Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL114C61460229640.0
Sklu_2174.463261920810.0
Kwal_47.1814562461820310.0
YER049W64462019030.0
CAGL0J02816g62561918690.0
KLLA0E04411g60060818170.0
Scas_715.28*63262916650.0
CAGL0J07480g976113780.29
AFR301C165560666.4
Scas_642.1057339649.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL114C
         (602 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL114C [1627] [Homologous to ScYER049W - SH] (484310..486154) [...  1146   0.0  
Sklu_2174.4 YER049W, Contig c2174 3142-5040 reverse complement        806   0.0  
Kwal_47.18145                                                         786   0.0  
YER049W (YER049W) [1477] chr5 (251727..253661) Component of NuA3...   737   0.0  
CAGL0J02816g 272944..274821 highly similar to sp|P40032 Saccharo...   724   0.0  
KLLA0E04411g 404611..406413 similar to sp|P40032 Saccharomyces c...   704   0.0  
Scas_715.28*                                                          645   0.0  
CAGL0J07480g complement(720484..723414) similar to sp|P53858 Sac...    35   0.29 
AFR301C [3493] [Homologous to ScYIL159W (BNR1) - SH] (981215..98...    30   6.4  
Scas_642.10                                                            29   9.9  

>ADL114C [1627] [Homologous to ScYER049W - SH] (484310..486154)
           [1845 bp, 614 aa]
          Length = 614

 Score = 1146 bits (2964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/602 (93%), Positives = 561/602 (93%)

Query: 1   MKRRAPSQPVFESKQPFLEIEKVKASFNSKIWDDSYREQLREEVASNKPYNWGTIHDLVD 60
           MKRRAPSQPVFESKQPFLEIEKVKASFNSKIWDDSYREQLREEVASNKPYNWGTIHDLVD
Sbjct: 1   MKRRAPSQPVFESKQPFLEIEKVKASFNSKIWDDSYREQLREEVASNKPYNWGTIHDLVD 60

Query: 61  PDLLRSVRREIEKEIHFTNKETDIYKVNQSGDLANLSGLDWKDLSRLPSLCRLRQILYSD 120
           PDLLRSVRREIEKEIHFTNKETDIYKVNQSGDLANLSGLDWKDLSRLPSLCRLRQILYSD
Sbjct: 61  PDLLRSVRREIEKEIHFTNKETDIYKVNQSGDLANLSGLDWKDLSRLPSLCRLRQILYSD 120

Query: 121 VYRDFIGYVAGAGKLSGTKMDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPDKTWKE 180
           VYRDFIGYVAGAGKLSGTKMDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPDKTWKE
Sbjct: 121 VYRDFIGYVAGAGKLSGTKMDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPDKTWKE 180

Query: 181 HYGGALRLFPSIIPNVPTSDFSAKLVPQFNQLAFFHVHPGYSFHDVEEVKVDKHRLSIQG 240
           HYGGALRLFPSIIPNVPTSDFSAKLVPQFNQLAFFHVHPGYSFHDVEEVKVDKHRLSIQG
Sbjct: 181 HYGGALRLFPSIIPNVPTSDFSAKLVPQFNQLAFFHVHPGYSFHDVEEVKVDKHRLSIQG 240

Query: 241 WYHIPQXXXXXXXXXXXXQYVNTNISTLAQLESILLQDYEFLKSERSILPLQQLKQLEKF 300
           WYHIPQ            QYVNTNISTLAQLESILLQDYEFLKSERSILPLQQLKQLEKF
Sbjct: 241 WYHIPQEGEEGFVPGEEEQYVNTNISTLAQLESILLQDYEFLKSERSILPLQQLKQLEKF 300

Query: 301 LGSESEDTAFYLNADELAYLSMYISEEHLSLEGIKSLQSKFTENSYLQIDSFLNEQKSAX 360
           LGSESEDTAFYLNADELAYLSMYISEEHLSLEGIKSLQSKFTENSYLQIDSFLNEQKSA 
Sbjct: 301 LGSESEDTAFYLNADELAYLSMYISEEHLSLEGIKSLQSKFTENSYLQIDSFLNEQKSAL 360

Query: 361 XXXXXXXXXXXXXCPYKAAEVEKPWKTAIPPYKWRFMYIDGKSHEHFCSEDDIKRRLVHE 420
                        CPYKAAEVEKPWKTAIPPYKWRFMYIDGKSHEHFCSEDDIKRRLVHE
Sbjct: 361 LKKLIKIEELEKECPYKAAEVEKPWKTAIPPYKWRFMYIDGKSHEHFCSEDDIKRRLVHE 420

Query: 421 ELPNFTLLKQGLSDHLSVEPALLELVEFFKSFAFKKYXXXXXXXXXXXXXXXIRRFRPGH 480
           ELPNFTLLKQGLSDHLSVEPALLELVEFFKSFAFKKY               IRRFRPGH
Sbjct: 421 ELPNFTLLKQGLSDHLSVEPALLELVEFFKSFAFKKYLALLTLLCPLTEQLLIRRFRPGH 480

Query: 481 DFTLATKIYPSQLLQHVEGFVDAVLEGVLCLTPTDGWESGELGGYELYMGDQDDEDMNKD 540
           DFTLATKIYPSQLLQHVEGFVDAVLEGVLCLTPTDGWESGELGGYELYMGDQDDEDMNKD
Sbjct: 481 DFTLATKIYPSQLLQHVEGFVDAVLEGVLCLTPTDGWESGELGGYELYMGDQDDEDMNKD 540

Query: 541 VEDAAVYRSDDSGSSVLINKPASWNSFNLVLRDESVLQFVKYVSWAAKSSRWDISMNWDV 600
           VEDAAVYRSDDSGSSVLINKPASWNSFNLVLRDESVLQFVKYVSWAAKSSRWDISMNWDV
Sbjct: 541 VEDAAVYRSDDSGSSVLINKPASWNSFNLVLRDESVLQFVKYVSWAAKSSRWDISMNWDV 600

Query: 601 KS 602
           KS
Sbjct: 601 KS 602

>Sklu_2174.4 YER049W, Contig c2174 3142-5040 reverse complement
          Length = 632

 Score =  806 bits (2081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/619 (65%), Positives = 474/619 (76%), Gaps = 17/619 (2%)

Query: 1   MKRRAPSQPVFE-SKQPFLEIEKVKASFNSKIWDDSYREQLREEVASNKPYNWGTIHDLV 59
           MKR APS+ V   +KQ   E  KVK  FNSKIWD  ++  LR+E+A +KPYNWGTI DL+
Sbjct: 1   MKRSAPSKSVVNPTKQQAGEESKVKPLFNSKIWDPEFQAALRQEIAESKPYNWGTIRDLI 60

Query: 60  DPDLLRSVRREIEKEIHFTNKETDIYKVNQSGDLANLSGLDWKDLSRLPSLCRLRQILYS 119
           + DLLR+VR+EIE +IHFTNKETDIYKVNQSGDLANLSGLDW DLSRLP+L +LR+ILYS
Sbjct: 61  NDDLLRAVRKEIETQIHFTNKETDIYKVNQSGDLANLSGLDWNDLSRLPNLFKLREILYS 120

Query: 120 DVYRDFIGYVAGAGKLSGTKMDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPDKTWK 179
           ++YRD I YV GAGKLSG+K DMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPDK WK
Sbjct: 121 EIYRDVISYVTGAGKLSGSKTDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPDKQWK 180

Query: 180 EHYGGALRLFPSIIPNVPTSDFSAKLVPQFNQLAFFHVHPGYSFHDVEEVKVDKHRLSIQ 239
           +HYGG LRLFPSI+ NVP SD SAKLVPQFNQ+AFF V PG+SFHDVEEV+VDKHRLSIQ
Sbjct: 181 DHYGGGLRLFPSIVANVPHSDHSAKLVPQFNQIAFFQVQPGFSFHDVEEVRVDKHRLSIQ 240

Query: 240 GWYHIPQXXXXXXXXXXXXQYVNTNISTLAQLESILLQDYEFLKSERSILPLQQLKQLEK 299
           GWYHIPQ            ++V TN STLAQLES +LQDYEF K+ER ILP  Q+K  EK
Sbjct: 241 GWYHIPQVGEPGHIPGEEEEWVKTNTSTLAQLESNVLQDYEFPKNERDILPYHQVKHFEK 300

Query: 300 FL----------GSESEDTAFY----LNADELAYLSMYISEEHLSLEGIKSLQSKFTENS 345
            L            +S  +A      L  +EL YLS ++SEE+L+  GI+SLQS+F ENS
Sbjct: 301 VLQDSSPDSDSSKEKSPVSAIVDTKNLTEEELHYLSQFVSEEYLTPTGIQSLQSRFLENS 360

Query: 346 YLQIDSFLNEQKSAXXXXXXXXXXXXXXCPYKAAEVEKPWKTAIPPYKWRFMYIDGKSHE 405
           +LQI SFLN+ KS               CPY++ +V+ PWKTAIPP+KWR++YIDGKSHE
Sbjct: 361 FLQIGSFLNDSKSKLLKRLIKNDELNKDCPYESDKVDAPWKTAIPPHKWRYLYIDGKSHE 420

Query: 406 HFCSEDDIKRRLVHEELPNFTLLKQGL-SDHLSVEPALLELVEFFKSFAFKKYXXXXXXX 464
           +F SE DI  +L +EELPN+T LKQ L  +    E  L++LVEFF+S  FKKY       
Sbjct: 421 NFRSEADILAKLNNEELPNYTFLKQTLDKEKHDTEYELVQLVEFFQSTIFKKYLALLTSL 480

Query: 465 XXXXXXXXIRRFRPGHDFTLATKIYPSQLLQHVEGFVDAVLEGVLCLTPTDGWESGELGG 524
                   +RRFRPG DFTLATKI  ++LL +VEG+VDAVLEG LCLTPT+GW+SGE+GG
Sbjct: 481 CPLSEQILVRRFRPGKDFTLATKINQNKLLSNVEGYVDAVLEGTLCLTPTNGWDSGEVGG 540

Query: 525 YELYMGDQDDEDM-NKDVEDAAVYRSDDSGSSVLINKPASWNSFNLVLRDESVLQFVKYV 583
           YELYM DQDDE+M +KD+EDAAVY++DDSG SVLIN P SWNS NLVLRDESVLQFVKY+
Sbjct: 541 YELYMNDQDDEEMRDKDLEDAAVYKADDSGDSVLINSPPSWNSLNLVLRDESVLQFVKYI 600

Query: 584 SWAAKSSRWDISMNWDVKS 602
           SW+AKSSRWD+SM WDVK+
Sbjct: 601 SWSAKSSRWDVSMQWDVKT 619

>Kwal_47.18145
          Length = 624

 Score =  786 bits (2031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/618 (61%), Positives = 466/618 (75%), Gaps = 16/618 (2%)

Query: 1   MKRRAPSQ-PVFESKQPFLEIEKVKASFNSKIWDDSYREQLREEVASNKPYNWGTIHDLV 59
           MKR + +       KQP  E+ K+K+ FNSKIWD  +++ L++E+A +KPYNWGTI DLV
Sbjct: 1   MKRTSSTHNDEISKKQPTNEVGKIKSLFNSKIWDPKFQDDLKQEIADSKPYNWGTIRDLV 60

Query: 60  DPDLLRSVRREIEKEIHFTNKETDIYKVNQSGDLANLSGLDWKDLSRLPSLCRLRQILYS 119
           D DLLR+VR+E+E +IHFT KETDIYKVNQSGDLANLSGLDW+DLSRLP+LC+LR+ILYS
Sbjct: 61  DDDLLRAVRKEVETQIHFTKKETDIYKVNQSGDLANLSGLDWEDLSRLPNLCKLREILYS 120

Query: 120 DVYRDFIGYVAGAGKLSGTKMDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPDKTWK 179
           +VYRD I +V GAGKLSG+KMDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDP+  WK
Sbjct: 121 EVYRDVISHVTGAGKLSGSKMDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPNTRWK 180

Query: 180 EHYGGALRLFPSIIPNVPTSDFSAKLVPQFNQLAFFHVHPGYSFHDVEEVKVDKHRLSIQ 239
           EHYGG LRLFPSI+ NVP SD SAKL+PQFNQ+AFF V PG+SFHDVEEV+V++HRLSIQ
Sbjct: 181 EHYGGGLRLFPSIVANVPQSDHSAKLIPQFNQIAFFQVQPGFSFHDVEEVRVNRHRLSIQ 240

Query: 240 GWYHIPQXXXXXXXXXXXXQYVNTNISTLAQLESILLQDYEFLKSERSILPLQQLKQLEK 299
           GWYHIPQ            ++V TN STLAQLES +LQDYEF K ER ILP  Q+K  E 
Sbjct: 241 GWYHIPQEGEKGYIPGEEEEWVKTNTSTLAQLESNVLQDYEFPKGERDILPNHQIKHYEH 300

Query: 300 FLGSESEDTAFYLNADELA-------------YLSMYISEEHLSLEGIKSLQSKFTENSY 346
            L ++  +     ++DELA             +LS ++S E+L+ EGI  LQ +F +NS+
Sbjct: 301 LLEAQPANKEEESSSDELALPDLSFLTDKEMKFLSSFVSAEYLTPEGIAKLQKRFIDNSH 360

Query: 347 LQIDSFLNEQKSAXXXXXXXXXXXXXXCPYKAAEVEKPWKTAIPPYKWRFMYIDGKSHEH 406
           LQ+D FL+++++               CPY++  VE PWKTA+PP+KWR++YIDGKSHE+
Sbjct: 361 LQVDDFLSDERANLLKQLIKRDELDKECPYESVNVEMPWKTAMPPHKWRYLYIDGKSHEN 420

Query: 407 FCSEDDIKRRLVHEELPNFTLLKQGL-SDHLSVEPALLELVEFFKSFAFKKYXXXXXXXX 465
           F +E DI  +L +EE PN+ LLKQ L       E  L+ + EFF+S AFKKY        
Sbjct: 421 FTTEQDILDKLNNEERPNYVLLKQSLDKKKYDTETELISVAEFFQSTAFKKYLALLTLLS 480

Query: 466 XXXXXXXIRRFRPGHDFTLATKIYPSQLLQHVEGFVDAVLEGVLCLTPTDGWESGELGGY 525
                  IRRFRPG DFTLAT++  + LL HVEG VDAVLEG LCLTPT+GWESGE+GGY
Sbjct: 481 PLSEQVLIRRFRPGKDFTLATQLNKNDLLGHVEGIVDAVLEGTLCLTPTNGWESGEVGGY 540

Query: 526 ELYMGDQDD-EDMNKDVEDAAVYRSDDSGSSVLINKPASWNSFNLVLRDESVLQFVKYVS 584
           ELYM +QD+ EDM+KD+EDAAVY++DD+G +VLINKP SWNS NLVLRDESVLQF+KYVS
Sbjct: 541 ELYMDNQDESEDMDKDIEDAAVYKTDDAGDAVLINKPPSWNSLNLVLRDESVLQFIKYVS 600

Query: 585 WAAKSSRWDISMNWDVKS 602
           W+AKSSRWDI+  WDVK+
Sbjct: 601 WSAKSSRWDITAQWDVKA 618

>YER049W (YER049W) [1477] chr5 (251727..253661) Component of NuA3
           histone acetyltransferase complex [1935 bp, 644 aa]
          Length = 644

 Score =  737 bits (1903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/620 (60%), Positives = 446/620 (71%), Gaps = 31/620 (5%)

Query: 13  SKQPFLEIEKVKASFNSKIWDDSYREQLREEVASNKPYNWGTIHDLVDPDLLRSVRREIE 72
           SKQ  LE +K+K  FN KIWD ++++ L++E+  ++PYNWGTIH+LV+ DLLR+VR+EIE
Sbjct: 16  SKQISLEEDKIKGMFNPKIWDKTFQDGLKKEIEDSQPYNWGTIHELVNDDLLRAVRKEIE 75

Query: 73  KEIHFTNKETDIYKVNQSGDLANLSGLDWKDLSRLPSLCRLRQILYSDVYRDFIGYVAGA 132
            EIHFT KETDIY+VNQSGDLANLSGLDW DLSRLP+L +LRQILYS  YRDF GYV  A
Sbjct: 76  TEIHFTKKETDIYRVNQSGDLANLSGLDWDDLSRLPNLFKLRQILYSKQYRDFFGYVTKA 135

Query: 133 GKLSGTKMDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPDKTWKEHYGGALRLFPSI 192
           GKLSG+K DMSINTYTKGCHLLTHDDVIGSRR+SFILYLPDPD+ WK HYGG LRLFPSI
Sbjct: 136 GKLSGSKTDMSINTYTKGCHLLTHDDVIGSRRISFILYLPDPDRKWKSHYGGGLRLFPSI 195

Query: 193 IPNVPTSDFSAKLVPQFNQLAFFHVHPGYSFHDVEEVKVDKHRLSIQGWYHIPQXXXXXX 252
           +PNVP SD SAKLVPQFNQ+AFF V PG+SFHDVEEVKVDKHRLSIQGWYHIPQ      
Sbjct: 196 LPNVPHSDPSAKLVPQFNQIAFFKVLPGFSFHDVEEVKVDKHRLSIQGWYHIPQVGEEGY 255

Query: 253 XXXXXXQYVNTNISTLAQLESILLQDYEFLKSERSILPLQQLKQLEKFL----GSESEDT 308
                  +V  N STLAQ+ES +L+D+EF K ER+IL   ++K  EK L    G+++++T
Sbjct: 256 IPGEEEAWVRNNTSTLAQIESNVLEDFEFPKDERNILSFHEVKHFEKMLKGDAGAKTDNT 315

Query: 309 -----------AFYLNADELAYLSMYISEEHLSLEGIKSLQSKFTENSYLQIDSFLNEQK 357
                      +  L+  E  YLS YIS EHLS +GI+ LQ +F ENS LQI+SFLN+ K
Sbjct: 316 PKESMTSVISDSVKLSEAEFTYLSQYISPEHLSSKGIEKLQKQFVENSSLQIESFLNDDK 375

Query: 358 SAXXXXXXXXXXXXXXCPYKAAEVEKPWKTAIPPYKWRFMYIDGKSHEHFCSEDDIKRRL 417
           S               CPY + +V+ PWKTAIPP+K R++YIDGK + +F +E DI   L
Sbjct: 376 SELLKKVIKQKELEQECPYHSKDVKAPWKTAIPPHKARYLYIDGKEYRNFQTEADILEAL 435

Query: 418 VHEELPNFTLLKQGLS-----------DHLSVEPALLELVEFFKSFAFKKYXXXXXXXXX 466
            + +LPNF   K  +            ++   E AL++L  F KS  FKKY         
Sbjct: 436 NNNDLPNFQFTKDAIKIISDASGNSRENNFDAELALIDLAVFHKSTIFKKYLALLTSLCP 495

Query: 467 XXXXXXIRRFRPGHDFTLATKIYPSQLLQHVEGFVDAVLEGVLCLTPTDGWESGELGGYE 526
                 IRRFRPG DFTLATK   ++LL+     +DAVLEG LCLTP+ GWESGELGGYE
Sbjct: 496 VSEQILIRRFRPGMDFTLATKCRFNELLKSNPDIIDAVLEGTLCLTPSAGWESGELGGYE 555

Query: 527 LYMGDQDDED----MNKDVEDAAVYRSDDSGSSVLINKPASWNSFNLVLRDESVLQFVKY 582
           LYM D DDED    + +DVEDA+VYR+DDSG SVLIN P +WN+FNLVLRDESVL+FVKY
Sbjct: 556 LYMMD-DDEDNKQYLKEDVEDASVYRADDSGDSVLINDPPAWNTFNLVLRDESVLEFVKY 614

Query: 583 VSWAAKSSRWDISMNWDVKS 602
           VSW+AKSSRWD+ M WDVKS
Sbjct: 615 VSWSAKSSRWDVKMKWDVKS 634

>CAGL0J02816g 272944..274821 highly similar to sp|P40032
           Saccharomyces cerevisiae YER049w, start by similarity
          Length = 625

 Score =  724 bits (1869), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/619 (59%), Positives = 440/619 (71%), Gaps = 19/619 (3%)

Query: 1   MKRRAPSQPVFESKQPFLEIEKVKASFNSKIWDDSYREQLREEVASNKPYNWGTIHDLVD 60
           MKR+A +Q    +KQ  LE +KVK  FN K+W   +RE L+ ++ S+ PYNWG I  LV+
Sbjct: 1   MKRKAEAQEN-GNKQLDLEEDKVKGLFNQKLWTPEFREGLKNQIDSSAPYNWGNISGLVN 59

Query: 61  PDLLRSVRREIEKEIHFTNKETDIYKVNQSGDLANLSGLDWKDLSRLPSLCRLRQILYSD 120
            DLLR+VR+EIE EIHFT KETDIYKVNQSGDLANLSGL+W DLSRLP++ +LRQILYSD
Sbjct: 60  DDLLRAVRKEIETEIHFTKKETDIYKVNQSGDLANLSGLNWDDLSRLPNMYKLRQILYSD 119

Query: 121 VYRDFIGYVAGAGKLSGTKMDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPDKTWKE 180
           VYRD IGYV GAGKLSG+KMDMS+NTYTKGCHLLTHDDVIGSRR+SFILYLPDPD+ WK 
Sbjct: 120 VYRDLIGYVTGAGKLSGSKMDMSVNTYTKGCHLLTHDDVIGSRRISFILYLPDPDRKWKP 179

Query: 181 HYGGALRLFPSIIPNVPTSDFSAKLVPQFNQLAFFHVHPGYSFHDVEEVKVDKHRLSIQG 240
            YGG LRLF SI+PN+P +D  AK VPQFN++AFF V PG+SFHDVEEVKVDKHRLSIQG
Sbjct: 180 QYGGGLRLFSSILPNIPETDPCAKFVPQFNEIAFFKVLPGFSFHDVEEVKVDKHRLSIQG 239

Query: 241 WYHIPQXXXXXXXXXXXXQYVNTNISTLAQLESILLQDYEFLKSERSILPLQQLKQLEKF 300
           WYH PQ             +V  N STL QLE+ +LQD+E+ K ER ILP  Q+K  EK 
Sbjct: 240 WYHFPQPGEPGYTPGQEEAWVKNNTSTLTQLETNVLQDFEYPKQERDILPYHQVKHFEKV 299

Query: 301 LGS-------ESEDTAFYLNADELA-----YLSMYISEEHLSLEGIKSLQSKFTENSYLQ 348
           L +       E E  +   + D L+     YLS YIS EHL+ EGIK LQ +F ENS LQ
Sbjct: 300 LYAADGKKIDEDEVKSVVQDTDSLSEKEYKYLSQYISAEHLTKEGIKKLQEQFLENSTLQ 359

Query: 349 IDSFLNEQKSAXXXXXXXXXXXXXXCPYKAAEVEKPWKTAIPPYKWRFMYIDGKSHEHFC 408
           I  FLNE+ S               CPY A +VE PW+TA+P +KWR+MYIDGK+     
Sbjct: 360 IKDFLNEEVSELLKKMIKTEELEKACPYMAKDVETPWQTAMPSHKWRYMYIDGKNPRKLL 419

Query: 409 SEDDIKRRLVHEELPNFTLLKQGL--SDHLSVEPALLELVEFFKSFAFKKYXXXXXXXXX 466
              DI   L +EELPNF LL++ L     + VE  L++L  F+KS  FKKY         
Sbjct: 420 KASDIMEALNNEELPNFELLRETLPKDGSVDVELKLIDLAIFYKSTIFKKYLALLTALCP 479

Query: 467 XXXXXXIRRFRPGHDFTLATKIYPSQLLQHVEGFVDAVLEGVLCLTPTDGWESGELGGYE 526
                 IRRFRPG+DFTLAT+   ++ LQ VEG + ++L G LCLTP+ GWESGE+GGYE
Sbjct: 480 LSEQILIRRFRPGNDFTLATQCRLNEFLQDVEGILPSILVGNLCLTPSSGWESGEVGGYE 539

Query: 527 LYMGD----QDDEDMNKDVEDAAVYRSDDSGSSVLINKPASWNSFNLVLRDESVLQFVKY 582
           LYM D    +++E M+KDVEDA+VYR+DD+G SVL+N P SWN+FNLVLRD+SVL+FVKY
Sbjct: 540 LYMMDDENTEEEERMHKDVEDASVYRTDDNGDSVLVNNPPSWNTFNLVLRDQSVLEFVKY 599

Query: 583 VSWAAKSSRWDISMNWDVK 601
           VS AAKSSRWD+ M WDVK
Sbjct: 600 VSCAAKSSRWDVKMEWDVK 618

>KLLA0E04411g 404611..406413 similar to sp|P40032 Saccharomyces
           cerevisiae YER049w singleton, start by similarity
          Length = 600

 Score =  704 bits (1817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/608 (57%), Positives = 439/608 (72%), Gaps = 27/608 (4%)

Query: 10  VFESKQP-------------FLEIEKVKASFNSKIWDDSYREQLREEVASNKPYNWGTIH 56
           V ESK+P              LE  K   SFNSKIWD S+++ LR+E+ + +PYNWGTI 
Sbjct: 3   VVESKRPAEETALGSDEKVRLLESSKAVGSFNSKIWDKSFQDDLRQEIKNAQPYNWGTIR 62

Query: 57  DLVDPDLLRSVRREIEKEIHFTNKETDIYKVNQSGDLANLSGLDWKDLSRLPSLCRLRQI 116
           DLVDP+LL+ VRREIE  IHFT KETDIYKVNQSGDLANLSGLD  DLS+LPSL +LR++
Sbjct: 63  DLVDPNLLQEVRREIETSIHFTQKETDIYKVNQSGDLANLSGLDDADLSKLPSLVKLREL 122

Query: 117 LYSDVYRDFIGYVAGAGKLSGTKMDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPDK 176
           LYS+ YRDFI YV  +GKLSG+K D+SINTYTKGCHLLTHDDVIGSRRVSFILYLP+P++
Sbjct: 123 LYSEKYRDFIAYVTQSGKLSGSKTDISINTYTKGCHLLTHDDVIGSRRVSFILYLPEPER 182

Query: 177 TWKEHYGGALRLFPSIIPNVPTSDFSAKLVPQFNQLAFFHVHPGYSFHDVEEVKVDKHRL 236
            WKEHYGG LRLFPSI+PNVP SD SAKLVPQFNQ+AFF V PG+SFHDVEEVKVDKHRL
Sbjct: 183 VWKEHYGGGLRLFPSIVPNVPFSDHSAKLVPQFNQIAFFKVQPGFSFHDVEEVKVDKHRL 242

Query: 237 SIQGWYHIPQXXXXXXXXXXXXQYVNTNISTLAQLESILLQDYEFLKSERSILPLQQLKQ 296
           SIQGWYHIPQ            +++ TNISTL+QL +  LQDYEF K +R+ L   +  +
Sbjct: 243 SIQGWYHIPQEGEPGYTPGEEEEWIKTNISTLSQLVNSPLQDYEFPKIDRTPLSHYESGK 302

Query: 297 LEKFLGSESEDTAFYLNADELAYLSMYISEEHLSLEGIKSLQSKFTENSYLQIDSFLNEQ 356
           L++        T   L  D++ +LS +++ EHL+ E ++ +  KF E+S++ I+SFLN++
Sbjct: 303 LDR--------TDDLLTEDDITFLSKFLNPEHLTTESMRKISDKFVEDSFINIESFLNDE 354

Query: 357 KSAXXXXXXXXXXXXXXCPYKAAEVEKPWKTAIPPYKWRFMYIDGKSHEHFCSEDDIKRR 416
            S+              CPY++  V  PWKT++PP+KWR++YIDGKS+ +F +E+DIK+ 
Sbjct: 355 YSSLLKKLIMDKEFNYDCPYESVNVRHPWKTSLPPHKWRYLYIDGKSYTNFRNEEDIKKA 414

Query: 417 LVHEELPNFTLLKQGLSD--HLSVEPALLELVEFFKSFAFKKYXXXXXXXXXXXXXXXIR 474
           L + ELPNF  L    +D    + E  L EL  F +S +FKK+               IR
Sbjct: 415 LNNPELPNFHQLLSSFADKEEFNCEAKLCELAIFLQSISFKKWIVQLTKLVILSEQLLIR 474

Query: 475 RFRPGHDFTLATKIYPSQLLQHVEGFVDAVLEGVLCLTPTDGWESGELGGYELYMGDQDD 534
           RFRPG DFTLAT    ++LL+ + GFV+A+LE  LCLTP+ GW+SGE+GGYELYM +Q  
Sbjct: 475 RFRPGKDFTLATTTEVNELLKTIPGFVEAILECTLCLTPSKGWDSGEVGGYELYMNNQ-- 532

Query: 535 EDMNKDVEDAAVYRSDDSGSSVLINKPASWNSFNLVLRDESVLQFVKYVSWAAKSSRWDI 594
              + + +DAA+YR+DD G SVLINKPASWNS NLVLRDE+VLQF+KYVSWAAKSSRWDI
Sbjct: 533 --DDDEDDDAAIYRADDDGDSVLINKPASWNSLNLVLRDENVLQFIKYVSWAAKSSRWDI 590

Query: 595 SMNWDVKS 602
           S+ WDVKS
Sbjct: 591 SLQWDVKS 598

>Scas_715.28*
          Length = 632

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/629 (51%), Positives = 428/629 (68%), Gaps = 33/629 (5%)

Query: 1   MKRRAPSQPVFESKQPFLEIEKVKASFNSKIWDDSYREQLREEVASNKPYNWGTIHDLVD 60
           MKR +      ++K   LE +K+KA FN +IW+  Y+++LR+E+A++KP+NWG+I  L+D
Sbjct: 1   MKRSSGDDSAAQAKMQTLEDDKLKALFNPRIWEPDYQKELRDEIANSKPFNWGSIPKLID 60

Query: 61  PDLLRSVRREIEKEIHFTNKETDIYKVNQSGDLANLSGLDWKDLSRLPSLCRLRQILYSD 120
            DLLR+VR+EIE EIHF+ KETDIYKVNQSGDLANLS LDW DLSRLP+L +LRQ+LYS+
Sbjct: 61  DDLLRAVRKEIETEIHFSKKETDIYKVNQSGDLANLSKLDWNDLSRLPNLFKLRQLLYSE 120

Query: 121 VYRDFIGYVAGAGKLSGTKMDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPDKTWKE 180
            YRDF  Y+  +G LSG K DMSINTYTKGCHL+ HDDVIGSRR+SFILYLPDPD+ WK 
Sbjct: 121 KYRDFFAYITQSGHLSGKKTDMSINTYTKGCHLVPHDDVIGSRRISFILYLPDPDRKWKS 180

Query: 181 HYGGALRLFPSIIPNVPTSDFSAKLVPQFNQLAFFHVHPGYSFHDVEEVKVDKHRLSIQG 240
           HYGG LRL+ +I+PNVP +D  AKLVPQFNQ+AFF V+PG+SFHDVEEVKVDKHRLSIQG
Sbjct: 181 HYGGGLRLYDTIMPNVPENDPCAKLVPQFNQIAFFKVNPGFSFHDVEEVKVDKHRLSIQG 240

Query: 241 WYHIPQXXXXXXXXXXXXQYVNTNISTLAQLESILLQDYEFLKSERSILPLQQLKQLEKF 300
           WYHIPQ             Y++ NI+ L +L+S +L+D+EF K ER +LP  Q+K  EK 
Sbjct: 241 WYHIPQEGDKGYIPNEEATYIDKNITQLGELDSAVLEDFEFPKEERELLPNYQIKHFEKI 300

Query: 301 L---GSESEDTAFYLN----------------ADELAYLSMYISEEHLSLEGIKSLQSKF 341
           L    S   D++  L+                 +E+AYLS Y++ EHL+ EGI  LQ  F
Sbjct: 301 LERSNSGDNDSSNVLSIPSGMKVIPSEIPSLTEEEVAYLSEYVALEHLTKEGISKLQESF 360

Query: 342 TENSYLQIDSFLNEQKSAXXXXXXXXXXXXXXCPYKAAEVEKPWKTAIPPYKWRFMYIDG 401
            ENS+L I+SFLNE+KS+              CP  + +V  PWKTA+P +K +++YIDG
Sbjct: 361 LENSFLSIESFLNEEKSSLLENQIKRTELEKDCPLFSKDVAYPWKTAMPSHKCKYLYIDG 420

Query: 402 KSHEHFCSEDDIKRRLVHEELPNFTLLKQGLS---DHLSVEPALLELVEFFKSFAFKKYX 458
           K  +   + D +   L ++E  NF ++K+ ++   + +  E +L+EL  FFKS  FKKY 
Sbjct: 421 KKQQDLATADGLITTLNNDENSNFEMVKELVNIGKEDIDTEKSLIELSIFFKSLIFKKYL 480

Query: 459 XXXXXXXXXXXXXXIRRFRPGHDFTLATKIYPSQLLQHVEGFVDAVLEGVLCLTPTDGWE 518
                         IRRFRPG+DFTLA K   +   +++   +D VL          GWE
Sbjct: 481 VLLTSLCLITEQVLIRRFRPGNDFTLANKCKMNT--KYLNEVLDNVLRRYFMFDSIKGWE 538

Query: 519 SGELGGYELYMGD-----QDDEDMNKDVEDAAVYRSDDSGSSVLINKPASWNSFNLVLRD 573
           +G++GGYE+YM D      +DED   DVE A  Y++D++G S+L+N PASWN+FNLVLRD
Sbjct: 539 TGDVGGYEIYMMDGTKEKAEDED---DVE-AERYKNDENGESILLNSPASWNTFNLVLRD 594

Query: 574 ESVLQFVKYVSWAAKSSRWDISMNWDVKS 602
           ESVL+FVKY+SW AKSSRWDI + WDV++
Sbjct: 595 ESVLEFVKYISWEAKSSRWDIKLKWDVRT 623

>CAGL0J07480g complement(720484..723414) similar to sp|P53858
           Saccharomyces cerevisiae YNL233w BNI4 bud neck involved,
           hypothetical start
          Length = 976

 Score = 34.7 bits (78), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 50/113 (44%), Gaps = 7/113 (6%)

Query: 494 LQHVEGFVDAVLEGVLCLTPTDGWESGELGGYELYMGDQDDEDMNKDVE-DAAVYRSDDS 552
           + H + F ++++  VL           + G Y     D  D    +D E D AV R +DS
Sbjct: 26  MDHAKTFRNSLILNVLSDNSIANSTDKDEGNYSTIADDGGDVTYVEDNESDIAVKRDEDS 85

Query: 553 GSSVLINKPASWNSFNLVLRDESVLQFVKYVSWAAKSSRWDI----SMNWDVK 601
            SS L N  +  N  NL+ ++E  +Q +   +  + S+  +I    S N D K
Sbjct: 86  NSSTLSNNESQPNRSNLLKKNE--IQTINMTTSPSLSALANILQEKSKNADKK 136

>AFR301C [3493] [Homologous to ScYIL159W (BNR1) - SH]
           (981215..986182) [4968 bp, 1655 aa]
          Length = 1655

 Score = 30.0 bits (66), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 6/60 (10%)

Query: 64  LRSVRREIEKEIHFTNKETDIYKVNQS----GDLANLSGLDWKDLSRLPSLCRLRQILYS 119
           L++ R + E+EI   N++++    N S      L N +GL   ++SR PSL R +++ YS
Sbjct: 549 LKNEREKYEREI--ANRDSERRLSNSSVFLFAQLKNGNGLPHSNVSRTPSLTRSKRVSYS 606

>Scas_642.10
          Length = 573

 Score = 29.3 bits (64), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%)

Query: 278 DYEFLKSERSILPLQQLKQLEKFLGSESEDTAFYLNADE 316
           D+EFLK  +++LP     Q+EK +   S+ T   L  DE
Sbjct: 34  DFEFLKQPQNVLPAPTSSQIEKEMPMTSQKTPENLLPDE 72

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.135    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,903,532
Number of extensions: 881175
Number of successful extensions: 2663
Number of sequences better than 10.0: 15
Number of HSP's gapped: 2703
Number of HSP's successfully gapped: 15
Length of query: 602
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 495
Effective length of database: 12,891,983
Effective search space: 6381531585
Effective search space used: 6381531585
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)