Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL116C43542722860.0
Sklu_2174.241336413970.0
Kwal_47.1815141436213970.0
CAGL0L00869g41936712101e-165
KLLA0E04455g42137911811e-160
YIL042C3943909521e-126
Scas_704.444433988401e-108
Sklu_2299.65304512214e-19
AER270W4892772162e-18
KLLA0F27423g5122812117e-18
Kwal_14.18254924432109e-18
AAR157C5034171949e-16
KLLA0C05654g4734161912e-15
YGL059W4913261841e-14
CAGL0F07007g4852831823e-14
Scas_563.94924201771e-13
Scas_698.14118393780.17
CAGL0I10406g25780730.45
CAGL0K07920g47597701.2
KLLA0A00638g115582701.6
Scas_582.12216155672.2
YIL147C (SLN1)122088682.3
YGR135W (PRE9)25880672.7
KLLA0D00528g100281682.9
AFR318W25180663.5
Scas_658.12962162664.2
AER421W903117664.8
ADR128C86780646.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL116C
         (427 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL116C [1625] [Homologous to ScYIL042C - SH] (481045..482352) [...   885   0.0  
Sklu_2174.2 YIL042C, Contig c2174 576-1817 reverse complement         542   0.0  
Kwal_47.18151                                                         542   0.0  
CAGL0L00869g complement(105236..106495) similar to sp|P40530 Sac...   470   e-165
KLLA0E04455g 408415..409680 similar to sp|P40530 Saccharomyces c...   459   e-160
YIL042C (YIL042C) [2625] chr9 complement(275107..276291) Protein...   371   e-126
Scas_704.44                                                           328   e-108
Sklu_2299.6 YGL059W, Contig c2299 10909-12501 reverse complement       90   4e-19
AER270W [2772] [Homologous to NOHBY] complement(1131292..1132761...    88   2e-18
KLLA0F27423g complement(2537353..2538891) similar to ca|CA5524|I...    86   7e-18
Kwal_14.1825                                                           86   9e-18
AAR157C [345] [Homologous to ScYGL059W - SH] (627130..628641) [1...    79   9e-16
KLLA0C05654g complement(504568..505989) similar to sp|P53170 Sac...    78   2e-15
YGL059W (YGL059W) [1920] chr7 (392226..393701) Protein with simi...    75   1e-14
CAGL0F07007g 687174..688631 highly similar to sp|P53170 Saccharo...    75   3e-14
Scas_563.9                                                             73   1e-13
Scas_698.14                                                            35   0.17 
CAGL0I10406g complement(1019334..1020107) highly similar to sp|P...    33   0.45 
CAGL0K07920g complement(786086..787513) weakly similar to tr|Q06...    32   1.2  
KLLA0A00638g complement(60378..63845) gi|5531277|emb|CAB50891.1 ...    32   1.6  
Scas_582.12                                                            30   2.2  
YIL147C (SLN1) [2530] chr9 complement(69791..73453) Two-componen...    31   2.3  
YGR135W (PRE9) [2092] chr7 (761395..762171) Proteasome subunit a...    30   2.7  
KLLA0D00528g 51518..54526 some similarities with sp|Q8UBH7 Agrob...    31   2.9  
AFR318W [3510] [Homologous to ScYGR135W (PRE9) - SH] complement(...    30   3.5  
Scas_658.12                                                            30   4.2  
AER421W [2921] [Homologous to ScYNL082W (PMS1) - SH] complement(...    30   4.8  
ADR128C [1869] [Homologous to ScYKL073W (LHS1) - SH] (934447..93...    29   6.9  

>ADL116C [1625] [Homologous to ScYIL042C - SH] (481045..482352)
           [1308 bp, 435 aa]
          Length = 435

 Score =  885 bits (2286), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/427 (100%), Positives = 427/427 (100%)

Query: 1   MNRLPVSVPLARAGRAMFTGRWAAKVEACAKVMGSQMLNRSCRLVRDTSCSRCLSTMPAR 60
           MNRLPVSVPLARAGRAMFTGRWAAKVEACAKVMGSQMLNRSCRLVRDTSCSRCLSTMPAR
Sbjct: 1   MNRLPVSVPLARAGRAMFTGRWAAKVEACAKVMGSQMLNRSCRLVRDTSCSRCLSTMPAR 60

Query: 61  SAGGSLSQLSFEQLYQLRSNLEMLIQDYAKREIPRITYEFLTEYVPPLSDNERFMLSIKV 120
           SAGGSLSQLSFEQLYQLRSNLEMLIQDYAKREIPRITYEFLTEYVPPLSDNERFMLSIKV
Sbjct: 61  SAGGSLSQLSFEQLYQLRSNLEMLIQDYAKREIPRITYEFLTEYVPPLSDNERFMLSIKV 120

Query: 121 LNMLLTYTCRRLLALQRLPYIAVINPNIEESNRLYLKTLESLLAIELPYGLHDHAAMREK 180
           LNMLLTYTCRRLLALQRLPYIAVINPNIEESNRLYLKTLESLLAIELPYGLHDHAAMREK
Sbjct: 121 LNMLLTYTCRRLLALQRLPYIAVINPNIEESNRLYLKTLESLLAIELPYGLHDHAAMREK 180

Query: 181 LITFLDDHGDTLVTLSKGFEEIMDFYPQQKVFDFLNIHLRDRLSMKLLVTHYLRLVEQSS 240
           LITFLDDHGDTLVTLSKGFEEIMDFYPQQKVFDFLNIHLRDRLSMKLLVTHYLRLVEQSS
Sbjct: 181 LITFLDDHGDTLVTLSKGFEEIMDFYPQQKVFDFLNIHLRDRLSMKLLVTHYLRLVEQSS 240

Query: 241 GADCIGVLDKRLNIAELVKRTEEFVGDLTFVKYDRIVPVNILEGHDVTFACIPQDLEYVL 300
           GADCIGVLDKRLNIAELVKRTEEFVGDLTFVKYDRIVPVNILEGHDVTFACIPQDLEYVL
Sbjct: 241 GADCIGVLDKRLNIAELVKRTEEFVGDLTFVKYDRIVPVNILEGHDVTFACIPQDLEYVL 300

Query: 301 QEILKNSARAHIENHTPSNYSAEKPIEVTIVRSYEDLEIRIRDFGGGIPPDVEDRMFDYS 360
           QEILKNSARAHIENHTPSNYSAEKPIEVTIVRSYEDLEIRIRDFGGGIPPDVEDRMFDYS
Sbjct: 301 QEILKNSARAHIENHTPSNYSAEKPIEVTIVRSYEDLEIRIRDFGGGIPPDVEDRMFDYS 360

Query: 361 YTTSEKDAKDTGMSAYIIPGQDVSNVSGMGFGLPLCKAYVEMFNGELDIVSLWGWGTDVY 420
           YTTSEKDAKDTGMSAYIIPGQDVSNVSGMGFGLPLCKAYVEMFNGELDIVSLWGWGTDVY
Sbjct: 361 YTTSEKDAKDTGMSAYIIPGQDVSNVSGMGFGLPLCKAYVEMFNGELDIVSLWGWGTDVY 420

Query: 421 IRLKGPK 427
           IRLKGPK
Sbjct: 421 IRLKGPK 427

>Sklu_2174.2 YIL042C, Contig c2174 576-1817 reverse complement
          Length = 413

 Score =  542 bits (1397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/364 (71%), Positives = 306/364 (84%), Gaps = 2/364 (0%)

Query: 66  LSQLSFEQLYQLRSNLEMLIQDYAKREIPRITYEFLTEYVPPLSDNERFMLSIKVLNMLL 125
           LS L FEQLYQ+RS++E+LIQDYA + IP I+YE+L+ Y PPL+DNE+++L IK +N+LL
Sbjct: 45  LSGLGFEQLYQIRSSIELLIQDYANKPIPAISYEYLSMYKPPLTDNEKYVLVIKTVNLLL 104

Query: 126 TYTCRRLLALQRLP-YIAVINPNIEESNRLYLKTLESLLAIELPYGLHDHAAMREKLITF 184
            YTCRRL A+Q+L  YIAV+NPN+EESNRLYLKTLESLL+I+ PYGLHD  AM  KL  F
Sbjct: 105 AYTCRRLAAIQKLSXYIAVVNPNVEESNRLYLKTLESLLSIDFPYGLHDQEAMVTKLTKF 164

Query: 185 LDDHGDTLVTLSKGFEEIMDFYPQQKVFDFLNIHLRDRLSMKLLVTHYLRLVEQS-SGAD 243
           LDDH DTL+TLS+GFEE+M+FY Q+ VF+FLN HLRDR+SMKLLVTHYL LV+Q    + 
Sbjct: 165 LDDHQDTLITLSRGFEEVMEFYQQEAVFEFLNQHLRDRISMKLLVTHYLALVQQQDKNSP 224

Query: 244 CIGVLDKRLNIAELVKRTEEFVGDLTFVKYDRIVPVNILEGHDVTFACIPQDLEYVLQEI 303
            IGVL K L I+EL+ R EEFVGDL FVKYDR VPV IL G DVTF CIP DLEYVL EI
Sbjct: 225 AIGVLHKNLKISELIHRVEEFVGDLCFVKYDRQVPVKILYGADVTFPCIPTDLEYVLTEI 284

Query: 304 LKNSARAHIENHTPSNYSAEKPIEVTIVRSYEDLEIRIRDFGGGIPPDVEDRMFDYSYTT 363
           LKNS+RAHIEN T      EKPIEVTIVRS  DLEIRIRDFGGGIPP+VEDRMF+YSY+T
Sbjct: 285 LKNSSRAHIENSTKERDLTEKPIEVTIVRSDCDLEIRIRDFGGGIPPEVEDRMFEYSYST 344

Query: 364 SEKDAKDTGMSAYIIPGQDVSNVSGMGFGLPLCKAYVEMFNGELDIVSLWGWGTDVYIRL 423
            + + KDTGMSAY+IPG++V+NVSGMGFGLP+CKAY+EMF+G LDI SL+GWGTDVYI+L
Sbjct: 345 VQANTKDTGMSAYVIPGEEVNNVSGMGFGLPMCKAYLEMFDGSLDIQSLYGWGTDVYIKL 404

Query: 424 KGPK 427
           KGP+
Sbjct: 405 KGPE 408

>Kwal_47.18151
          Length = 414

 Score =  542 bits (1397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/362 (69%), Positives = 306/362 (84%), Gaps = 1/362 (0%)

Query: 66  LSQLSFEQLYQLRSNLEMLIQDYAKREIPRITYEFLTEYVPPLSDNERFMLSIKVLNMLL 125
           L ++ FE+LY++RSN E+LIQD+AK+ IP I+YEFLT+Y  PL+DNE++ML+I+ +N+LL
Sbjct: 47  LREVGFEELYRIRSNTELLIQDFAKKPIPAISYEFLTQYKVPLTDNEKYMLTIQTVNLLL 106

Query: 126 TYTCRRLLALQRLPYIAVINPNIEESNRLYLKTLESLLAIELPYGLHDHAAMREKLITFL 185
           TYTCRRL+A+Q+LPYIAV+NPNIEE+NRLYL+TLESLL++  PYGLHD   M +KL  FL
Sbjct: 107 TYTCRRLVAIQKLPYIAVLNPNIEETNRLYLRTLESLLSLNYPYGLHDQEVMAKKLTEFL 166

Query: 186 DDHGDTLVTLSKGFEEIMDFYPQQKVFDFLNIHLRDRLSMKLLVTHYLRLVEQSSGAD-C 244
           DDH DTL+TLS+GF+EIM+F+P++ VF+FLN HLRDR+SMKLL THYL +V Q+S  D  
Sbjct: 167 DDHQDTLLTLSRGFQEIMEFFPKESVFEFLNSHLRDRISMKLLATHYLAIVSQTSRDDRV 226

Query: 245 IGVLDKRLNIAELVKRTEEFVGDLTFVKYDRIVPVNILEGHDVTFACIPQDLEYVLQEIL 304
           IGVL + + I+ELV R EEFVGDL +VKYD+ VP+ ILEG DVTF CIP DLEYVL E+L
Sbjct: 227 IGVLHREMKISELVCRVEEFVGDLCYVKYDQQVPIKILEGEDVTFPCIPTDLEYVLTELL 286

Query: 305 KNSARAHIENHTPSNYSAEKPIEVTIVRSYEDLEIRIRDFGGGIPPDVEDRMFDYSYTTS 364
           KNS+RAHIE  T  N +AEKP+EVTIVR   DL+IRIRDFGGGIPP VEDRMFDYSY+T 
Sbjct: 287 KNSSRAHIEGSTSDNNTAEKPVEVTIVRKDNDLKIRIRDFGGGIPPVVEDRMFDYSYSTV 346

Query: 365 EKDAKDTGMSAYIIPGQDVSNVSGMGFGLPLCKAYVEMFNGELDIVSLWGWGTDVYIRLK 424
             DAKD+GMSAY+IPG DV NVSGMGFGLP+CKAY+EMFNG LDI SLWGWGTD YI LK
Sbjct: 347 NTDAKDSGMSAYVIPGADVCNVSGMGFGLPMCKAYMEMFNGTLDIQSLWGWGTDAYIYLK 406

Query: 425 GP 426
           GP
Sbjct: 407 GP 408

>CAGL0L00869g complement(105236..106495) similar to sp|P40530
           Saccharomyces cerevisiae YIL042c, hypothetical start
          Length = 419

 Score =  470 bits (1210), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 225/367 (61%), Positives = 286/367 (77%), Gaps = 6/367 (1%)

Query: 66  LSQLSFEQLYQLRSNLEMLIQDYAKREIPRITYEFLTEYVPPLSDNERFMLSIKVLNMLL 125
           L  L F++ Y++RSN+E+LIQ+YA + IP +TY++LT Y PPLS NE +ML+IK +N+LL
Sbjct: 42  LKHLEFDKHYKIRSNIELLIQEYASKPIPPLTYDYLTHYKPPLSANEEYMLTIKTINLLL 101

Query: 126 TYTCRRLLALQRLPYIAVINPNIEESNRLYLKTLESLLAIELPYGLHDHAAMREKLITFL 185
           +YTCRRL A+Q+LPY+A +NP+IE+S  LYLKTLESLL+IE PY LHD   +   LI FL
Sbjct: 102 SYTCRRLNAIQKLPYVAAVNPSIEKSYSLYLKTLESLLSIEFPYALHDKDIIHGLLIEFL 161

Query: 186 DDHGDTLVTLSKGFEEIMDFYPQQKVFDFLNIHLRDRLSMKLLVTHYLRLVEQSSGAD-- 243
           DDH DT+ TLS+G EEIMDF  +  +F FL+ HLRDR++MK+L T++L +   +  +D  
Sbjct: 162 DDHQDTVETLSRGLEEIMDFLEKDTIFKFLDEHLRDRIAMKILATNHLAVSNHNRDSDPN 221

Query: 244 CIGVLDKRLNIAELVKRTEEFVGDLTFVKYDRIV-PVNILEGHDVTFACIPQDLEYVLQE 302
            IG + K L +A++VK+  EFV DL FVKYD++V PV I  GHDVTF CIP  LEYVL E
Sbjct: 222 MIGTIHKALPVADMVKKVSEFVSDLCFVKYDQLVAPVKIYGGHDVTFPCIPTILEYVLTE 281

Query: 303 ILKNSARAHIENHTPSNYSAEKPIEVTIVRSY---EDLEIRIRDFGGGIPPDVEDRMFDY 359
           ILKNS RAHIEN T  N   EKP+EV IV+     E+LEIRIRDFGGGIPP+VE  +F+Y
Sbjct: 282 ILKNSYRAHIENTTSHNCLVEKPVEVQIVKDEKYDEELEIRIRDFGGGIPPNVESHIFEY 341

Query: 360 SYTTSEKDAKDTGMSAYIIPGQDVSNVSGMGFGLPLCKAYVEMFNGELDIVSLWGWGTDV 419
           SYTT E D K++G SAY+IPG+D++ VSGMGFGLP+CKAY+EMF+G+LDI SLWGWGTDV
Sbjct: 342 SYTTVESDKKESGASAYVIPGEDINIVSGMGFGLPMCKAYIEMFDGKLDIQSLWGWGTDV 401

Query: 420 YIRLKGP 426
           YI+LKGP
Sbjct: 402 YIKLKGP 408

>KLLA0E04455g 408415..409680 similar to sp|P40530 Saccharomyces
           cerevisiae YIL042c, hypothetical start
          Length = 421

 Score =  459 bits (1181), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 226/379 (59%), Positives = 294/379 (77%), Gaps = 6/379 (1%)

Query: 48  TSCSRCLSTMPARSAGGSLSQLSFEQLYQLRSNLEMLIQDYAKREIPRITYEFLTEYVPP 107
           +S +R       R     +++L+F++LY +RSN++ LIQDY+  EIP+I + FL +Y  P
Sbjct: 42  SSHNRLHRRNNHRKRSKEMTELNFQELYHIRSNIQHLIQDYSSYEIPKIDWAFLLQYRGP 101

Query: 108 LSDNERFMLSIKVLNMLLTYTCRRLLALQRLPYIAVINPNIEESNRLYLKTLESLLAIEL 167
           L DNE++ L+IK LN+LLT TC RL +LQ LPYIA++NPNIE+SNRLYLKTLESLL+IE 
Sbjct: 102 LQDNEKYFLTIKTLNLLLTLTCHRLASLQELPYIALVNPNIEQSNRLYLKTLESLLSIEY 161

Query: 168 PYGLHDHAAMREKLITFLDDHGDTLVTLSKGFEEIMDFYPQQKVFDFLNIHLRDRLSMKL 227
           PY L+D   ++     FL+DH DTL+TLS G +E+  FY  + +F FLN HL DR+ MKL
Sbjct: 162 PYDLYDTDKIQNLTEEFLNDHQDTLLTLSNGLQEVSRFYDPENIFKFLNKHLHDRILMKL 221

Query: 228 LVTHYLRLVEQSSGADCIGVLDKRLNIAELVKRTEEFVGDLTFVKYDRIVPVNILEGHDV 287
           L T+YL+L+EQ+S  + IGV+ K L+I++LV RT EFV DLTF+KYD+ VPV I+EG DV
Sbjct: 222 LTTNYLKLLEQTSSDEVIGVIHKDLHISDLVTRTNEFVNDLTFIKYDKTVPVKIMEGSDV 281

Query: 288 TFACIPQDLEYVLQEILKNSARAHIENHTPSNYSAEKPIEVTIVRSYEDLEIRIRDFGGG 347
            F+ IP DLEYVLQE+LKNS+RAHIEN      + +K +EVTIV++ + LEIRIRDFGGG
Sbjct: 282 KFSYIPTDLEYVLQELLKNSSRAHIEN------NVDKDVEVTIVKNDDQLEIRIRDFGGG 335

Query: 348 IPPDVEDRMFDYSYTTSEKDAKDTGMSAYIIPGQDVSNVSGMGFGLPLCKAYVEMFNGEL 407
           I P VEDR+FDYS++T+ K+ KD+GMS Y++PGQ+V NV+GMGFGLP+CKAY+E+FNG L
Sbjct: 336 IDPQVEDRVFDYSFSTTVKEEKDSGMSDYVLPGQEVQNVAGMGFGLPMCKAYLELFNGTL 395

Query: 408 DIVSLWGWGTDVYIRLKGP 426
           DI SLWGWGTDVYIRL GP
Sbjct: 396 DIQSLWGWGTDVYIRLHGP 414

>YIL042C (YIL042C) [2625] chr9 complement(275107..276291) Protein
           with similarity to mitochondrial branched chain
           alpha-ketoacid and pyruvate dehydrogenase protein
           kinases [1185 bp, 394 aa]
          Length = 394

 Score =  371 bits (952), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 184/390 (47%), Positives = 266/390 (68%), Gaps = 13/390 (3%)

Query: 43  RLVRDTSCSRCLSTMPARSAGGSLSQLSFEQLYQLRSNLEMLIQDYAKREIPRITYEFLT 102
           +++R   C         R +   LSQLSF+Q Y++RSN+E+LIQDYA + I  + YE+  
Sbjct: 3   KIMRSWKCGGMRWAHRQRPSHELLSQLSFDQHYKIRSNIELLIQDYASKPIAPLNYEYFL 62

Query: 103 EYVPPLSDNERFMLSIKVLNMLLTYTCRRLLALQRLPYIAVINPNIEESNRLYLKTLESL 162
           +Y PPL+  E +ML+IK +N+LL+ TC+RL A+QRLPY AVINP+IE +N LYLK+L++L
Sbjct: 63  QYRPPLTKKEEYMLTIKTINLLLSLTCKRLNAIQRLPYNAVINPHIERTNSLYLKSLQTL 122

Query: 163 LAIELPYGLHDHAAMREKLITFLDDHGDTLVTLSKGFEEIMDFYPQQKVFDFLNIHLRDR 222
           L+I  PY LH+   ++ K    LDDH D +V L+KG +EI   YP+ ++  FLN HL++R
Sbjct: 123 LSIAYPYELHNPPKIQAKFTELLDDHEDAIVVLAKGLQEIQSCYPKFQISQFLNFHLKER 182

Query: 223 LSMKLLVTHYLRLVEQSSG---ADCIGVLDKRLNIAELVKRTEEFVGDLTFVKYD-RIVP 278
           ++MKLLVTHYL L+ Q+ G      IG+L + L IA+L+K   ++V D+ FVK++ +  P
Sbjct: 183 ITMKLLVTHYLSLMAQNKGDTNKRMIGILHRDLPIAQLIKHVSDYVNDICFVKFNTQRTP 242

Query: 279 VNIL-EGHDVTFACIPQDLEYVLQEILKNSARAHIENHTPSNYSAEKPIEVTIVRSYED- 336
           V I     D+TF CIP  LEY++ E+ KN+  A I     +      PIE+ +++  +D 
Sbjct: 243 VLIHPPSQDITFTCIPPILEYIMTEVFKNAFEAQI-----ALGKEHMPIEINLLKPDDDE 297

Query: 337 LEIRIRDFGGGIPPDVEDRMFDYSYTTSEKDAKDTGMSAYIIPGQDVSNVSGMGFGLPLC 396
           L +RIRD GGGI P+VE  MF+YSY+T  + + D+  +   +PG+ ++NVSGMGFGLP+C
Sbjct: 298 LYLRIRDHGGGITPEVEALMFNYSYSTHTQQSADSESTD--LPGEQINNVSGMGFGLPMC 355

Query: 397 KAYVEMFNGELDIVSLWGWGTDVYIRLKGP 426
           K Y+E+F G++D+ SL GWGTDVYI+LKGP
Sbjct: 356 KTYLELFGGKIDVQSLLGWGTDVYIKLKGP 385

>Scas_704.44
          Length = 443

 Score =  328 bits (840), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 168/398 (42%), Positives = 257/398 (64%), Gaps = 39/398 (9%)

Query: 62  AGGSLSQLSFEQLYQLRSNLEMLIQDYAKREIPRITYEFLTEYVPPLSDNERFMLSIKVL 121
           A  +LS L F+  Y++RSN+E+LIQDY+++ IP ++Y+FLTEY  PLS  E++ L+IK +
Sbjct: 43  AAINLSHLDFQAYYKIRSNIELLIQDYSRKPIPPLSYKFLTEYQKPLSQTEKYNLAIKTI 102

Query: 122 NMLLTYTCRRLLALQRLPYIAVINPNIEESNRLYLKTLESLLAIELPYGLHDHAAMREKL 181
           N L++ TCR+L  +Q LPYI ++NP I + N LYLKTLESLL+I  PY L+ +  +   L
Sbjct: 103 NQLISLTCRQLSLIQNLPYIVLLNPKINQINSLYLKTLESLLSITFPYDLYKNDLILSLL 162

Query: 182 ITFLDDHGDTLVTLSKGFEEIMD-FYPQQKVFDFLNIHLRDRLSMKLLVTHYLRLVEQSS 240
               ++H DTL+ LS G +EI +     + +  FL++H+RDR++MKL++ ++L L+   +
Sbjct: 163 NHLNEEHNDTLLVLSDGLKEINNELLSNEAISKFLDVHIRDRITMKLIILNHLALLSPKT 222

Query: 241 GADCIGVLDKRLNIAELVKRTEEFVGDLTFVKYDRIVP-------VNILEGHDVTFACIP 293
             D IG++ KR+ I++ + +T EFV DL  +K++  +        +  + G ++ F CIP
Sbjct: 223 EPDMIGIIHKRVKISQFINQTFEFVNDLCQLKFNLPMSTTGNSSMITYITGEEIEFPCIP 282

Query: 294 QDLEYVLQEILKNSARAHIENHTPSNYSAEKPIEVTIVRSYED-LEIRIRDFGGGIPPDV 352
             LEYVL EILKNS +AHIEN         KPIE++I  +  D L +RIRD+GGGI P +
Sbjct: 283 VILEYVLTEILKNSMKAHIEN------DVTKPIEISIFETDSDELTVRIRDYGGGIDPKI 336

Query: 353 EDRMFDYSYTTS-----------------EKDA------KDTGMSAYIIPGQDVSN-VSG 388
           E ++F YS++T+                 E D+       D+ +   ++PG+  +N +SG
Sbjct: 337 EPKIFQYSFSTTLDSTFSKIHEENNGNQRETDSVIGSCQNDSSVPQLMMPGEVENNTISG 396

Query: 389 MGFGLPLCKAYVEMFNGELDIVSLWGWGTDVYIRLKGP 426
           MG+GLPLCK Y+E+F+G++ I +LWG GTDVYI++KGP
Sbjct: 397 MGYGLPLCKNYLELFDGDITIQNLWGLGTDVYIKVKGP 434

>Sklu_2299.6 YGL059W, Contig c2299 10909-12501 reverse complement
          Length = 530

 Score = 89.7 bits (221), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 109/451 (24%), Positives = 177/451 (39%), Gaps = 93/451 (20%)

Query: 51  SRCLSTMPARSAGGSLSQLSFEQLYQLRSNLEMLIQDYAKREIPRITYEFLTEYVPPLSD 110
           S  LS  P++S       ++ +  YQ   N  +L Q Y  +    ++ + L  Y     D
Sbjct: 80  STTLSAYPSKS-----RYVNMQHYYQ---NKNILWQKYLTKSPNPVSLKQLAMYY----D 127

Query: 111 NERFMLSIKVLNM-------LLTYTCRRLLALQRLPYIAVINPNIEESNRLYLKTLESLL 163
           +   +  +K++N        L     ++L  LQ LP+  V N +  +    Y    E   
Sbjct: 128 DSNKLTKLKIINSGRFVKEELAIRIAQKLHLLQNLPFNVVNNFHFVQVYESYYNIFERFR 187

Query: 164 AIELPYGLHDHAAMREKLITFLDDHGD-TLVTLSKGFEE--IMDFYPQQKVFDFLNIHLR 220
                  + D+    E L   L D     L  L  G  E  I+D Y Q+++ + ++  LR
Sbjct: 188 KFPHIKNIEDNYKFAEFLYQILSDFNSLNLPHLIMGALECRILDLYKQEQMDELISTLLR 247

Query: 221 DRLSMKLLVTHYLRLVEQ-SSG--------ADCIGVLDKRLNIAELVKRTEEFVGDLTFV 271
            R+S +L+V  +L +    +SG         D       R  + E  +  E F+ D+ F 
Sbjct: 248 ARISRRLIVEEHLSITSNFASGKKENTLVLGDIFQECCARDYLLEASQMCEAFIKDMFF- 306

Query: 272 KYDRI-VPVNILEGH-DVTFACIPQDLEYVLQEILKNSARAHIENHTPSNYSAEKPIEVT 329
             D I +P  +++G  D+ F  +P  L+Y+L E L+NS  A ++ +         PI VT
Sbjct: 307 --DGIPLPKFVIDGDTDLKFYFLPSHLKYLLGETLRNSYEATVKEYIRLGLDNPHPITVT 364

Query: 330 IVRSYEDLEIRIRDFGGGIPPDVED---------------------------RMFDYSYT 362
           I+ +      RI D GGGIP D +                             ++DY Y 
Sbjct: 365 IISNNHSFLFRISDRGGGIPHDDKTIWSFGKSKKLAKESLDNFHKLPGLQTVSLYDYMYQ 424

Query: 363 -----------TSEKDAKDTGMSAYIIPGQDVSNVSGM-------------------GFG 392
                      TS+ D         + P  D +   G+                   G G
Sbjct: 425 GIHDGKISQRITSKDDLNQPYRYTSLEPMSDTNLHKGLYKLEKPLLGLLERSSRYKLGIG 484

Query: 393 LPLCKAYVEMFNGELDIVSLWGWGTDVYIRL 423
           L +CK Y E +NG+L + S+ G+GTD  ++L
Sbjct: 485 LAVCKVYAEYWNGDLTVHSIHGYGTDTVLKL 515

>AER270W [2772] [Homologous to NOHBY] complement(1131292..1132761)
           [1470 bp, 489 aa]
          Length = 489

 Score = 87.8 bits (216), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 70/277 (25%), Positives = 131/277 (47%), Gaps = 44/277 (15%)

Query: 188 HGDTLVTLSKGFEEIMDFYPQQK-------VFDFLNIHLRDRLSMKLLVTHYLRLVEQS- 239
           H  T+VTL++G   ++ +   QK       +  +L+     R+ +++L+  +L L+EQ+ 
Sbjct: 205 HDATVVTLARG---LLRWKRTQKNNVVDASIKGYLDRFYMGRIGIRMLIGQHLSLLEQAM 261

Query: 240 --------------SGADCIGVLDKRLNIAELVKRTEEFVGDLTFVKYD---------RI 276
                         S AD +G++  R  +A++     +    +    Y+           
Sbjct: 262 HSDLACEHVPGAVGSDADYVGIVCTRTKVAQVADIAIDRARHICAEYYNLYEAPKVELHT 321

Query: 277 VPVNILEG---HDVTFACIPQDLEYVLQEILKNSARAHIE-----NHTPSNYSAEK--PI 326
           +P+   +     ++ F  +P  L ++L E+LKN+ RA +E     N   ++Y + +  P+
Sbjct: 322 IPIKRDDSSGLREIEFTYVPSHLVHMLFEVLKNALRATVESTIQKNPGVTDYDSLRFPPV 381

Query: 327 EVTIVRSYEDLEIRIRDFGGGIPPDVEDRMFDYSYTTSEKDAKDTGMSAYIIPGQDVSNV 386
           +V I    E+L ++I D GGGI       ++ Y YTT   D +D+ +            +
Sbjct: 382 KVIISEGTEELAVKISDEGGGIARSNLPLVWTYLYTTMTDDEQDSLIDGDSTLSGSCPPM 441

Query: 387 SGMGFGLPLCKAYVEMFNGELDIVSLWGWGTDVYIRL 423
           +G G+GL L + Y   F G+L ++S+ G+GTDVY+ L
Sbjct: 442 AGYGYGLALSRLYARHFGGDLRLLSMDGYGTDVYLHL 478

>KLLA0F27423g complement(2537353..2538891) similar to
           ca|CA5524|IPF2861 Candida albicans putative pyruvate
           dehydrogenase kinase, hypothetical start
          Length = 512

 Score = 85.9 bits (211), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 78/281 (27%), Positives = 126/281 (44%), Gaps = 51/281 (18%)

Query: 188 HGDTLVTLSKGFEEIMDFYPQQKVFD----FLNIHLRDRLSMKLLVTHYLRLVEQS---- 239
           H  T++TL+KG  +    + Q  V D    FL+     R+ +++L+   L L+E +    
Sbjct: 227 HDATVITLAKGVLKWKKTHQQNVVDDSIQSFLDRFYLSRIGIRMLIGQQLALLESARQPA 286

Query: 240 ------SGADCIGVLDKRLNIAELVKRTEEFVGDLTFVKYD--RIVPVNIL--------- 282
                    D +G++  + NI +L K   +    +    Y       V +L         
Sbjct: 287 EGPFDEDDEDWVGIICTKTNITQLSKTAIDNARHICAEHYGLYEAPKVQLLTFPLDYRPS 346

Query: 283 ---------EGHDVTFACIPQDLEYVLQEILKNSARAHIENHTPSNYSAEK------PIE 327
                    E  D+ F  +P  L ++L E LKN+ RA +E     N S +K       ++
Sbjct: 347 TEEKSGCPNESPDIEFMYVPGHLIHMLFETLKNALRATVEKTIEKNPSVDKYDLKFPDVK 406

Query: 328 VTIVRSYEDLEIRIRDFGGGIPPDVEDRMFDYSYTTSEKDAK----DTGMSA-YIIPGQD 382
           V I    EDL ++I D GGGI       ++ Y YTT  ++ +    D  MS  + IP   
Sbjct: 407 VIITEGTEDLTVKISDEGGGIARSNLPLVWTYLYTTMPENEQIGLMDEEMSQNFRIP--- 463

Query: 383 VSNVSGMGFGLPLCKAYVEMFNGELDIVSLWGWGTDVYIRL 423
              ++G G+GL L + Y   F G+L ++S+ G+GTDVY+ L
Sbjct: 464 ---MAGYGYGLALSRLYARYFGGDLKLMSMEGFGTDVYLHL 501

>Kwal_14.1825
          Length = 492

 Score = 85.5 bits (210), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 108/443 (24%), Positives = 183/443 (41%), Gaps = 87/443 (19%)

Query: 51  SRCLSTMPARSAGGSLSQLSFEQLYQLRSNLEMLIQDYAKREIPRITYEFLTEYVPPLSD 110
           SR L   P +S       ++ +  YQ   N  +L + Y  ++   ++   L +Y     D
Sbjct: 52  SRTLCAYPVQSK-----YVNQQHYYQ---NQNILEKHYLTKKPHPVSLSQLAQYF----D 99

Query: 111 NERFMLSIKVLNM-------LLTYTCRRLLALQRLPYIAVINPNIEESNRLYLKTLESLL 163
           +   +   K++N        L+T    ++  LQ LP+  V N +  +    Y    E   
Sbjct: 100 DSTALTKQKIVNSGNFVKDELVTRIAHKIHLLQTLPFNVVNNFHFSQVYESYYNIFERFR 159

Query: 164 AIELPYGLHDHAAMREKLITFLDDHGD-TLVTLSKGFEE--IMDFYPQQKVFDFLNIHLR 220
                  L D+    + L T L D     L  L  G  E  I+D  P +K+ + ++  LR
Sbjct: 160 RYPSIKTLEDNERFAKFLHTILSDFNSLNLPHLIMGALECRILDLCPPEKMDEVISSLLR 219

Query: 221 DRLSMKLLVTHYLRLVEQ-SSGAD----CIGVLDKRLNIAELV----KRTEEFVGDLTFV 271
            R+S +L+V  +L +     SG       +G + +  +  E +       E+F+ D+ +V
Sbjct: 220 ARISRRLIVEEHLSITSNYHSGKKENTLVLGDIFQECSAREFLLGAKSMCEKFIQDMYYV 279

Query: 272 KYDRIVPVNILEGH-DVTFACIPQDLEYVLQEILKNSARAHIENHTPSNYSAEKPIEVTI 330
                +P  I++G  D+ F  +P  L+Y+L E+L+NS  A ++ +        +PI VT+
Sbjct: 280 GIK--LPEFIIDGKTDLKFYFLPLHLKYLLGEVLRNSYEATMQEYIRLGLKDPEPITVTV 337

Query: 331 VRSYEDLEIRIRDFGGGIPPDVEDRMFDYSYTTSEKDAKDTGMSAYIIPG-QDVS----- 384
           V +      RI D  GGIP    D    +S+  S++ A+ +  + + +PG Q VS     
Sbjct: 338 VSNESSFIFRISDRAGGIP---HDEKTIWSFGKSKELARKSLSNFHKLPGLQTVSLYDHV 394

Query: 385 ---------------------NVSG-----------------------MGFGLPLCKAYV 400
                                N S                        +G GL +CK Y 
Sbjct: 395 TDHHPGHSSTFPYKFTSLEPINASNLPTGLHKFEKPLLGLLERSSRYKLGIGLAMCKVYA 454

Query: 401 EMFNGELDIVSLWGWGTDVYIRL 423
           E +NG+L + SL G+GTD  ++L
Sbjct: 455 EYWNGDLTVHSLQGYGTDTVLKL 477

>AAR157C [345] [Homologous to ScYGL059W - SH] (627130..628641) [1512
           bp, 503 aa]
          Length = 503

 Score = 79.3 bits (194), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 100/417 (23%), Positives = 161/417 (38%), Gaps = 82/417 (19%)

Query: 80  NLEMLIQDYAKREIPRITYEFLTEYVPPLSDNERFMLSIKVLNM-------LLTYTCRRL 132
           N ++L++ Y +R+   ++ + L +Y     D+   +   KV+         L      +L
Sbjct: 81  NRKVLVERYLQRQPHAVSLKHLAQYY----DDSNRLTKQKVIRSGQFAKEELTVRMAHKL 136

Query: 133 LALQRLPYIAVINPNIEESNRLYLKTLESLLAIELPYGLHDHAAMREKLITFLDDHGD-T 191
             LQ LP+  V N +  +    Y    E          L D+    E L   + D     
Sbjct: 137 RELQDLPFNVVNNFHFVQVYESYYNIFERFRRFPAIRTLEDNERFAELLHQIMSDFNSLN 196

Query: 192 LVTLSKGFEE--IMDFYPQQKVFDFLNIHLRDRLSMKLLVTHYLRLVEQS-SG------- 241
           L  L  G  E  I+D YPQ  +   ++  LR R+S +L+V  +L +     SG       
Sbjct: 197 LPHLIMGALESCILDLYPQDAMDRLMSSFLRARISRRLIVEEHLSVTSNYMSGKSENTLV 256

Query: 242 -ADCIGVLDKRLNIAELVKRTEEFVGDLTFVKYDRIVPVNILEG-HDVTFACIPQDLEYV 299
             D       R  +    +  E  + D+ +   D  +P  I++G  D+ F  +P  L Y+
Sbjct: 257 LGDIFQECSAREYLLHAARICENAIRDMFYP--DIPLPDFIIDGCADLRFYFLPSQLHYL 314

Query: 300 LQEILKNSARAHIENHTPSNYSAEKPIEVTIVRSYEDLEIRIRDFGGGIPPDVEDRMFDY 359
             E L+NS  A ++           PI VT+V++ E    RI D GGGIP    DR   +
Sbjct: 315 FGETLRNSYEATVKEAIRRGLPKPDPITVTVVQNPESYLFRISDRGGGIPH--PDRTI-W 371

Query: 360 SYTTSEKDAKDTGMSAYIIPGQD---------------------VSNVS----------- 387
           S+  S+  A+    + + +PG                       +SN S           
Sbjct: 372 SFGKSKLLAQQALDNFHKLPGAQTVSLYDHMYDADARRVAAACKLSNTSLQSMAETNLTK 431

Query: 388 ---------------------GMGFGLPLCKAYVEMFNGELDIVSLWGWGTDVYIRL 423
                                 +G GL +CK Y E +NG+L + S+ G GTD  ++L
Sbjct: 432 GRYKFDFPRPLVGLLERPFRYKLGIGLAMCKVYAEYWNGDLTVHSIHGHGTDTVLKL 488

>KLLA0C05654g complement(504568..505989) similar to sp|P53170
           Saccharomyces cerevisiae YGL059w, start by similarity
          Length = 473

 Score = 78.2 bits (191), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 94/416 (22%), Positives = 169/416 (40%), Gaps = 76/416 (18%)

Query: 75  YQLRSNLEMLIQDYAKREIPRITYEFLTEYVPPLSDNERFMLSIKVLNM-------LLTY 127
           Y    N  +L++ Y +++   ++ + L +Y     D+   +  +K+++        L   
Sbjct: 52  YHYYHNDNVLVKKYLQKKPHPMSLKQLAQYY----DDSSKLTKMKIISSGKFVKEELCVR 107

Query: 128 TCRRLLALQRLPYIAVINPNIEESNRLYLKTLESLLAIELPYGLHDHAAMREKLITFLDD 187
              +L  LQ LP+  V N +  +    Y    E            D+    + L   L D
Sbjct: 108 IAHKLDLLQNLPFDVVNNFHFNQVYESYYNIFERFRKFPEIKDEKDNLKFCQFLHAILSD 167

Query: 188 HGD-TLVTLSKGFEE--IMDFYPQQKVFDFLNIHLRDRLSMKLLVTHYLRLVE-----QS 239
                L  L  G  E  I+D YPQ K+   ++  LR R+S +L+V  +L +       + 
Sbjct: 168 FNSLNLPHLIMGALECRILDLYPQDKMDALISDLLRARISRRLIVEEHLSITSNYLSGKK 227

Query: 240 SGADCIGVLDKRLNIAELVKRTEE----FVGDLTFVKYDRIVPVNILEGH-DVTFACIPQ 294
                +G + ++ N  E +    E    ++ ++ F      +P  I+ G  ++ F  +P 
Sbjct: 228 ENTLVLGDIFQKCNAKEYLNGAREVCEAYINNMYFAGIK--MPELIINGDTELEFYFLPS 285

Query: 295 DLEYVLQEILKNSARAHIENHTPSNYSAEKPIEVTIVRSYEDLEIRIRDFGGGIPPDVED 354
            L+++L EIL+NS    ++           P+ VTI+ + +    RI D GGG+P    D
Sbjct: 286 HLKFLLGEILRNSYEVTVKETIRLGLEKAPPVTVTIISNDQSYLFRISDRGGGVPH--SD 343

Query: 355 RMFDYSYTTSEKDAKDTGMSAYIIPG------QDVSNVS--------------------- 387
           +   +S+  S++ AK +  + + +PG       D SN +                     
Sbjct: 344 KQI-WSFGKSKELAKQSLDNFHHLPGLQTLSLYDSSNGAHLKSDRYRQTSLDRMSENNLT 402

Query: 388 --------------------GMGFGLPLCKAYVEMFNGELDIVSLWGWGTDVYIRL 423
                                +G GL LCK Y E +NG+L + S+ G+GTD  ++L
Sbjct: 403 KGKFKVGQPLMELLKRSPRYKLGIGLALCKVYAEYWNGDLTVHSIQGYGTDTVLKL 458

>YGL059W (YGL059W) [1920] chr7 (392226..393701) Protein with
           similarity to human branched-chain alpha-ketoacid
           dehydrogenase kinase, transcription is induced by the
           drug FK506 in a GCN4-dependent manner [1476 bp, 491 aa]
          Length = 491

 Score = 75.5 bits (184), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 84/326 (25%), Positives = 151/326 (46%), Gaps = 30/326 (9%)

Query: 80  NLEMLIQDYAKREIPRITYEFLTEYVPPLSDNERFMLSIKVLNM-------LLTYTCRRL 132
           N  +L+++Y KR    ++   L +Y     D+   +   K++N        L+     +L
Sbjct: 64  NRTVLVENYLKRSPNPVSLTQLAQYY----DDSTKLTRTKIINSGKFVKEELVIRIAHKL 119

Query: 133 LALQRLPYIAVINPNIEESNRLYLKTLESLLAIELPYGLHDHAAMREKLITFLDDHGD-T 191
             LQ+LP+  V N +  +    Y    ES         L D +   + +   L+      
Sbjct: 120 NQLQQLPFNVVNNFHFVQVYESYYNIFESFRKYPTIRTLEDASQFADFIKNMLEGFNTLN 179

Query: 192 LVTLSKGFEE--IMDFYPQQKVFDFLNIHLRDRLSMKLLVT-HYLRLVEQSSG------- 241
           L  L  G  E  I+D YP++K+   L+  LR R+S +L+V  H +     +SG       
Sbjct: 180 LPHLIMGALECTILDLYPREKMDQLLSDLLRARISRRLIVEEHVVYTANYTSGKEENTLV 239

Query: 242 -ADCIGVLDKRLNIAELVKRTEEFVGDLTFVKYDRIVPVNILEGH-DVTFACIPQDLEYV 299
             D       +  + E  + +++F+ D+ F   D  +P  I+EG   ++F  +P  L+Y+
Sbjct: 240 LGDIFQECSAKKYLLEASEESQKFIQDMYFK--DIPMPEFIIEGDTQLSFYFLPTHLKYL 297

Query: 300 LQEILKNSARAHIENHTPSNYSAEKPIEVTIVRSYEDLEIRIRDFGGGIPPDVEDRMFDY 359
           L EIL+N+  A ++++        +PI VT+V + E    RI D  GG+  D E+    +
Sbjct: 298 LGEILRNTYEATMKHYIRKGLEKPEPIIVTVVSNDESYLFRISDKAGGVLHDDENL---W 354

Query: 360 SYTTSEKDAKDTGMSAYIIPG-QDVS 384
           S+  S++ A+++  + + +PG Q VS
Sbjct: 355 SFGKSKERAQESLNNFHKLPGLQTVS 380

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 26/35 (74%)

Query: 389 MGFGLPLCKAYVEMFNGELDIVSLWGWGTDVYIRL 423
           +G GL +CK Y E +NG+L + S+ G+GTDV ++L
Sbjct: 442 LGIGLAMCKVYAEYWNGDLSLHSMPGYGTDVVLKL 476

>CAGL0F07007g 687174..688631 highly similar to sp|P53170
           Saccharomyces cerevisiae YGL059w, hypothetical start
          Length = 485

 Score = 74.7 bits (182), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 69/283 (24%), Positives = 122/283 (43%), Gaps = 66/283 (23%)

Query: 203 MDFYPQQKVFDFLNIHLRDRLSMKLLVTHYLRLVEQS-SG--------ADCIGVLDKRLN 253
           +D YP  K+   L+  LR R+S +L+V  ++ + +   SG         D       + +
Sbjct: 192 LDLYPTDKMDKLLSDLLRARISRRLIVEEHISIADNYFSGKKKNTLVLGDIFQECSAKEH 251

Query: 254 IAELVKRTEEFVGDLTFVKYDRIVPVNILEGH---DVTFACIPQDLEYVLQEILKNSARA 310
           I    K  E+F+ D+ F      +P+  L+ +   D+ F  +P  L+Y+L EIL+N+  A
Sbjct: 252 ILGASKICEKFIQDMYF----ESIPMPELKINGETDLKFYFLPSHLKYLLGEILRNTYEA 307

Query: 311 HIENHTPSNYSAEKPIEVTIVRSYEDLEIRIRDFGGGIPP-------------------- 350
            I+++        +PI +TI+++ E    RI D  GG+                      
Sbjct: 308 TIKDYIRKGLPKPEPIVITIIKNEESYLFRICDRAGGLAHHHDDNNIWSFGKTKEQAAQS 367

Query: 351 ---------------------DVEDRMFDYSY-TTSEKDAKDTGMSAYIIPGQDV----- 383
                                + EDR  + +Y  TS +    + +++ +  G +V     
Sbjct: 368 ISNFHKLPGLQTVSLYDHLYNNTEDRQVNRAYINTSLEPMAHSNIASAVATGYEVPLLKL 427

Query: 384 ---SNVSGMGFGLPLCKAYVEMFNGELDIVSLWGWGTDVYIRL 423
              S    +G GL +CK Y E +NG+L + S+ G+GTD  ++L
Sbjct: 428 LKRSFRYKLGIGLAMCKVYAEYWNGDLTLHSIHGFGTDTVLKL 470

>Scas_563.9
          Length = 492

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 100/420 (23%), Positives = 166/420 (39%), Gaps = 85/420 (20%)

Query: 80  NLEMLIQDYAKREIPRITYEFLTEYVPPLSDNERFMLSIKVLNM-------LLTYTCRRL 132
           N  +LI DY K+    ++   L +Y     D+   +   K++N        L      ++
Sbjct: 67  NKTVLIDDYLKKSPHPMSLAQLAQYY----DDSTTLTKHKIINSGRFVKEELAIRMAHKI 122

Query: 133 LALQRLPYIAVINPNIEESNRLYLKTLESLLAIELPYGLHDHAAMREKLITFLDDHGD-T 191
             LQ+LP+  V N +  +    Y    E          + D++   E     L D     
Sbjct: 123 YQLQQLPFNVVNNFHFVQVYESYYNIFERFRKFPRIKTIEDNSRFVEFTRRILQDFNSLN 182

Query: 192 LVTLSKGFEE--IMDFYPQQKVFDFLNIHLRDRLSMKLLVTHYLRLVEQ--SSGADCIGV 247
           L  L  G  E  I++  P+ ++   L+  LR R+S +L+V  +L +     S   +   V
Sbjct: 183 LPHLVMGALECNILELLPRDEIDALLSSLLRARISRRLIVEEHLSISANYLSGKKENTLV 242

Query: 248 LDKRLN-------IAELVKRTEEFVGDLTFVKYDRIVPVNILEGH-DVTFACIPQDLEYV 299
           L              E  +  E+FV  + F   D  +P  I+EG  D+TF  +P  L+Y+
Sbjct: 243 LGDIFQECQALDYFMEASRTCEKFVKAMYFD--DIPIPELIIEGQKDLTFYFLPTHLQYI 300

Query: 300 LQEILKNSARAHIENHTPSNYSAEKPIEVTIVRSYEDLEIRIRDFGGGIPPDVEDRMFDY 359
           L EIL+N   A I+++     +  +PI +TIV++      R  D  GGI    ED    +
Sbjct: 301 LGEILRNIYEATIKDYIRKGLAKPEPIVITIVKNDSSFIFRFSDKAGGILHHEEDI---W 357

Query: 360 SYTTSEKDAKDTGMSAYIIPG-QDVS---------------------------NVSGMG- 390
           S+  S++ A ++  + + +PG Q VS                           ++  MG 
Sbjct: 358 SFGKSKERAAESLNNFHKLPGLQTVSLYDHLYNGEEHDMNTRTLMANRPYMHTSLEAMGH 417

Query: 391 ---------------------------FGLPLCKAYVEMFNGELDIVSLWGWGTDVYIRL 423
                                       GL +CK Y E +NG+L + ++ G GTD  + L
Sbjct: 418 SNLKKGPYKFEMPLIEMLERAPRYKLGIGLAMCKIYAEYWNGDLSLTTIPGHGTDTVLTL 477

>Scas_698.14
          Length = 1183

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 43/93 (46%), Gaps = 18/93 (19%)

Query: 326 IEVTIVRSYEDLEIRIRDFGGGIPPDVEDRMFDYSYTTSEKDAKDTGMSAYIIPGQDVS- 384
           IE+T  +++  + I ++D G GI P ++  +F+                 ++   Q +S 
Sbjct: 829 IELTNPKTWV-IAIEVQDTGPGIDPSLQKSVFE----------------PFVQGDQTLSR 871

Query: 385 NVSGMGFGLPLCKAYVEMFNGELDIVSLWGWGT 417
              G G GL +C+    M NG +++ S  G G+
Sbjct: 872 QYGGTGLGLSICRQLANMMNGTMELKSEVGVGS 904

>CAGL0I10406g complement(1019334..1020107) highly similar to
           sp|P23638 Saccharomyces cerevisiae YGR135w proteasome
           subunit Y13, start by similarity
          Length = 257

 Score = 32.7 bits (73), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 38/80 (47%), Gaps = 8/80 (10%)

Query: 302 EILKNSARAHIENHTPSNYSAEKPIEVTIVRSYEDLEIRIRDFGGGIPPDVE------DR 355
           EIL N+AR H +N+  + Y+ E P+E+ +VR   D++     +GG  P  V       D 
Sbjct: 85  EILINTARIHAQNYLKT-YNEEIPVEM-LVRKLSDIKQGYTQYGGLRPYGVSFIYAGYDD 142

Query: 356 MFDYSYTTSEKDAKDTGMSA 375
            + Y   TS      TG  A
Sbjct: 143 RYGYQLYTSNPSGNYTGWKA 162

>CAGL0K07920g complement(786086..787513) weakly similar to tr|Q06822
           Saccharomyces cerevisiae YPR085c, hypothetical start
          Length = 475

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 44/97 (45%), Gaps = 15/97 (15%)

Query: 225 MKLLVTHYLRLVEQSSGADCIGVLDKRLNIAELVKRTEEFVGDLTF-------------V 271
           M+   TH+LRL +    A C GV+D    I   V  + +  G++T              +
Sbjct: 1   MERAATHFLRLHKSGISALCSGVIDPDYGITSPVLFSGDIDGEVTIWNLITRRPIFTSKI 60

Query: 272 KYDRIVPVNILEGHDVTFACIPQDLEYVLQEILKNSA 308
             +++V +  LEG  ++  C  +D +  L E+LK  A
Sbjct: 61  CNEQVVDIQFLEGKYLSLLC--KDHKLRLYELLKLGA 95

>KLLA0A00638g complement(60378..63845) gi|5531277|emb|CAB50891.1
           Kluyveromyces lactis SLN1 homologue, start by similarity
          Length = 1155

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/82 (21%), Positives = 35/82 (42%), Gaps = 17/82 (20%)

Query: 337 LEIRIRDFGGGIPPDVEDRMFDYSYTTSEKDAKDTGMSAYIIPGQDVS-NVSGMGFGLPL 395
           + + + D G GI P +++ +F+                 ++   Q +S    G G GL +
Sbjct: 849 ISMEVEDTGSGIDPSLQESVFE----------------PFVQGDQTLSRQYGGTGLGLSI 892

Query: 396 CKAYVEMFNGELDIVSLWGWGT 417
           C+   +M  G + + S  G G+
Sbjct: 893 CRQLAKMMKGTMKLDSKVGVGS 914

>Scas_582.12
          Length = 216

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 61/155 (39%), Gaps = 18/155 (11%)

Query: 211 VFDFLNIHLRDRLSMKLLVTHYLRLVE--------QSSGADCIGVLDKRLNIAELVKRTE 262
           +F FLN   R R         YLRL          ++   D I  L  R +I  L  R  
Sbjct: 45  LFPFLNTTSRQR------TFEYLRLTSLGVIGALVKNDSQDVINFL-LRTDIVPLCLRIM 97

Query: 263 EFVGDLTFVKYDRIVPVNILEGHDVTFACIPQDLEYVLQEILKNSARAHIENHTPSNYSA 322
           E   +L+      I+   +L+   + + C  +D  Y +  +LKN    H+  HTP     
Sbjct: 98  ESSSELSKTVAIFILQKILLDDMGLQYICATKDRFYAITSVLKNMV-DHLTIHTPPGRLL 156

Query: 323 EKPIEVTIVRSYEDLEIRIRDFGGGIPPDVEDRMF 357
           +  I   + R  +DLE R +     +P  + D  F
Sbjct: 157 KHIIRCYL-RLSDDLEAR-KLLNVVLPESLRDNTF 189

>YIL147C (SLN1) [2530] chr9 complement(69791..73453) Two-component
           signal transducer involved in the osmotic stress signal
           transduction pathway that initiates a phosphorelay from
           Sln1p to Ypd1p to the response regulators Ssk1p and
           Skn7p [3663 bp, 1220 aa]
          Length = 1220

 Score = 30.8 bits (68), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/88 (22%), Positives = 35/88 (39%), Gaps = 17/88 (19%)

Query: 337 LEIRIRDFGGGIPPDVEDRMFDYSYTTSEKDAKDTGMSAYIIPGQDVS-NVSGMGFGLPL 395
           + I + D G GI P +++ +F                  ++   Q +S    G G GL +
Sbjct: 853 ISIEVEDTGPGIDPSLQESVFH----------------PFVQGDQTLSRQYGGTGLGLSI 896

Query: 396 CKAYVEMFNGELDIVSLWGWGTDVYIRL 423
           C+    M +G + + S  G G+     L
Sbjct: 897 CRQLANMMHGTMKLESKVGVGSKFTFTL 924

>YGR135W (PRE9) [2092] chr7 (761395..762171) Proteasome subunit
           alpha3_sc (protease yscE subunit Y13) [777 bp, 258 aa]
          Length = 258

 Score = 30.4 bits (67), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 37/80 (46%), Gaps = 8/80 (10%)

Query: 302 EILKNSARAHIENHTPSNYSAEKPIEVTIVRSYEDLEIRIRDFGGGIPPDVE------DR 355
           EIL N+AR H +N+  + Y+ + P+E+ +VR   D++      GG  P  V       D 
Sbjct: 85  EILINTARIHAQNYLKT-YNEDIPVEI-LVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDD 142

Query: 356 MFDYSYTTSEKDAKDTGMSA 375
            + Y   TS      TG  A
Sbjct: 143 RYGYQLYTSNPSGNYTGWKA 162

>KLLA0D00528g 51518..54526 some similarities with sp|Q8UBH7
           Agrobacterium tumefaciens st C58 / ATCC 33970
           Hydantoinase, hypothetical start
          Length = 1002

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 40/81 (49%), Gaps = 14/81 (17%)

Query: 245 IGVLDKRLNIAELVKRTEEFVGDLTFVKYDRIVPVNILEGHDVTFACIPQDLEYVLQEIL 304
           +G +D    ++   K  E+ V D           V+  EG +V    +P++ EYVL+EI 
Sbjct: 545 VGDVDYESALSATQKSVEQVVDD-----------VSSSEGEEVEL--VPKEDEYVLEEIF 591

Query: 305 KNSARAHIENHTPSNYSAEKP 325
           K++  + +E    +NY+  KP
Sbjct: 592 KSAKVSRVEKEI-TNYAHYKP 611

>AFR318W [3510] [Homologous to ScYGR135W (PRE9) - SH]
           complement(1013021..1013776) [756 bp, 251 aa]
          Length = 251

 Score = 30.0 bits (66), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 36/80 (45%), Gaps = 8/80 (10%)

Query: 302 EILKNSARAHIENHTPSNYSAEKPIEVTIVRSYEDLEIRIRDFGGGIPPDVE------DR 355
           EIL N+AR H +N+    Y+ E P+EV +VR   D++      GG  P  V       D 
Sbjct: 85  EILVNTARLHAQNYLKM-YNEEIPVEV-LVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDA 142

Query: 356 MFDYSYTTSEKDAKDTGMSA 375
            + Y   TS      +G  A
Sbjct: 143 RYGYQLYTSNPSGNYSGWKA 162

>Scas_658.12
          Length = 962

 Score = 30.0 bits (66), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 72/162 (44%), Gaps = 19/162 (11%)

Query: 100 FLTEYVPPLSDNERFMLSIKVLNMLLTYTCRRLLAL-QRLPYIAVINPNI-EESNR---- 153
           + T+Y     DN     S+K LN+L T   ++L  L +RL  + ++N  + EE N+    
Sbjct: 460 WKTQYEHIQKDNLDLQSSLKTLNVLNTDLTKKLRDLSKRLNELEIVNDRLTEERNKLSDT 519

Query: 154 ---LYLKTLESLLAI-----ELPYGLHDHAAMREKLITFLDDHGDTLVTLSKGFEEIMDF 205
              L  K+ ES L I     EL    +DH   +E+++ F +        L+K   +I   
Sbjct: 520 VTSLNNKSEESELQITKLEEELDSIKNDH---KEEILKFNEQLEQKTSELTKATNQIKTL 576

Query: 206 YPQQKVFDFLNIHLRDRLSMKLLVTHYLRLVEQSSGADCIGV 247
             Q+++FD +      + S   L   Y ++ +  +  D + +
Sbjct: 577 --QKQLFDNIKNSTESKTSEDALQKRYKQIKKLQTELDDVTL 616

>AER421W [2921] [Homologous to ScYNL082W (PMS1) - SH]
           complement(1445064..1447775) [2712 bp, 903 aa]
          Length = 903

 Score = 30.0 bits (66), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 55/117 (47%), Gaps = 13/117 (11%)

Query: 275 RIVPVNILEGHDVTFACIPQDLEYVLQEILKNSARAHIENHTPSNYSAEKPIEVTIVRSY 334
           +I  +N  + H +T   +  DL   ++E+++NS  AH +            +E+T  R+Y
Sbjct: 4   KINAINQADVHRITSGQVIIDLVAAVKEVVENSLDAHADK-----------LEITF-RNY 51

Query: 335 EDLEIRIRDFGGGIPPDVEDRMFDYSYTTSEKDAKD-TGMSAYIIPGQDVSNVSGMG 390
               I   D G GIP    D +    +T+  ++ +D T ++ +   G+ ++++  M 
Sbjct: 52  GLEAIECADNGDGIPDSNFDSLALKHHTSKIEEFEDLTRVTTFGFRGEALASICAMA 108

>ADR128C [1869] [Homologous to ScYKL073W (LHS1) - SH]
           (934447..937050) [2604 bp, 867 aa]
          Length = 867

 Score = 29.3 bits (64), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 37/80 (46%), Gaps = 5/80 (6%)

Query: 156 LKTLESLLAIELPYGLHDHAAMREKLITFLDDHGDTLVTLSKGFEEIMDFYPQQKVFDFL 215
           L +LESL+     Y   +     E L     D+ + L  L     E +D+      FD +
Sbjct: 600 LNSLESLI-----YSTREWLETPEVLDNGAHDYVEKLTELVSTNLEWLDYESSNATFDDI 654

Query: 216 NIHLRDRLSMKLLVTHYLRL 235
           N  L++ +S+  L++HYL +
Sbjct: 655 NNRLQEIMSLYKLLSHYLSI 674

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.138    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,499,277
Number of extensions: 578324
Number of successful extensions: 1701
Number of sequences better than 10.0: 33
Number of HSP's gapped: 1710
Number of HSP's successfully gapped: 40
Length of query: 427
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 323
Effective length of database: 12,995,837
Effective search space: 4197655351
Effective search space used: 4197655351
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 63 (28.9 bits)