Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL115W33332716320.0
Sklu_2174.333031511551e-159
Kwal_47.1814832331610701e-147
CAGL0L00891g3413169081e-122
YIL041W3263178621e-115
KLLA0E04433g3023088271e-110
Scas_704.453293178141e-108
AFR309C3642972145e-19
Kwal_55.212273763031924e-16
KLLA0E04543g3893141748e-14
CAGL0L08492g3852141731e-13
Scas_676.184442371695e-13
YPR148C435621421e-09
Sklu_2383.233836662.4
KLLA0C14971g445102635.8
KLLA0C04213g39443619.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL115W
         (327 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL115W [1626] [Homologous to ScYIL041W - SH] complement(483166....   633   0.0  
Sklu_2174.3 YIL041W, Contig c2174 2044-3036                           449   e-159
Kwal_47.18148                                                         416   e-147
CAGL0L00891g 106804..107829 similar to sp|P40531 Saccharomyces c...   354   e-122
YIL041W (YIL041W) [2626] chr9 (276524..277504) Cytoplasmic prote...   336   e-115
KLLA0E04433g complement(406764..407672) similar to sp|P40531 Sac...   323   e-110
Scas_704.45                                                           318   e-108
AFR309C [3501] [Homologous to ScYPR148C - SH] (1000084..1001178)...    87   5e-19
Kwal_55.21227                                                          79   4e-16
KLLA0E04543g 412009..413178 similar to sgd|S0006352 Saccharomyce...    72   8e-14
CAGL0L08492g 929051..930208 similar to tr|Q06523 Saccharomyces c...    71   1e-13
Scas_676.18                                                            70   5e-13
YPR148C (YPR148C) [5564] chr16 complement(826827..828134) Protei...    59   1e-09
Sklu_2383.2 YMR228W, Contig c2383 8318-9334 reverse complement         30   2.4  
KLLA0C14971g 1305101..1306438 some similarities with sgd|S000263...    29   5.8  
KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces c...    28   9.6  

>ADL115W [1626] [Homologous to ScYIL041W - SH]
           complement(483166..484167) [1002 bp, 333 aa]
          Length = 333

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/327 (96%), Positives = 316/327 (96%)

Query: 1   MSFNAFADSFSKRFQEISSTVQQKAQEAQXXXXXXXXXXXVSQRTQDLTSNLPSLAQTTQ 60
           MSFNAFADSFSKRFQEISSTVQQKAQEAQ           VSQRTQDLTSNLPSLAQTTQ
Sbjct: 1   MSFNAFADSFSKRFQEISSTVQQKAQEAQLDKKLKDLSLSVSQRTQDLTSNLPSLAQTTQ 60

Query: 61  RRVQERLGQVTDISQMPEEYVELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSVN 120
           RRVQERLGQVTDISQMPEEYVELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSVN
Sbjct: 61  RRVQERLGQVTDISQMPEEYVELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSVN 120

Query: 121 DFSKTVTGKVQELTKATTTEEAQSILISPGPARNPKTLNYALSKVALTSSEYLSKSGSDD 180
           DFSKTVTGKVQELTKATTTEEAQSILISPGPARNPKTLNYALSKVALTSSEYLSKSGSDD
Sbjct: 121 DFSKTVTGKVQELTKATTTEEAQSILISPGPARNPKTLNYALSKVALTSSEYLSKSGSDD 180

Query: 181 VVTADILLKYSDVQAKIAQARLQQDTLIQTRFNRRLREKLNTQFAEAMQSRKQVDQKRLQ 240
           VVTADILLKYSDVQAKIAQARLQQDTLIQTRFNRRLREKLNTQFAEAMQSRKQVDQKRLQ
Sbjct: 181 VVTADILLKYSDVQAKIAQARLQQDTLIQTRFNRRLREKLNTQFAEAMQSRKQVDQKRLQ 240

Query: 241 YDIARANFTAARPEKQASLRVQMETLEDQFAQSTEDAVALMQAVIDDTEFLKEFQELVTA 300
           YDIARANFTAARPEKQASLRVQMETLEDQFAQSTEDAVALMQAVIDDTEFLKEFQELVTA
Sbjct: 241 YDIARANFTAARPEKQASLRVQMETLEDQFAQSTEDAVALMQAVIDDTEFLKEFQELVTA 300

Query: 301 QLGFHKAAAELLSGFATVFAADSAVHI 327
           QLGFHKAAAELLSGFATVFAADSAVHI
Sbjct: 301 QLGFHKAAAELLSGFATVFAADSAVHI 327

>Sklu_2174.3 YIL041W, Contig c2174 2044-3036
          Length = 330

 Score =  449 bits (1155), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 215/315 (68%), Positives = 267/315 (84%)

Query: 1   MSFNAFADSFSKRFQEISSTVQQKAQEAQXXXXXXXXXXXVSQRTQDLTSNLPSLAQTTQ 60
           MSFNAFADS +K+FQE+S++V QKAQEAQ           VSQRTQDLT++LPSLAQ+TQ
Sbjct: 1   MSFNAFADSLNKKFQELSTSVSQKAQEAQLDKKFKDLSQAVSQRTQDLTTSLPSLAQSTQ 60

Query: 61  RRVQERLGQVTDISQMPEEYVELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSVN 120
           R VQERLGQVTDISQ+P+EY+ELE R+DR +L+Y+NFLKV+Q+YE ESYDYP ++ DSVN
Sbjct: 61  RLVQERLGQVTDISQLPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVRDSVN 120

Query: 121 DFSKTVTGKVQELTKATTTEEAQSILISPGPARNPKTLNYALSKVALTSSEYLSKSGSDD 180
           +FSKTV+ K+ EL+ A++T+EAQ+ILISPGPA++PKTLNYALSKVALTSSEYLSKSG +D
Sbjct: 121 EFSKTVSSKLHELSHASSTDEAQNILISPGPAKDPKTLNYALSKVALTSSEYLSKSGHED 180

Query: 181 VVTADILLKYSDVQAKIAQARLQQDTLIQTRFNRRLREKLNTQFAEAMQSRKQVDQKRLQ 240
              A  LLKYSDVQAKIAQARLQQDTLIQT+FN++LRE L +   +A+++RK+V+ KRLQ
Sbjct: 181 ETIATALLKYSDVQAKIAQARLQQDTLIQTKFNKKLRETLASDLNKAVKARKEVENKRLQ 240

Query: 241 YDIARANFTAARPEKQASLRVQMETLEDQFAQSTEDAVALMQAVIDDTEFLKEFQELVTA 300
           YDIARAN   A+PEK+ASLRVQME+LED+FAQ+TEDA  +MQ VI  +EFLK+  ELV+A
Sbjct: 241 YDIARANLANAKPEKEASLRVQMESLEDEFAQATEDATGVMQDVIASSEFLKDLSELVSA 300

Query: 301 QLGFHKAAAELLSGF 315
           QL ++K + ELLS F
Sbjct: 301 QLAYYKLSTELLSDF 315

>Kwal_47.18148
          Length = 323

 Score =  416 bits (1070), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 203/316 (64%), Positives = 256/316 (81%), Gaps = 1/316 (0%)

Query: 1   MSFNAFADSFSKRFQEISSTVQQKAQEAQXXXXXXXXXXXVSQRTQDLTSNLPSLAQTTQ 60
           MSFN+FADS +++FQEISS V Q+AQEAQ           VSQ+TQD T+ LPSLAQ+TQ
Sbjct: 1   MSFNSFADSVNRKFQEISSQVSQRAQEAQLDKKFKDLSTAVSQKTQDFTTQLPSLAQSTQ 60

Query: 61  RRVQERLGQVTDISQMPEEYVELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSVN 120
           R +QE+LGQVTDISQ+P++YVELE ++DR KL+Y+NFLKV+Q+YE+ESYDYP ++ DSVN
Sbjct: 61  RLMQEKLGQVTDISQLPQDYVELENKIDRMKLVYENFLKVTQVYENESYDYPNNVRDSVN 120

Query: 121 DFSKTVTGKVQELTKATTTEEAQSILISPGPARNPKTLNYALSKVALTSSEYLSKS-GSD 179
           +FS  V  K+ EL++AT+T EAQS+LISPGP ++PKTLNYALSKVALTSSEYL+KS G++
Sbjct: 121 EFSSIVGTKLHELSRATSTNEAQSVLISPGPHKDPKTLNYALSKVALTSSEYLNKSPGAE 180

Query: 180 DVVTADILLKYSDVQAKIAQARLQQDTLIQTRFNRRLREKLNTQFAEAMQSRKQVDQKRL 239
           D   +  LLKYSDVQAKIAQARL QDTLIQT+FN++LR  L      A ++RK V+ KRL
Sbjct: 181 DSEVSSSLLKYSDVQAKIAQARLHQDTLIQTKFNKKLRAALADDLNRAQKARKNVENKRL 240

Query: 240 QYDIARANFTAARPEKQASLRVQMETLEDQFAQSTEDAVALMQAVIDDTEFLKEFQELVT 299
           QYDIARAN   ARPEK+ASLRVQME+LED+FAQ+T+DAV +MQ V + +E LK+ +ELV 
Sbjct: 241 QYDIARANLANARPEKEASLRVQMESLEDEFAQATDDAVVIMQKVAESSELLKDLRELVA 300

Query: 300 AQLGFHKAAAELLSGF 315
           AQ  ++K +AELLS F
Sbjct: 301 AQAEYYKQSAELLSEF 316

>CAGL0L00891g 106804..107829 similar to sp|P40531 Saccharomyces
           cerevisiae YIL041w, hypothetical start
          Length = 341

 Score =  354 bits (908), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 173/316 (54%), Positives = 233/316 (73%), Gaps = 22/316 (6%)

Query: 2   SFNAFADSFSKRFQEISSTVQQKAQEAQXXXXXXXXXXXVSQRTQDLTSNLPSLAQTTQR 61
           +FN+FA+S  +  Q  S+TV                    SQ+T +L++N+P+LAQ+TQR
Sbjct: 3   NFNSFANSLRENLQSFSNTV--------------------SQKTHELSTNIPTLAQSTQR 42

Query: 62  RVQERLGQVTDISQMPEEYVELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSVND 121
            VQE+LGQVTDISQ+P+EY+ELE +VD  K++Y++FL+V+ +YE+ESYDYP+++S+SVN+
Sbjct: 43  MVQEKLGQVTDISQLPQEYLELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVSESVNE 102

Query: 122 FSKTVTGKVQELTKATTTEEAQSILISPGPARNPKTLNYALSKVALTSSEYLSKSGSD-- 179
           FSK +  KVQEL+KAT+  EAQ+IL++PGP + PKTLNYA+SKVAL +SEYL+ S  D  
Sbjct: 103 FSKNMAAKVQELSKATSATEAQNILVAPGPVKEPKTLNYAMSKVALNASEYLNHSFDDPM 162

Query: 180 DVVTADILLKYSDVQAKIAQARLQQDTLIQTRFNRRLREKLNTQFAEAMQSRKQVDQKRL 239
           D   + +LL YSDVQ K+AQARLQQDT IQT+FN+ +RE L    A A ++RK V  KRL
Sbjct: 163 DAKLSKVLLNYSDVQTKVAQARLQQDTQIQTKFNKVIRENLAESIARANKARKDVQSKRL 222

Query: 240 QYDIARANFTAARPEKQASLRVQMETLEDQFAQSTEDAVALMQAVIDDTEFLKEFQELVT 299
           QYD+AR N   A+PEK+A LRVQMETLEDQFAQ+TEDA  +MQ VI    FL   +EL T
Sbjct: 223 QYDVARTNLQNAKPEKEAGLRVQMETLEDQFAQATEDATVVMQEVIASANFLPSLKELAT 282

Query: 300 AQLGFHKAAAELLSGF 315
           AQL +++ +A+L+  F
Sbjct: 283 AQLEYYEQSAKLMKEF 298

>YIL041W (YIL041W) [2626] chr9 (276524..277504) Cytoplasmic protein
           with possible role in cell-cycle regulation [981 bp, 326
           aa]
          Length = 326

 Score =  336 bits (862), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 175/317 (55%), Positives = 225/317 (70%), Gaps = 26/317 (8%)

Query: 1   MSFNAFADSFSKRFQEISSTVQQKAQEAQXXXXXXXXXXXVSQRTQDLTSNLPSLAQTTQ 60
           MSFNAFA S SK+ QEIS++V +K QE                        LPSLAQ+TQ
Sbjct: 1   MSFNAFASSLSKKLQEISTSVSEKTQE------------------------LPSLAQSTQ 36

Query: 61  RRVQERLGQVTDISQMPEEYVELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSVN 120
           R VQERLGQVTDISQ+P EY ELE +VD  KLIY++FL V+ IYE+ SYDYP++I++SVN
Sbjct: 37  RMVQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVN 96

Query: 121 DFSKTVTGKVQELTKATTTEEAQSILISPGPARNPKTLNYALSKVALTSSEYLSKS-GSD 179
           +FS++V  K+ ELT AT+  EAQ+IL++PGP + PKTLNYALSKVAL SSE L+K   ++
Sbjct: 97  EFSRSVASKLTELTHATSASEAQNILVAPGPIKEPKTLNYALSKVALNSSECLNKMFPTE 156

Query: 180 DVVTADILLKYSDVQAKIAQARLQQDTLIQTRFNRRLREKLNTQFAEAMQSRKQVDQKRL 239
           +   A  LL++SDVQAKIAQAR+QQDTLIQT+FN+ LRE+L+ +  +A + RK V   RL
Sbjct: 157 EQPLASALLQFSDVQAKIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKCRKDVHSMRL 216

Query: 240 QYDIARANF-TAARPEKQASLRVQMETLEDQFAQSTEDAVALMQAVIDDTEFLKEFQELV 298
           +YD+AR N     +PEK+ASLRVQMETLEDQFAQ TEDA   +Q VI    F ++ +EL 
Sbjct: 217 RYDVARTNLANNKKPEKEASLRVQMETLEDQFAQVTEDATVCLQEVISHANFSEDLKELA 276

Query: 299 TAQLGFHKAAAELLSGF 315
            AQ  + + +A L+  F
Sbjct: 277 KAQAEYFETSAGLMKEF 293

>KLLA0E04433g complement(406764..407672) similar to sp|P40531
           Saccharomyces cerevisiae YIL041w singleton, start by
           similarity
          Length = 302

 Score =  323 bits (827), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 163/308 (52%), Positives = 228/308 (74%), Gaps = 17/308 (5%)

Query: 6   FADSFSKRFQEISSTVQQKAQEAQXXXXXXXXXXXVSQRTQDLTSNLPSLAQTTQRRVQE 65
           + DSFSK+ QE+S++V QKAQEAQ           + Q+ +DL +NLP LA +TQR +QE
Sbjct: 4   YFDSFSKKVQELSTSVSQKAQEAQ-----------LDQKFKDLKTNLPLLANSTQRMLQE 52

Query: 66  RLGQVTDISQMPEEYVELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSVNDFSKT 125
           +LGQVTDISQ+P+EYV+LE RV+  KLIY+NFLKV++IYE+ESYDYP ++ +SV++FSK 
Sbjct: 53  KLGQVTDISQLPDEYVQLEHRVETIKLIYENFLKVTKIYENESYDYPSNVKESVDEFSKL 112

Query: 126 VTGKVQELTKATTTEEAQSILISPGPARNPKTLNYALSKVALTSSEYLSKSGSDDVVTAD 185
           V GK+ +L+K T  E+AQ++L+S    + PKTLNYALSKVALTSSE++     +D   A+
Sbjct: 113 VGGKLHDLSKVTNREQAQNVLLSSPQMKEPKTLNYALSKVALTSSEHV-----EDESLAN 167

Query: 186 ILLKYSDVQAKIAQARLQQDTLIQTRFNRRLREKLNTQFAEAMQSRKQVDQKRLQYDIAR 245
            L KYSD Q KIAQ RLQQDT+IQT+FN+ ++EKL      + ++RK V+QKRLQYD+ R
Sbjct: 168 FLAKYSDSQTKIAQLRLQQDTMIQTKFNKAIKEKLEQDIETSTKARKLVEQKRLQYDVVR 227

Query: 246 AN-FTAARPEKQASLRVQMETLEDQFAQSTEDAVALMQAVIDDTEFLKEFQELVTAQLGF 304
           +N     +PEKQA+L+V+  T E++FA++T+DA+  M  V++  +F     ELV AQL +
Sbjct: 228 SNRLKNTKPEKQAALQVEESTHEEEFAKATDDAIIAMSKVVELADFSANLHELVAAQLAY 287

Query: 305 HKAAAELL 312
           HK++AE+L
Sbjct: 288 HKSSAEIL 295

>Scas_704.45
          Length = 329

 Score =  318 bits (814), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 169/317 (53%), Positives = 221/317 (69%), Gaps = 23/317 (7%)

Query: 2   SFNAFADSFSKRFQEISSTVQQKAQEAQXXXXXXXXXXXVSQRTQDLTSNLPSLAQTTQR 61
           SFN+F +SFSK   E+SSTV                    SQ+TQ+L++NLP+LAQ+TQR
Sbjct: 3   SFNSFTNSFSKTLSELSSTV--------------------SQKTQELSTNLPNLAQSTQR 42

Query: 62  RVQERLGQVTDISQMPEEYVELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSVND 121
            VQERLGQVTDISQ+PEEY+ELE ++D  K IYDNFL VS +YE +SYDYP    +S+ +
Sbjct: 43  MVQERLGQVTDISQLPEEYLELEMKLDSIKQIYDNFLAVSSVYEQQSYDYPYVAKESLIE 102

Query: 122 FSKTVTGKVQELTKATTTEEAQSILI-SPGPARNPKTLNYALSKVALTSSEYLSKSGSDD 180
           FSKT   KV+EL+ A++  EAQ+IL  S    + PKTLN+ALSKVAL SSE+L++   ++
Sbjct: 103 FSKTAASKVEELSHASSAHEAQNILTTSSTQIKEPKTLNFALSKVALKSSEHLNQFNDNE 162

Query: 181 VV--TADILLKYSDVQAKIAQARLQQDTLIQTRFNRRLREKLNTQFAEAMQSRKQVDQKR 238
               +A  LL +S++QAKIAQARLQQD LI+ +FN  LR  L T  A+A + RK+V  KR
Sbjct: 163 AFKSSASALLNFSNIQAKIAQARLQQDLLIKQKFNDALRHDLATNIAKATKVRKEVQSKR 222

Query: 239 LQYDIARANFTAARPEKQASLRVQMETLEDQFAQSTEDAVALMQAVIDDTEFLKEFQELV 298
           LQYDIAR N   A+PEK+ASLRVQMETLED FAQ+TE A  +MQ VID+++ +    EL 
Sbjct: 223 LQYDIARTNLMNAKPEKEASLRVQMETLEDDFAQATEHATIVMQDVIDNSDIVSRVNELA 282

Query: 299 TAQLGFHKAAAELLSGF 315
            AQL + + ++ L+  F
Sbjct: 283 RAQLAYFELSSSLMKEF 299

>AFR309C [3501] [Homologous to ScYPR148C - SH] (1000084..1001178)
           [1095 bp, 364 aa]
          Length = 364

 Score = 87.0 bits (214), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 71/297 (23%), Positives = 134/297 (45%), Gaps = 41/297 (13%)

Query: 57  QTTQRRVQERLGQVTDISQMPEEYVELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHIS 116
           +T +R++QE LG   DISQ+P +Y  LE++ D  + +    L VS+ +E E YDYP + +
Sbjct: 54  KTRKRQLQETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPT 113

Query: 117 DSVNDFSKTVTGKVQ--ELTKATTTEEAQSILISPGPARNPKTLNYALSKVALTSSEYLS 174
           +S++D+  T T + +  +  K  T ++ +        + +P +  +AL + A  S   + 
Sbjct: 114 ESISDWWNTSTKETRFLKFGKGGTDKQKEDKQKQAAGSSDPPSFAHALHRAAKGSQGIIQ 173

Query: 175 KSGSDDVVT----------ADILLK----YSDVQAKIAQARLQQDTLIQTRFNRRLREKL 220
           +                   + L+K    ++D Q  +  A+ + D  +   FN +L+  L
Sbjct: 174 ELKEQAEEEQEQEVEIDEDVESLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLL 233

Query: 221 NTQFAEAMQSRKQVDQKRLQYDIAR-------ANFTAARPE-KQA--------------- 257
             +F +    R++V++ RL +D  +       A     + E KQA               
Sbjct: 234 EVEFKKGHTLRRKVEESRLTFDTLKYEQHERDAALAKKQDEAKQAEGATPSTGVTQSSTA 293

Query: 258 --SLRVQMETLEDQFAQSTEDAVALMQAVIDDTEFLKEFQELVTAQLGFHKAAAELL 312
             +   Q+E  ED+F  +T +AV  M ++ D T+ +   +     QL +H+   + L
Sbjct: 294 DLAFYAQLEDAEDEFVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHRKCVQEL 350

>Kwal_55.21227
          Length = 376

 Score = 78.6 bits (192), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 75/303 (24%), Positives = 134/303 (44%), Gaps = 59/303 (19%)

Query: 63  VQERLGQVTDISQMPEEYVELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSVNDF 122
           +QE LG + DIS++P +Y  LE++ D  +      L V++ +E E YDYP ++S+S++D+
Sbjct: 53  LQETLGTIEDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDW 112

Query: 123 SKTVTGKVQELTKATTTEEAQSILISPGPARNPKTLNYALSKVALTSSEYLS-------- 174
             +    +  L  ++  ++      +   A  P++   A++K A  S + L+        
Sbjct: 113 WSSNKEGLFGLMSSSKKDKGAESAAAAKSALMPRSFAQAIAKAAKDSGDVLAALKDQEQQ 172

Query: 175 KSGSDDVVTADI--LLK----YSDVQAKIAQARLQQDTLIQTRFNRRLREKLNTQFAEAM 228
            S  ++    DI  L+K    +S+ Q KI Q + + D L+   FN++L   +  +F  A 
Sbjct: 173 ASADEEDEDEDITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNAS 232

Query: 229 QSRKQVDQKRLQYDIAR----------------------------------ANFTAAR-- 252
             R++V+  RL++D  R                                  AN T+    
Sbjct: 233 VLRRKVEDSRLKFDTMRYEVKLTEQQSKQAMENEKAQFKESDLSSKEEGADANETSNEVG 292

Query: 253 ------PEKQAS---LRVQMETLEDQFAQSTEDAVALMQAVIDDTEFLKEFQELVTAQLG 303
                  E+QA+    +  +E LED+F  +T +AV  M  + D  E L   +     QL 
Sbjct: 293 KSVTKTKEEQATNDAAQELLEKLEDEFVSNTTEAVETMGEITDSAELLNLVKLFHNFQLV 352

Query: 304 FHK 306
           +H+
Sbjct: 353 YHR 355

>KLLA0E04543g 412009..413178 similar to sgd|S0006352 Saccharomyces
           cerevisiae YPR148c, start by similarity
          Length = 389

 Score = 71.6 bits (174), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 77/314 (24%), Positives = 126/314 (40%), Gaps = 89/314 (28%)

Query: 60  QRRVQERLGQVTDISQMPEEYVELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSV 119
           + ++QE LG V DISQ+P +Y  LEQ+ D  + I    L V++ +E E YDYP ++++S 
Sbjct: 47  RHQLQETLGTVHDISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESF 106

Query: 120 NDFSKTVTGKVQELTK------ATTTEEAQSILISPGPARNPKTLNYALSKVALTSSEYL 173
           ND+       +   +K          E A++ L+       P++   ALSK A  S+  L
Sbjct: 107 NDWWSGNKDSIFSFSKKKAEVSPEVKETAENGLL-------PRSFAQALSKAATDSALIL 159

Query: 174 --------------SKSGSDDVVTADI----------------------LLK----YSDV 193
                         S+ G+D     +                       L+K    ++  
Sbjct: 160 KQLKAEETRTNQEESQEGADQKPAEETKAEPELEAEADEDEDEDEDVDNLIKAFESWTKC 219

Query: 194 QAKIAQARLQQDTLIQTRFNRRLREKLNTQFAEAMQSRKQVDQKRLQYDIAR-------- 245
           Q  I Q++ + D+L+   FN +L + + T F +  + R +V   RL +D  R        
Sbjct: 220 QLSIDQSKAEMDSLMVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLKLQ 279

Query: 246 ---------------ANFTAARPEKQASLR-VQM------------ETLEDQFAQSTEDA 277
                          A  T   PEK+ +   V M            E LEDQF  +T + 
Sbjct: 280 EKEVVASSEEAEKKVATETPETPEKKTNEEPVDMAKTEEDPDSKLFERLEDQFVSATSET 339

Query: 278 VALMQAVIDDTEFL 291
           V  +  + D +E +
Sbjct: 340 VEFLGELTDSSEII 353

>CAGL0L08492g 929051..930208 similar to tr|Q06523 Saccharomyces
           cerevisiae YPR148c, start by similarity
          Length = 385

 Score = 71.2 bits (173), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 104/214 (48%), Gaps = 20/214 (9%)

Query: 61  RRVQERLGQVTDISQMPEEYVELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSVN 120
           R +QE +G   DIS++P +YV LE++ D  + +    L V++ YE E YDYP +IS+S++
Sbjct: 38  RFLQEAIGNERDISKLPPQYVVLEKKCDSIEKVLKRILIVTKTYEIEGYDYPPNISESLS 97

Query: 121 DFSKTVTG-KVQELTKATT----------TEEAQSILISPGPARNPKTLNYALSKVALTS 169
            + +T     + ELTK             TE ++++         P +   A+++    S
Sbjct: 98  SWWQTKEWFNISELTKNVIPKHGNVEKAGTEASKTLTDKEVSHEGPPSFASAIARAGKDS 157

Query: 170 S---EYLSKSGSDDVVTADILLK----YSDVQAKIAQARLQQDTLIQTRFNRRLREKLNT 222
               E +     D+    D L+K    +SD   +I+ ++ + D ++   FN +L + L  
Sbjct: 158 QLIFESIETKDEDEKEDIDELVKIFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQK 217

Query: 223 QFAEAMQSRKQVDQKRLQYDIARANFTAARPEKQ 256
            F +    R +V++ RL +D  R  +  A+  KQ
Sbjct: 218 NFQKIHTLRAKVEESRLNFDTMR--YEVAQTSKQ 249

>Scas_676.18
          Length = 444

 Score = 69.7 bits (169), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 106/237 (44%), Gaps = 45/237 (18%)

Query: 42  SQRTQDLTSNL------PS--LAQTTQRRV-QERLGQVTDISQMPEEYVELEQRVDRTKL 92
           +Q+T D  SN       P+  L+  +Q+R+ QE +G V DIS +PE+Y  LE R D  + 
Sbjct: 18  AQKTSDTLSNAITTATDPATKLSLRSQKRLFQESIGTVHDISTLPEQYTTLEARTDALEK 77

Query: 93  IYDNFLKVSQIYESESYDYPQHISDSVNDFSKTVTGKVQELTKATTTEEAQSILISPGPA 152
                L VS+ +E E YDYP ++S+S +D+             + ++++ +         
Sbjct: 78  CLRRILIVSKTFEMEGYDYPPNLSESFSDWW------------SLSSKKKKEQEKEDKKG 125

Query: 153 RNPKTLNYALSKVALTSSE-YLSKSGSDDVVTADI-------------------LLKYSD 192
             P++   A+S  A    E Y   +  DD    +                    L+K  D
Sbjct: 126 FLPRSFAQAISNSAEDCVEIYQHVNDGDDEDKEENANNEEENEEEDEEDEDVKNLIKTFD 185

Query: 193 VQAK----IAQARLQQDTLIQTRFNRRLREKLNTQFAEAMQSRKQVDQKRLQYDIAR 245
             AK    I Q + + D+++   FN +L + LN +F +    RK+V   RL++D  R
Sbjct: 186 SWAKCYKNIDQGKAEMDSMMMKEFNAKLEKLLNEEFKKVHTLRKRVKDSRLKFDTVR 242

>YPR148C (YPR148C) [5564] chr16 complement(826827..828134) Protein
           of unknown function [1308 bp, 435 aa]
          Length = 435

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 43/62 (69%)

Query: 61  RRVQERLGQVTDISQMPEEYVELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSVN 120
           R VQE LG V+DIS++P +Y  LE++ D  + +    L VS+ +E E YDYP ++++S++
Sbjct: 53  RFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESIS 112

Query: 121 DF 122
           D+
Sbjct: 113 DW 114

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 35/68 (51%)

Query: 190 YSDVQAKIAQARLQQDTLIQTRFNRRLREKLNTQFAEAMQSRKQVDQKRLQYDIARANFT 249
           +S     I + + + D+++   FN++L   +N  F +    RK+V++ RL++D  R    
Sbjct: 221 WSTCYKNIDEGKAEMDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRYEVK 280

Query: 250 AARPEKQA 257
           A   E +A
Sbjct: 281 AKEAELEA 288

>Sklu_2383.2 YMR228W, Contig c2383 8318-9334 reverse complement
          Length = 338

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 77  PEEYVELEQRVDRTKLIYDNFLKVS-QIYESESYDY 111
           P++YV ++ R D  K I DNF   S ++Y+ + Y++
Sbjct: 69  PKQYVLMDSRPDFVKFIQDNFAGTSMELYQRDPYEW 104

>KLLA0C14971g 1305101..1306438 some similarities with sgd|S0002637
           Saccharomyces cerevisiae YDR229w, hypothetical start
          Length = 445

 Score = 28.9 bits (63), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 44/102 (43%), Gaps = 17/102 (16%)

Query: 111 YPQHISDSVNDFSKTVTGKVQELTKATTTEEAQSILISPGPA-------RNPKTLNYALS 163
           Y  H+S+    F   + GK    +  +T ++  +  +SP PA       R P ++   LS
Sbjct: 8   YAPHLSE----FYSMMNGKSNNNSNDSTKDKTNTGSLSPSPASPETGNMRRPSSIRSGLS 63

Query: 164 KV------ALTSSEYLSKSGSDDVVTADILLKYSDVQAKIAQ 199
                   AL S E + K+ S     AD + KYS    ++AQ
Sbjct: 64  TCSITDLRALVSKEDIKKTESGVKSLADKISKYSQKLNELAQ 105

>KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces
           cerevisiae YAR018c KIN3 ser/thr protein kinase,
           hypothetical start
          Length = 394

 Score = 28.1 bits (61), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 21/43 (48%)

Query: 113 QHISDSVNDFSKTVTGKVQELTKATTTEEAQSILISPGPARNP 155
           QH ++   DF+  V  +V+E+   T+   A  ++   GP   P
Sbjct: 337 QHATEMKRDFASAVDQRVREILNGTSKPAATPLITGTGPVTMP 379

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.125    0.322 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,571,458
Number of extensions: 323279
Number of successful extensions: 1394
Number of sequences better than 10.0: 71
Number of HSP's gapped: 1377
Number of HSP's successfully gapped: 78
Length of query: 327
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 225
Effective length of database: 13,065,073
Effective search space: 2939641425
Effective search space used: 2939641425
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 62 (28.5 bits)