 922
Number of sequences better than 10.0: 15
Number of HSP's gapped: 894
Number of HSP's successfully gapped: 15
Length of query: 365
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 262
Effective length of database: 13,030,455
Effective search space: 3413979210
Effective search space used: 3413979210
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 62 (28.5 bits)