Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL193C46545621580.0
Kwal_55.221064954357452e-93
Sklu_2316.34874577372e-92
KLLA0E02134g5394627301e-90
YGR197C (SNG1)5474546717e-82
CAGL0G09273g5454436291e-75
Scas_617.35414255983e-71
Scas_647.94493895836e-70
CAGL0B03949g6324225563e-64
YJR015W5104205118e-59
CAGL0B03971g5434684953e-56
Scas_434.13572962784e-27
Scas_617.0d4636883e-04
Sklu_2175.4800786310.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL193C
         (456 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL193C [1548] [Homologous to ScYGR197C (SNG1) - NSH] (357909..3...   835   0.0  
Kwal_55.22106                                                         291   2e-93
Sklu_2316.3 , Contig c2316 10494-11957 reverse complement             288   2e-92
KLLA0E02134g complement(200436..202055) similar to sp|P46950 Sac...   285   1e-90
YGR197C (SNG1) [2147] chr7 complement(892500..894143) Probable t...   263   7e-82
CAGL0G09273g 885374..887011 similar to sp|P46950 Saccharomyces c...   246   1e-75
Scas_617.3                                                            234   3e-71
Scas_647.9                                                            229   6e-70
CAGL0B03949g complement(387861..389759) similar to sp|P46950 Sac...   218   3e-64
YJR015W (YJR015W) [2918] chr10 (462635..464167) Protein with sim...   201   8e-59
CAGL0B03971g complement(390700..392331) similar to sp|P47090 Sac...   195   3e-56
Scas_434.1                                                            111   4e-27
Scas_617.0d                                                            39   3e-04
Sklu_2175.4 YOL076W, Contig c2175 4893-7295                            29   10.0 

>ADL193C [1548] [Homologous to ScYGR197C (SNG1) - NSH]
           (357909..359306) [1398 bp, 465 aa]
          Length = 465

 Score =  835 bits (2158), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/456 (89%), Positives = 410/456 (89%)

Query: 1   MNVQEDESTDFEDDSRTESVQMYLGEYPKNAEREGSGEMLGGKLARLKTRFMSPRVYLAR 60
           MNVQEDESTDFEDDSRTESVQMYLGEYPKNAEREGSGEMLGGKLARLKTRFMSPRVYLAR
Sbjct: 1   MNVQEDESTDFEDDSRTESVQMYLGEYPKNAEREGSGEMLGGKLARLKTRFMSPRVYLAR 60

Query: 61  KRXXXXXXXXXXXXACLVLVVFSLHVGVLVNQQQYLGRLPMLMVVQDEDAGMSAELLRAA 120
           KR            ACLVLVVFSLHVGVLVNQQQYLGRLPMLMVVQDEDAGMSAELLRAA
Sbjct: 61  KRLLVLFLSNKLFLACLVLVVFSLHVGVLVNQQQYLGRLPMLMVVQDEDAGMSAELLRAA 120

Query: 121 EHAAGRWTTVHGAAAWSHFGLEEDADLDEYLQSLIRKHRYWMALHVRPGATEALRRSLDD 180
           EHAAGRWTTVHGAAAWSHFGLEEDADLDEYLQSLIRKHRYWMALHVRPGATEALRRSLDD
Sbjct: 121 EHAAGRWTTVHGAAAWSHFGLEEDADLDEYLQSLIRKHRYWMALHVRPGATEALRRSLDD 180

Query: 181 PGAPVFNSSEFFKVYYETVRDFNAMGSVRKLMETLEANFRAYYLDTWLPGELRERANTID 240
           PGAPVFNSSEFFKVYYETVRDFNAMGSVRKLMETLEANFRAYYLDTWLPGELRERANTID
Sbjct: 181 PGAPVFNSSEFFKVYYETVRDFNAMGSVRKLMETLEANFRAYYLDTWLPGELRERANTID 240

Query: 241 LSSTGSNIVAAGSMRWSYVDLGPFYDPSLYGILQVGMIICLLLTFFQLAMISAXXXXXXX 300
           LSSTGSNIVAAGSMRWSYVDLGPFYDPSLYGILQVGMIICLLLTFFQLAMISA       
Sbjct: 241 LSSTGSNIVAAGSMRWSYVDLGPFYDPSLYGILQVGMIICLLLTFFQLAMISALHTELSL 300

Query: 301 XXXXXXXXXXXXXXXXXXXXXXXXXXXIVPIIYHLDMEKAYGRAGFLVFWMTTWLFMTAL 360
                                      IVPIIYHLDMEKAYGRAGFLVFWMTTWLFMTAL
Sbjct: 301 LLRTSHLLLYRYIVSYASYLLLSLFYSIVPIIYHLDMEKAYGRAGFLVFWMTTWLFMTAL 360

Query: 361 GGANENVISVIFEYCPRFVGFWLMFWIVFNITPTFYSLHLANDFYKYGYITPIYNARECY 420
           GGANENVISVIFEYCPRFVGFWLMFWIVFNITPTFYSLHLANDFYKYGYITPIYNARECY
Sbjct: 361 GGANENVISVIFEYCPRFVGFWLMFWIVFNITPTFYSLHLANDFYKYGYITPIYNARECY 420

Query: 421 KVLLFDTDRGYLKVAYVVLVAWTVLNAALFPLALKI 456
           KVLLFDTDRGYLKVAYVVLVAWTVLNAALFPLALKI
Sbjct: 421 KVLLFDTDRGYLKVAYVVLVAWTVLNAALFPLALKI 456

>Kwal_55.22106
          Length = 495

 Score =  291 bits (745), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 157/435 (36%), Positives = 244/435 (56%), Gaps = 9/435 (2%)

Query: 28  PKNAEREGSGEM--LGGKLARLKTRFMSPRVYLARKRXXXXXXXXXXXXACLVLVVFSLH 85
           P+N      GE+  +  KL+R+ T F S RV   R++            A L++ VFSL+
Sbjct: 45  PENEAGATEGELRRVESKLSRVVTGFFSDRVKGERRKLIMRFLLNHFLLAMLIMSVFSLY 104

Query: 86  VGVLVNQQQYLGRLPMLMVVQDEDA---GMSAELLRAAEHAAGRWTTVHGAAAWSHFGLE 142
            G    + +++ ++ +L VVQDE     G+++ +   AE A G W   + ++    +G+ 
Sbjct: 105 WGATYQRSKHMHKVKILAVVQDEPGTGTGIASSIPTLAEQAPGTWHVYNTSSFQQKYGVA 164

Query: 143 EDADLDEYLQSLIRKHRYWMALHVRPGATEALRRSLDDPGAPVFNSSEFFKVYYETVRD- 201
           +D ++D  +Q L+   +YW++L+V+P AT  L  SL +  A  FNSS FF+++YE+ RD 
Sbjct: 165 QD-EVDAKIQQLVHDQKYWVSLNVKPNATSTLIESLQNSRASPFNSSAFFELFYESGRDP 223

Query: 202 FNAMGSVRKLMETLEANFRAYYLDTWLPGELRERANTIDLSSTGSNIVAAGSMRWSYVDL 261
            N   S+  +  +LE+ ++  Y  T LPG L     T  +     N+  AG+M ++ VD 
Sbjct: 224 TNLKSSILPIALSLESRYQNIYASTILPGILSNI--TQRVGDVSRNVAMAGNMVFAQVDN 281

Query: 262 GPFYDPSLYGILQVGMIICLLLTFFQLAMISAXXXXXXXXXXXXXXXXXXXXXXXXXXXX 321
            PF D  L G LQVG+I C+LLTFFQLA+                               
Sbjct: 282 RPFNDYVLLGPLQVGLIYCILLTFFQLALFGPIHALLGQKLKPVHMLLYRYVIAFVNYFF 341

Query: 322 XXXXXXIVPIIYHLDMEKAYGRAGFLVFWMTTWLFMTALGGANENVISVIFEYCPRFVGF 381
                 +V + + +D  KA+GRAGF+V WM++WL M A+GGANEN++++I  + P+++GF
Sbjct: 342 LSLFFCLVSLAFQVDFTKAFGRAGFMVAWMSSWLLMAAVGGANENMLTIIMAFGPQYLGF 401

Query: 382 WLMFWIVFNITPTFYSLHLANDFYKYGYITPIYNARECYKVLLFDTDRGYLKVAYVVLVA 441
           WL+FW+V NI+P FY + L ++FY+YGY+TPIYN    ++V   D  RG+L   Y +L A
Sbjct: 402 WLIFWVVLNISPAFYPMELTHNFYRYGYMTPIYNGVGIFRVTFLDLYRGHLGRNYGILCA 461

Query: 442 WTVLNAALFPLALKI 456
           W VLN A+FP  +K+
Sbjct: 462 WIVLNMAIFPFVMKL 476

>Sklu_2316.3 , Contig c2316 10494-11957 reverse complement
          Length = 487

 Score =  288 bits (737), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 166/457 (36%), Positives = 243/457 (53%), Gaps = 16/457 (3%)

Query: 1   MNVQEDESTDFEDDSRTESVQMYLGEYPKNAEREGSGEMLGGKLARLKTRFMSPRVYLAR 60
           +N  E    D +  S  +SV+  L E   N          GG L R+ T F SPR+   R
Sbjct: 25  LNQFEQRCLD-QAQSEHDSVRTSLSEVASND---------GGSLQRMATSFFSPRLQAQR 74

Query: 61  KRXXXXXXXXXXXXACLVLVVFSLHVGVLVNQQQYLGRLPMLMVVQDEDAGMSAELLRAA 120
           K             A L + VFSL+ G L N+  +LG++ +L V+QD D  +   L    
Sbjct: 75  KHVWFQFLFNILALAALTISVFSLYWGALYNRNSHLGKVRILAVIQD-DGSLPGALPAII 133

Query: 121 EHAAGRWTTVHGAAAWSHFGLEEDADLDEYLQSLIRKHRYWMALHVRPGATEALRRSLDD 180
           +   G W         S + + E   +D  ++ L+   ++WM+L+V+P AT AL  SL +
Sbjct: 134 DANPGGWHVYTSEQFQSKYHINE-TQIDSKIEHLVHTQKFWMSLNVKPNATNALHESLQN 192

Query: 181 PGAPVFNSSEFFKVYYETVRD-FNAMGSVRKLMETLEANFRAYYLDTWLPGELRERANTI 239
           P A  F +S +F+  YE+ RD  N   S+  L++ +E +F+  Y  ++LP EL    N  
Sbjct: 193 PSADPFVASNYFEAIYESGRDPTNFRSSILPLLQEVELSFQKNYTSSYLP-ELLSHTNLS 251

Query: 240 DLSSTGSNIVAAGSMRWSYVDLGPFYDPSLYGILQVGMIICLLLTFFQLAMISAXXXXXX 299
           + S   +N+ AAG++ +   D+ PF +  L G LQVG+I C+LLTFFQLAM         
Sbjct: 252 NASP--ANLAAAGNLEFCSEDMRPFSNYVLLGPLQVGLIFCVLLTFFQLAMFGPLHGMVS 309

Query: 300 XXXXXXXXXXXXXXXXXXXXXXXXXXXXIVPIIYHLDMEKAYGRAGFLVFWMTTWLFMTA 359
                                        V  I+ +D    +GRAGF+V+WM+TWL M A
Sbjct: 310 PKLKPAHILIYRYCISMTAYFFLSLFFCTVSAIFQVDFTPTFGRAGFMVYWMSTWLIMAA 369

Query: 360 LGGANENVISVIFEYCPRFVGFWLMFWIVFNITPTFYSLHLANDFYKYGYITPIYNAREC 419
           +GGANENV+S+I  Y  +++GFWL+FWIV NI+P+F+ L L N+FY+YGY+ PI+NA + 
Sbjct: 370 VGGANENVLSLILPYGAQYLGFWLVFWIVSNISPSFFPLALMNNFYRYGYMMPIHNAMDI 429

Query: 420 YKVLLFDTDRGYLKVAYVVLVAWTVLNAALFPLALKI 456
           YKV+  +T +G L   Y +L AW V+N+ LF   LKI
Sbjct: 430 YKVIFLNTYKGTLGRNYGILCAWVVINSILFVPVLKI 466

>KLLA0E02134g complement(200436..202055) similar to sp|P46950
           Saccharomyces cerevisiae YGR197c SNG1 involved in
           nitroguanidine resistance, start by similarity
          Length = 539

 Score =  285 bits (730), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 161/462 (34%), Positives = 245/462 (53%), Gaps = 16/462 (3%)

Query: 3   VQEDESTDFEDDSRTESVQMYLGEYP----KNAEREGSGEMLGGK--LARLKTRFMSPRV 56
           V ED       D + ESV+ +  E      KN E+        G+  L R+KTRF S ++
Sbjct: 70  VGEDNQDQSTSDEQAESVEEFNKESANIDDKNEEQNDGSPAEAGQPALGRVKTRFFSSKL 129

Query: 57  YLARKRXXXXXXXXXXXXACLVLVVFSLHVGVLVNQQQYLGRLPMLMVVQDEDAGMSAEL 116
              R                L + +FSL+ G L N       +  + VV+D D  M A +
Sbjct: 130 STHRNIFARRFALNCFLLGSLAIAMFSLYWGALYNHSSDYHNVKFIAVVED-DGDMGAGV 188

Query: 117 LRAAEHAAGRWTTVHGAAAWSHFGLEEDADLDEYLQSLIRKHRYWMALHVRPGATEALRR 176
           +   + A  ++   + ++    +G  +D ++ E +  L+   ++W +L V PG T+A   
Sbjct: 189 IPIMDSAIPQFFVYNTSSFRDKYG--QDVNISEKVHHLVHTKKFWGSLIVYPGTTDAFVD 246

Query: 177 SLDDPGAPVFNSSEFFKVYYETVRDFNAM-GSVRKLMETLEANFR-AYYLDTWLPGELRE 234
           SL    AP FNS+++F+ +Y+T RD + M  S+  L+ ++E  ++  ++ + + P  +  
Sbjct: 247 SLTTDDAPAFNSTDYFEFFYKTARDLSNMRASIVPLLTSIETTYKKTFFYNDYFPSVI-- 304

Query: 235 RANTIDLSSTGSNIVAAGSMRWSYVDLGPFYDPSLYGILQVGMIICLLLTFFQLAMISAX 294
            AN  ++S  G N+ AAG M W  +D  PF D +L G +QVG+I C+LLTFFQLA+    
Sbjct: 305 -ANITNIS--GPNLSAAGDMNWKQIDNRPFTDYTLLGPMQVGLIYCILLTFFQLALFGPF 361

Query: 295 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVPIIYHLDMEKAYGRAGFLVFWMTTW 354
                                             V  I+H+D   A+GR GF+V+WMTTW
Sbjct: 362 HAMLSPLLKPKHIILYRLVTSWATYFFLSLFFCTVSAIFHVDFTLAFGRGGFVVYWMTTW 421

Query: 355 LFMTALGGANENVISVIFEYCPRFVGFWLMFWIVFNITPTFYSLHLANDFYKYGYITPIY 414
           + M A+GGANENV+S++  YCP+++GFWL+ WI+ NI+ +F  L LAN FY+YGY+TPIY
Sbjct: 422 ILMGAVGGANENVLSILLAYCPQYLGFWLISWIIINISASFVPLVLANRFYRYGYMTPIY 481

Query: 415 NARECYKVLLFDTDRGYLKVAYVVLVAWTVLNAALFPLALKI 456
           NA E Y+V+  DT +G +   Y +L AW VLN  LFP  +KI
Sbjct: 482 NAMEIYRVIFTDTYKGDMGRNYGILAAWCVLNTLLFPFVMKI 523

>YGR197C (SNG1) [2147] chr7 complement(892500..894143) Probable
           transport protein, confers resistance to MNNG and
           nitrosoguanidine [1644 bp, 547 aa]
          Length = 547

 Score =  263 bits (671), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 150/454 (33%), Positives = 229/454 (50%), Gaps = 10/454 (2%)

Query: 10  DFEDDSRTESVQMYLGEYPKNAEREGSGEMLGGKLARLKTRFMSPRVYLARKRXXXXXXX 69
           D+       S    +GE   N E +G  +  GG LAR++T   SPR+   RK+       
Sbjct: 54  DYRPPDEKPSSLSSVGEGGANEEEKGGND--GGPLARIQTGLFSPRLRNHRKKILSKFVL 111

Query: 70  XXXXXACLVLVVFSLHVGVLVNQQQYLGRLPMLMVVQDEDAGMSAELLRAA-----EHAA 124
                AC+ + + S++ G      +Y  ++  ++V+QD  +  S + + A          
Sbjct: 112 NNFFIACVCVSLISIYWGACYGTDRYFFKVKNIVVLQDAPSNTSVQSISAIIPSLLASVP 171

Query: 125 GRWTTVHGAAAWSHFGLEEDADLDEYLQSLIRKHRYWMALHVRPGATEALRRSLDDPGAP 184
           G W   +  +    FG     ++D  +  LI   RYW+AL+V+P AT+ L  SL    A 
Sbjct: 172 GTWHIYNATSFHRKFGTTNSTEIDRKIVDLIYDERYWLALNVKPNATDTLYNSLISQDAN 231

Query: 185 V-FNSSEFFKVYYETVRDFNAMGS-VRKLMETLEANFRAYYLDTWLPGELRE-RANTIDL 241
             FNSS FF+  +E+ RD +++ S +  LM+ LE   + YY+  +LP  +    +N  DL
Sbjct: 232 SEFNSSIFFESVFESGRDPSSVKSTILPLMQQLEVRLQKYYVKEYLPSLMSNITSNDRDL 291

Query: 242 SSTGSNIVAAGSMRWSYVDLGPFYDPSLYGILQVGMIICLLLTFFQLAMISAXXXXXXXX 301
           +    N   AG + ++Y D  PF D  L   LQVG+I C+LLT  QL++           
Sbjct: 292 NINMENWAIAGQLLFTYNDYRPFADRILMAPLQVGLIYCILLTVLQLSLYGKLHGEMARV 351

Query: 302 XXXXXXXXXXXXXXXXXXXXXXXXXXIVPIIYHLDMEKAYGRAGFLVFWMTTWLFMTALG 361
                                      V  I+ +D   A+GR GF+V+WM+TWL M A+G
Sbjct: 352 LKPKHILIYRLLISWATYFLLSIGFCTVSAIFRIDFTPAFGRGGFVVYWMSTWLVMMAVG 411

Query: 362 GANENVISVIFEYCPRFVGFWLMFWIVFNITPTFYSLHLANDFYKYGYITPIYNARECYK 421
           GANENV+S++  YCP ++  WLM WI+ NI+ +FY + L N+FY+YGYI PI+NA + YK
Sbjct: 412 GANENVLSLVIAYCPPYLSIWLMTWIILNISASFYPMVLNNEFYRYGYIMPIHNAVDIYK 471

Query: 422 VLLFDTDRGYLKVAYVVLVAWTVLNAALFPLALK 455
           V+  +  +  +   Y +LVAW  LN +L P  +K
Sbjct: 472 VIFLNLTKRKMGRNYGILVAWVALNTSLMPFCMK 505

>CAGL0G09273g 885374..887011 similar to sp|P46950 Saccharomyces
           cerevisiae YGR197c SNG1 or sp|P47090 Saccharomyces
           cerevisiae YJR015w, hypothetical start
          Length = 545

 Score =  246 bits (629), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 138/443 (31%), Positives = 226/443 (51%), Gaps = 15/443 (3%)

Query: 27  YPKNAEREGSGEMLGG---KLARLKTRFMSPRVYLARKRXXXXXXXXXXXXACLVLVVFS 83
           + K +  +  G    G   K   L    ++P++   +              A + L +  
Sbjct: 78  HQKGSYSDTQGSHTAGFFHKCVHLLKNILNPKLESHKSVLAFQFCFTNVLLATVCLSIIC 137

Query: 84  LHVGVLVNQQQYLGRLPMLMVVQDED----AGMSAELLRAAEHAAGRWTTVHGAAAWSHF 139
           ++ G     + YL ++ +L V+QD+D      M++ L    +   G W   + ++    +
Sbjct: 138 IYWGAAYRTEHYLFKVNILSVIQDQDYNNIQSMASTLPALIDQTPGTWHLYNRSSFVEKY 197

Query: 140 GLEEDAD-LDEYLQSLIRKHRYWMALHVRPGATEALRRSLDDPGAPVFNSSEFFKVYYET 198
           G+E  ++ +D+ +  LI + +YWM+L+V+ GATEAL  SL D  AP FNSS +F+  +E+
Sbjct: 198 GIENTSEAVDKKITDLIFEEKYWMSLNVKTGATEALYNSLTDNTAPAFNSSAYFECMFES 257

Query: 199 VRD-FNAMGSVRKLMETLEANFRAYYLDTWLPGELRERANTIDLSSTGS----NIVAAGS 253
            RD  N   ++  +M+ L+A +  YY  T+LP  LR  + TI+  S G     ++  +G+
Sbjct: 258 GRDPTNLKSAILPIMQQLQAAYVQYYTSTYLPSMLRNVSATIN--SIGDVNPLSLANSGN 315

Query: 254 MRWSYVDLGPFYDPSLYGILQVGMIICLLLTFFQLAMISAXXXXXXXXXXXXXXXXXXXX 313
             ++Y+D  PF+D  L   LQVG+I  L+LT  QL++                       
Sbjct: 316 FEFNYIDYRPFFDRVLLAPLQVGLIFTLILTVVQLSLYGPMHAKMVRVFKPKHFLLYRYG 375

Query: 314 XXXXXXXXXXXXXXIVPIIYHLDMEKAYGRAGFLVFWMTTWLFMTALGGANENVISVIFE 373
                          V  IY +D   A+GR GF+++W+TT+  M A+G  NENVIS+I  
Sbjct: 376 LSWSTYFILSLFFCTVSAIYQIDFTLAFGRGGFVIYWITTFYVMLAIGATNENVISLIVA 435

Query: 374 YCPRFVGFWLMFWIVFNITPTFYSLHLANDFYKYGYITPIYNARECYKVLLFDTDRGYLK 433
           YCP+++  WL+ WI+ NI+P+FY + L N FY+YGY  P++NA + Y+V+  D  R  L 
Sbjct: 436 YCPQYMPIWLISWIILNISPSFYPMVLNNQFYRYGYAMPLHNAVDIYRVIFLDLSRNKLG 495

Query: 434 VAYVVLVAWTVLNAALFPLALKI 456
             Y +L AW  +   +FP  +KI
Sbjct: 496 RNYGILTAWVAVTHIIFPFVMKI 518

>Scas_617.3
          Length = 541

 Score =  234 bits (598), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 131/425 (30%), Positives = 222/425 (52%), Gaps = 12/425 (2%)

Query: 44  LARLKTRFMSPRVYLARKRXXXXXXXXXXXXACLVLVVFSLHVGVLVNQQQYLGRLPMLM 103
           ++  KTR  SP++   RK+            A + L + SL+ G L    ++L R+ ++ 
Sbjct: 103 ISPTKTRLYSPKLASQRKKITVKFIISNLLLAGVCLSILSLYWGSLYQTTKHLERISIIA 162

Query: 104 VVQDE-----DAGMS---AELLRAAEHAAGRWTTVHGAAAWSHFGLEEDADLDEYLQSLI 155
           ++QD+     D  ++   A +    E + G+W   + +     F +++   ++E L +LI
Sbjct: 163 IIQDDYIPPNDLNLTSVVAPVPSFIEQSTGKWHVYNQSYFQEKFNVQDPTMINERLNALI 222

Query: 156 RKHRYWMALHVRPGATEALRRSLDDPGAPVFNSSEFFKVYYETVRDFNAMGS-VRKLMET 214
              +YW+AL++    T  +  SL  P  P FNS++  +V YET R+   + + +  +++ 
Sbjct: 223 HDEKYWIALNIGANLTMRIVNSLTTPNEPFFNSTQHIRVVYETSREPTTLEAYMLPIIQE 282

Query: 215 LEANFRAYYLDTWLPGELRERAN--TIDLSSTGS-NIVAAGSMRWSYVDLGPFYDPSLYG 271
           +E  ++ +Y   +LP  L +  N  T  LS+TG+ N+   G  ++ Y D+  F D  L  
Sbjct: 283 IELAYQDFYHTEYLPELLSKLQNSTTTPLSNTGAANLANIGKFQFDYDDILVFPDRILIA 342

Query: 272 ILQVGMIICLLLTFFQLAMISAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVPI 331
            LQVG+I CL+LT FQL++                                      V  
Sbjct: 343 PLQVGLIYCLILTVFQLSLFGPLHAEMAKYLKPKHIIIYRLSVSWATYFFLSLFFCTVSA 402

Query: 332 IYHLDMEKAYGRAGFLVFWMTTWLFMTALGGANENVISVIFEYCPRFVGFWLMFWIVFNI 391
           I+ +D    +G+ GF+++WMTT+L M ALGGANENV+S+I  + P ++  WL+ WI+ NI
Sbjct: 403 IFQIDFTVTFGKGGFVIYWMTTYLVMLALGGANENVLSLIILFIPEYLPLWLLSWIIMNI 462

Query: 392 TPTFYSLHLANDFYKYGYITPIYNARECYKVLLFDTDRGYLKVAYVVLVAWTVLNAALFP 451
           +PTF  + L N FY+YGY+ P++ A + +KV+  +  + ++   Y +LVAW V+N  LFP
Sbjct: 463 SPTFNPMVLDNVFYRYGYMMPLHQALDIFKVVFLNVSKRHMGRNYGILVAWIVVNTCLFP 522

Query: 452 LALKI 456
           L +KI
Sbjct: 523 LVMKI 527

>Scas_647.9
          Length = 449

 Score =  229 bits (583), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 125/389 (32%), Positives = 196/389 (50%), Gaps = 8/389 (2%)

Query: 75  ACLVLVVFSLHVGVLVNQQQYLGRLPMLMVVQDEDAGMSAELLRAA------EHAAGRWT 128
           A     +F L  G+         R+ +L V+QDE    S  L  A+      +     W 
Sbjct: 20  AVFCFTIFVLFWGINYRITDKYHRVQILAVIQDEGINNSTVLPMASILPTLMQENPATWH 79

Query: 129 TVHGAAAWSHFGLEEDADLDEYLQSLIRKHRYWMALHVRPGATEALRRSLDDPGAPVFNS 188
             +  +    FG      +D+ +   +    YWMAL+V+P AT+AL  +  +P  P FNS
Sbjct: 80  LYNTTSFNEKFGTNSTEAIDKEVIHEVFSEHYWMALNVKPNATQALFETFINPNGPPFNS 139

Query: 189 SEFFKVYYETVRD-FNAMGSVRKLMETLEANFRAYYLDTWLPGELRERANTIDLSSTG-S 246
           +E+F+  + + RD  N   ++  L+E LE  +R YY++T+ P  +   +   +L++   +
Sbjct: 140 TEYFQAVFLSARDPSNFRVTLLPLIEFLETAYRNYYINTYFPQFMSNVSIANNLTTVNVT 199

Query: 247 NIVAAGSMRWSYVDLGPFYDPSLYGILQVGMIICLLLTFFQLAMISAXXXXXXXXXXXXX 306
           NI  AG+M + Y D  PF +  L   + +G+  CLLLTFFQ  + S              
Sbjct: 200 NIALAGAMNFDYFDYRPFTERELIAPVMIGVAYCLLLTFFQFLVYSGLHAETSRLLKPNQ 259

Query: 307 XXXXXXXXXXXXXXXXXXXXXIVPIIYHLDMEKAYGRAGFLVFWMTTWLFMTALGGANEN 366
                                    I+ +D  +A+G+ GF+V+WMTTWLFM A GG NEN
Sbjct: 260 VIYYRIIMLWCTMFIASLFFCTTSAIFQVDFTRAFGKGGFVVYWMTTWLFMVACGGTNEN 319

Query: 367 VISVIFEYCPRFVGFWLMFWIVFNITPTFYSLHLANDFYKYGYITPIYNARECYKVLLFD 426
            +S++F   PRF+G W++ +I+ NITPTFY L LAN  Y+YGY+ P++NA + Y+V+  D
Sbjct: 320 AVSLLFLMGPRFLGIWILSFIILNITPTFYPLILANPVYRYGYMMPVHNAIDIYRVIFLD 379

Query: 427 TDRGYLKVAYVVLVAWTVLNAALFPLALK 455
             +  +   + +L+AW  +N A  P   K
Sbjct: 380 LSKHKMGRNFGLLIAWIAMNTAALPFVYK 408

>CAGL0B03949g complement(387861..389759) similar to sp|P46950
           Saccharomyces cerevisiae YGR197c SNG1 or sp|P47090
           Saccharomyces cerevisiae YJR015w, hypothetical start
          Length = 632

 Score =  218 bits (556), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 123/422 (29%), Positives = 207/422 (49%), Gaps = 13/422 (3%)

Query: 46  RLKTRFMSPRVYLARKRXXXXXXXXXXXXACLVLVVFSLHVGVLVNQQQYLGRLPMLMVV 105
           + KT   S R+   R+R            A  V+   SL+ G + N    L R+  + V+
Sbjct: 166 KKKTSLFSKRMKDHRRRILAKFISTHILLAIFVIGALSLYWGAIYNYSGNLYRVHSIAVI 225

Query: 106 QDE-----DAGMSAELLRAAEHA----AGRWTTVHGAAAWSHFGLEEDADLDEYLQSLIR 156
           QDE     D  +   L R   +      G W  ++       + +    ++DE +  LI 
Sbjct: 226 QDEPYTAPDGTVIPALTRNVTNIINSIPGNWRIMNSTEFKVIYNVTNAQEIDEKVAELIF 285

Query: 157 KHRYWMALHVRPGATEALRRSLDDPGAPVFNSSEFFKVYYETVRD-FNAMGSVRKLMETL 215
             ++W+A++VR GATEA  +S+ + GAPVFNS+ +F+  YE+ RD  N   S+  ++   
Sbjct: 286 DEKFWLAVNVREGATEAFYKSVTEEGAPVFNSTNYFQSIYESGRDPTNLKSSIYPILAKF 345

Query: 216 EANFRAYYLDTWLPGELRERANTIDLSST--GSNIVAAGSMRWSYVDLGPFYDPSLYGIL 273
           E+ FR+ YL  ++P E  +   + D + T   +N+   G+   +  DL PF D  L G L
Sbjct: 346 ESVFRSQYLKIYVP-EFIKNITSPDFNETVNTANLYGLGNFATNSYDLRPFTDRVLLGPL 404

Query: 274 QVGMIICLLLTFFQLAMISAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVPIIY 333
            +G+   ++ + F +++                                      V  I+
Sbjct: 405 SMGLNYNIMFSVFSISIFGPVNKEMAKYLKPRSLFFYRILISWSMFFFLSLFTCTVSAIF 464

Query: 334 HLDMEKAYGRAGFLVFWMTTWLFMTALGGANENVISVIFEYCPRFVGFWLMFWIVFNITP 393
            +D    +G+AGF+++WMT+WL MTA+G ANEN++S+I  +CP+++ +W++ W + NI P
Sbjct: 465 QIDFTPGFGKAGFVIYWMTSWLVMTAVGMANENILSIILTFCPQYMSYWMIIWTILNIAP 524

Query: 394 TFYSLHLANDFYKYGYITPIYNARECYKVLLFDTDRGYLKVAYVVLVAWTVLNAALFPLA 453
           + Y L L + FY++GY  PI+N  + Y+V+  D  R  +   Y +L AW  +N A+ P  
Sbjct: 525 SLYPLVLISRFYRFGYAMPIHNGVQIYRVIFLDISRHQMSRNYGILAAWVAVNTAINPFV 584

Query: 454 LK 455
            K
Sbjct: 585 NK 586

>YJR015W (YJR015W) [2918] chr10 (462635..464167) Protein with
           similarity to Sng1p and multidrug resistance proteins
           [1533 bp, 510 aa]
          Length = 510

 Score =  201 bits (511), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 125/420 (29%), Positives = 201/420 (47%), Gaps = 15/420 (3%)

Query: 51  FMSPRVYLARKRXXXXXXXXXXXXACLVLVVFSLHVGVLVNQQQYLGRLPMLMVVQ---- 106
           F SP +   RK+            A +   +F L  G L +  +YL ++ +L+V+Q    
Sbjct: 74  FFSPNLQGQRKKVLLKFVFTNCLLAIICFTMFVLFWGALYDTSKYLHKVKLLVVIQEPPV 133

Query: 107 ---DEDAGMSAELLRAA-----EHAAGRWTTVHGAAAWSHFGLEEDADLDEYLQSLIRKH 158
              D ++ M    +  A           W   +     + F +     +++ +  L+   
Sbjct: 134 VILDNNSSMVVPSISYALPTFINKIPCDWDIYNSPTFQAKFDVNTPQQVNDKVVDLVYDE 193

Query: 159 RYWMALHVRPGATEALRRSLDDPGAPVFNSSEFFKVYYETVRD-FNAMGSVRKLMETLEA 217
           +YW A++++P ATE L  SL +  AP+FNS+ F +V YET RD  N   ++  + +T+E 
Sbjct: 194 KYWFAINIKPNATETLFESLINDTAPLFNSTLFNQVVYETGRDPTNLKSTILPVAQTIEE 253

Query: 218 NFRAYYLDTWLPGELRERANTID--LSSTGSNIVAAGSMRWSYVDLGPFYDPSLYGILQV 275
            +  +Y   +LP  L          L++    I AAG   + Y D  PF D  L    Q+
Sbjct: 254 YYHTFYTLNYLPPLLTNITQVYRYALTNNARYIAAAGKYNYEYYDHRPFTDRILLAPTQI 313

Query: 276 GMIICLLLTFFQLAMISAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVPIIYHL 335
           G++ CLLLTFFQ  +                                         I+ +
Sbjct: 314 GVVYCLLLTFFQFLLYGPLHVEMAKVLRPANGLIYRIAMSWFTFFFASLFFCTTTAIFQV 373

Query: 336 DMEKAYGRAGFLVFWMTTWLFMTALGGANENVISVIFEYCPRFVGFWLMFWIVFNITPTF 395
           D  K++GR GF+V+WM+TWLFM A GGANEN + ++    P+++GFW++ +++ NI P+F
Sbjct: 374 DFTKSFGRGGFVVYWMSTWLFMLAAGGANENAVMLVITLGPQYLGFWILSFVILNIAPSF 433

Query: 396 YSLHLANDFYKYGYITPIYNARECYKVLLFDTDRGYLKVAYVVLVAWTVLNAALFPLALK 455
           + L L N+ Y+YGY+ P++N  + Y+V+ FD  R  +   Y +LVA   LN AL P   K
Sbjct: 434 FPLALNNNVYRYGYMMPVHNVIDIYRVIFFDVTRRKMGRNYGILVALIALNTALLPFVGK 493

>CAGL0B03971g complement(390700..392331) similar to sp|P47090
           Saccharomyces cerevisiae YJR015w or sp|P46950
           Saccharomyces cerevisiae YGR197c SNG1, hypothetical
           start
          Length = 543

 Score =  195 bits (495), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 130/468 (27%), Positives = 206/468 (44%), Gaps = 18/468 (3%)

Query: 4   QEDESTDFEDDSRTESVQMYLGEYPKNAER----EGSGEMLGGKLARLKTRFMSPRVYLA 59
           +E   T  ED S            P+  E+    + +       L + KTRF SP     
Sbjct: 59  EESIRTSNEDYSEEAKDPQAYAPGPEGDEKGKPTQNNNPEPTNTLTKTKTRFFSPNFKDQ 118

Query: 60  RKRXXXXXXXXXXXXACLVLVVFSLHVGVLVNQQQYLGRLPMLMVVQDEDA--------- 110
           RKR             C    +  L  GVL     Y+ R  +L V+Q++           
Sbjct: 119 RKRVAYRWLLAVFLLMCFCFTILVLMWGVLYRTPHYVRRAKVLAVIQEDQVYRFNDTVQF 178

Query: 111 -GMSAELLRAAEHAAGRWTTVHGAAAWSHFGLEEDADLDEYLQSLIRKHRYWMALHVRPG 169
             +S+ L          W   +  +    + +E    +++ +  L+ K  +W+AL+V+  
Sbjct: 179 PSVSSPLYDIIAEVPLSWEIYNATSFQIKYNVEGIEAMNQKVIDLVYKEEFWLALNVQGN 238

Query: 170 ATEALRRSLDDPGAPV-FNSSEFFKVYYETVRDFNAMGSVR-KLMETLEANFRAYYLDTW 227
            T+ L RSL    + V FNS+  F+V YE+ RD   + SV   + + +E  F+  Y   +
Sbjct: 239 VTDTLVRSLISADSDVQFNSTSLFEVVYESGRDITNLPSVLLPVFQGIEGVFQKVYTYQY 298

Query: 228 LPGELRERANTIDLSSTGSNIVAAGSMRWSYVDLGPFYDPSLYGILQVGMIICLLLTFFQ 287
           LP  L    N  + +   + + AAG M+++Y D  P  D       Q+G + CLLLT FQ
Sbjct: 299 LPQLLGNITNGDNFNP--ARVAAAGRMKFNYNDYRPVTDRVTLLSTQIGAVYCLLLTVFQ 356

Query: 288 LAMISAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVPIIYHLDMEKAYGRAGFL 347
             +                                      V  +Y +D  KA+GRAGF+
Sbjct: 357 FLVFGPLHGEMSRMIKFSNLWIYRLIVLWSVLFFVSIFWCTVSAMYQVDFTKAFGRAGFV 416

Query: 348 VFWMTTWLFMTALGGANENVISVIFEYCPRFVGFWLMFWIVFNITPTFYSLHLANDFYKY 407
           V+WM+T+L+M A+GG NENVI +I    P ++GFW++ +++ N+ P F+++  AN FY+Y
Sbjct: 417 VYWMSTYLYMLAVGGLNENVIMLIILISPSYIGFWILSFVILNLAPAFFAIGYANVFYRY 476

Query: 408 GYITPIYNARECYKVLLFDTDRGYLKVAYVVLVAWTVLNAALFPLALK 455
           GY  P++      +V+ FD  +  L   Y +L AW  LN    P   K
Sbjct: 477 GYAMPLHCIVGINRVIFFDISKHQLGRNYGILCAWVGLNTISMPFVSK 524

>Scas_434.1
          Length = 357

 Score =  111 bits (278), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 80/296 (27%), Positives = 138/296 (46%), Gaps = 16/296 (5%)

Query: 6   DESTDFEDDSRTESVQMYLGEYPKNAEREGSGEMLGGKLARLKTRFMSPRVYLARKRXXX 65
           + ++D E  +  +  +  L ++P   E E        +LA  KT   SP +   RK+   
Sbjct: 58  NTTSDEEKQNPLKERRTSLSQHP--GEDEAITIASLPELAPAKTTLFSPHLTQHRKKIFW 115

Query: 66  XXXXXXXXXACLVLVVFSLHVGVLVNQQQYLGRLPMLMVVQDED--------AGMSAELL 117
                          V  +  G L    QY  ++  LMVVQDE           M++ L 
Sbjct: 116 KFISINAIIGLFCCTVLPIFWGCLYGTNQYFHKVHYLMVVQDEPLQLGGLSVPSMASFLP 175

Query: 118 RAAEHAAGRWTTVHGAAAWSHFGLEEDADLDEYLQSLIRKHRYWMALHVRPGATEALRRS 177
                  G W   + +    H+ L   +D++  +  LI + R+W+A++V+P AT +L +S
Sbjct: 176 EIVPSLPGTWHVYNTSTFMDHYHLTNASDINNKVVDLIFQERFWVAVNVKPNATASLMQS 235

Query: 178 LDDPGA----PVFNSSEFFKVYYETVRDFNAMGSVRKL-METLEANFRAYYLDTWLPGEL 232
           L  P +     +FN++ FF+V YET RD  ++ +   L ++ +E+ +R  Y++ +LP  L
Sbjct: 236 LVQPQSTTPETLFNATNFFQVIYETARDVTSVQAAMVLVVQEMESAYREIYMEQYLPTIL 295

Query: 233 RERANTIDLSSTG-SNIVAAGSMRWSYVDLGPFYDPSLYGILQVGMIICLLLTFFQ 287
            +   T  +SS   +++  A ++ + Y D   FY+ +L G L  G I  L +T FQ
Sbjct: 296 AQMDPTNQISSLAPTSLSRATNINFQYWDYRSFYNRALMGPLLAGTIYSLTITVFQ 351

>Scas_617.0d
          Length = 46

 Score = 38.5 bits (88), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 17/36 (47%), Positives = 22/36 (61%)

Query: 420 YKVLLFDTDRGYLKVAYVVLVAWTVLNAALFPLALK 455
           YKV+  D +R  +   Y +LVAW VLN  LFP  +K
Sbjct: 3   YKVIFCDLERSKMGRNYGILVAWIVLNTCLFPFIMK 38

>Sklu_2175.4 YOL076W, Contig c2175 4893-7295
          Length = 800

 Score = 28.9 bits (63), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 10/78 (12%)

Query: 147 LDEYLQSLIRKHRYWMALHVRPGATEALRRSLDDPGAPVFNSSEFFKVYY-------ETV 199
           +DE L +L ++ +  + L+++    + LRR  DD  A +F S E   VY+       E +
Sbjct: 208 VDELLPALFKEEQSSVDLYLKNFLVDHLRRLGDD--ANMFKSCEKLLVYFDDFELLKELI 265

Query: 200 RDFNAMGSVR-KLMETLE 216
           R  N++G  R +L + LE
Sbjct: 266 RSGNSVGKSRDELAQQLE 283

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.139    0.433 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,298,947
Number of extensions: 523440
Number of successful extensions: 1663
Number of sequences better than 10.0: 14
Number of HSP's gapped: 1650
Number of HSP's successfully gapped: 15
Length of query: 456
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 351
Effective length of database: 12,961,219
Effective search space: 4549387869
Effective search space used: 4549387869
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 63 (28.9 bits)