Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL113C1081065542e-75
Kwal_47.1814299882833e-34
YER048W-A94852625e-31
KLLA0E04389g91842522e-29
Sklu_2174.593872227e-25
CAGL0J02794g103772166e-24
Scas_715.28d95832028e-22
ACR206C7937740.007
YNL218W (MGS1)58782640.55
Kwal_56.2466156138611.5
Kwal_14.142073274601.8
ACR281C125956593.0
CAGL0G00154g43354583.1
Sklu_1666.147159566.8
KLLA0E02574g7946529.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL113C
         (106 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL113C [1628] [Homologous to ScYER048W-A - SH] (486497..486823)...   218   2e-75
Kwal_47.18142                                                         113   3e-34
YER048W-A (YER048W-A) [1476] chr5 (250717..251001) Protein of un...   105   5e-31
KLLA0E04389g 403312..403587 similar to sgd|S0007237 Saccharomyce...   101   2e-29
Sklu_2174.5 YER048W-A, Contig c2174 5568-5849 reverse complement       90   7e-25
CAGL0J02794g 272273..272584 similar to gi|6320889|sgd|S0007237 S...    88   6e-24
Scas_715.28d                                                           82   8e-22
ACR206C [1253] [Homologous to ScYDR379C-A - SH] (709048..709287)...    33   0.007
YNL218W (MGS1) [4386] chr14 (238237..240000) DNA-dependent ATPas...    29   0.55 
Kwal_56.24661                                                          28   1.5  
Kwal_14.1420                                                           28   1.8  
ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) ...    27   3.0  
CAGL0G00154g 14591..15892 highly similar to sp|P32527 Saccharomy...    27   3.1  
Sklu_1666.1 YOL069W, Contig c1666 1807-3222                            26   6.8  
KLLA0E02574g complement(237959..238198) similar to sgd|S0007605 ...    25   9.6  

>ADL113C [1628] [Homologous to ScYER048W-A - SH] (486497..486823)
           [327 bp, 108 aa]
          Length = 108

 Score =  218 bits (554), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 106/106 (100%), Positives = 106/106 (100%)

Query: 1   MQVSINRSRAQRSLLLSATTTMAGPTRAGVLHLYREFVRSARQFNNYNFREYFMRHSRDT 60
           MQVSINRSRAQRSLLLSATTTMAGPTRAGVLHLYREFVRSARQFNNYNFREYFMRHSRDT
Sbjct: 1   MQVSINRSRAQRSLLLSATTTMAGPTRAGVLHLYREFVRSARQFNNYNFREYFMRHSRDT 60

Query: 61  FRKHREASGEELQQLWERAQQEVGVLKRQSVISQMYTFDKLVVEQL 106
           FRKHREASGEELQQLWERAQQEVGVLKRQSVISQMYTFDKLVVEQL
Sbjct: 61  FRKHREASGEELQQLWERAQQEVGVLKRQSVISQMYTFDKLVVEQL 106

>Kwal_47.18142
          Length = 99

 Score =  113 bits (283), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 69/88 (78%), Gaps = 1/88 (1%)

Query: 20  TTMAGPTRAGVLHLYREFVRSARQFNNYNFREYFMRHSRDTFRKHREASGE-ELQQLWER 78
           +T AGPTRA VL LY++F+++A  FNNYN+REYF+R +R TFR+H+  +    ++  WE 
Sbjct: 2   STPAGPTRAQVLALYKQFIKNANGFNNYNYREYFLRKARTTFREHKTLTDPASVETAWEI 61

Query: 79  AQQEVGVLKRQSVISQMYTFDKLVVEQL 106
           A +E+GVLKRQSVISQMYTFDK VVE L
Sbjct: 62  ANKELGVLKRQSVISQMYTFDKQVVEPL 89

>YER048W-A (YER048W-A) [1476] chr5 (250717..251001) Protein of
           unknown function [285 bp, 94 aa]
          Length = 94

 Score =  105 bits (262), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 50/85 (58%), Positives = 65/85 (76%), Gaps = 1/85 (1%)

Query: 23  AGPTRAGVLHLYREFVRSARQFNNYNFREYFMRHSRDTFRKH-REASGEELQQLWERAQQ 81
             PTR  VL LY+EF+++A QFNNYNFREYF+  +R TFRK+  +   + L  L++ A+ 
Sbjct: 5   TAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKN 64

Query: 82  EVGVLKRQSVISQMYTFDKLVVEQL 106
           ++GVLKRQSVISQMYTFD+LVVE L
Sbjct: 65  DLGVLKRQSVISQMYTFDRLVVEPL 89

>KLLA0E04389g 403312..403587 similar to sgd|S0007237 Saccharomyces
           cerevisiae YER048wa, start by similarity
          Length = 91

 Score =  101 bits (252), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 66/84 (78%), Gaps = 1/84 (1%)

Query: 24  GPTRAGVLHLYREFVRSARQFNNYNFREYFMRHSRDTFRKHREA-SGEELQQLWERAQQE 82
           G ++  +LH+Y+EF+R+A +  NYNFREYF+R +R++FR ++   + E++ +L   A+++
Sbjct: 5   GASKTQILHMYKEFIRNASKIQNYNFREYFLRRARESFRANKNVENPEKISELLSEAEKD 64

Query: 83  VGVLKRQSVISQMYTFDKLVVEQL 106
           +GVLKRQSVIS MYTFDKLVVE L
Sbjct: 65  LGVLKRQSVISNMYTFDKLVVEPL 88

>Sklu_2174.5 YER048W-A, Contig c2174 5568-5849 reverse complement
          Length = 93

 Score = 90.1 bits (222), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 53/87 (60%), Positives = 66/87 (75%), Gaps = 1/87 (1%)

Query: 21  TMAGPTRAGVLHLYREFVRSARQFNNYNFREYFMRHSRDTFRKHREA-SGEELQQLWERA 79
           T   PTR  VL LYR+FV++A  FNNYNFREYF+R +R TF++ ++     ++   WE A
Sbjct: 2   TATVPTRPQVLALYRQFVKNANNFNNYNFREYFLRKARTTFKESKQLQDSTKVNAAWEEA 61

Query: 80  QQEVGVLKRQSVISQMYTFDKLVVEQL 106
           Q+E+GVLKRQSVISQMYTFDKLVVE L
Sbjct: 62  QRELGVLKRQSVISQMYTFDKLVVEPL 88

>CAGL0J02794g 272273..272584 similar to gi|6320889|sgd|S0007237
           Saccharomyces cerevisiae YER048wa, hypothetical start
          Length = 103

 Score = 87.8 bits (216), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 39/77 (50%), Positives = 59/77 (76%), Gaps = 1/77 (1%)

Query: 26  TRAGVLHLYREFVRSARQFNNYNFREYFMRHSRDTFRKHRE-ASGEELQQLWERAQQEVG 84
            R  VL LY++ +++A QF+NYNFREYF+R +R  F+ ++      +++ L++ AQ+++G
Sbjct: 3   ARQQVLQLYKQIIKNANQFSNYNFREYFLRKARTEFKANKALTDAAKIESLFQGAQRDLG 62

Query: 85  VLKRQSVISQMYTFDKL 101
           VLKRQS+ISQMYTFDKL
Sbjct: 63  VLKRQSIISQMYTFDKL 79

>Scas_715.28d
          Length = 95

 Score = 82.4 bits (202), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 47/83 (56%), Positives = 67/83 (80%), Gaps = 1/83 (1%)

Query: 23  AGPTRAGVLHLYREFVRSARQFNNYNFREYFMRHSRDTFRKHREA-SGEELQQLWERAQQ 81
           A P+R  VL LY++F+R++ QFNN+NFREYF+R SR+ F+++      E++ +L+E AQ+
Sbjct: 3   ATPSRLQVLSLYKQFIRNSNQFNNFNFREYFLRISREKFKENAPIQDKEKVAKLYEAAQR 62

Query: 82  EVGVLKRQSVISQMYTFDKLVVE 104
           ++GVLKRQ +ISQMYTFDKLVVE
Sbjct: 63  DLGVLKRQKLISQMYTFDKLVVE 85

>ACR206C [1253] [Homologous to ScYDR379C-A - SH] (709048..709287)
          [240 bp, 79 aa]
          Length = 79

 Score = 33.1 bits (74), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 30 VLHLYREFVRSARQFNNYNFREYFMRHSRDTFRKHRE 66
          VLHLYREF+R A      N R +F+ + R+ FR+H++
Sbjct: 12 VLHLYREFIRVAYTKAPEN-RPHFIGYIREEFRRHKD 47

>YNL218W (MGS1) [4386] chr14 (238237..240000) DNA-dependent ATPase
           required for genome stability, appears to be a DNA
           replication accessory factor that is specific for
           polymerase delta, member of the AAA family of ATPases
           [1764 bp, 587 aa]
          Length = 587

 Score = 29.3 bits (64), Expect = 0.55,   Method: Composition-based stats.
 Identities = 22/82 (26%), Positives = 45/82 (54%), Gaps = 9/82 (10%)

Query: 24  GPTRAGVLHLYREFVRSARQFNNYNF--REYFMRHSRDTFRKHREASGEELQQLWERAQQ 81
           GP   G   L R   ++A   +N +     YFM  +  T     +A+ +EL+ ++E++++
Sbjct: 177 GPPGVGKTSLARLLTKTATTSSNESNVGSRYFMIETSAT-----KANTQELRGIFEKSKK 231

Query: 82  EVGVLKRQSV--ISQMYTFDKL 101
           E  + KR++V  I +++ F+K+
Sbjct: 232 EYQLTKRRTVLFIDEIHRFNKV 253

>Kwal_56.24661
          Length = 561

 Score = 28.1 bits (61), Expect = 1.5,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 23/38 (60%)

Query: 60  TFRKHREASGEELQQLWERAQQEVGVLKRQSVISQMYT 97
           T R  R+  G+EL  L ++A++E   + R S I++ YT
Sbjct: 491 TNRSIRKNFGKELSSLQKQAREEAAKIGRASRIARKYT 528

>Kwal_14.1420
          Length = 732

 Score = 27.7 bits (60), Expect = 1.8,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 33/74 (44%), Gaps = 12/74 (16%)

Query: 5   INRSRAQRSLLLSATTTMAGPTRAGVLHLYREFVRSARQFNNYNFREYFMRHSRDTFRKH 64
           + R R+Q SL  S T+T A    +G   L+R F  +       NF +     SRDTF   
Sbjct: 645 LQRRRSQLSLFRSTTSTAAAKDPSG---LFRAFATTPHS----NFPD-----SRDTFAYD 692

Query: 65  REASGEELQQLWER 78
            + S   + + + +
Sbjct: 693 EKTSSSNMTEAYRK 706

>ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) -
           SH] (864528..868307) [3780 bp, 1259 aa]
          Length = 1259

 Score = 27.3 bits (59), Expect = 3.0,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 5/56 (8%)

Query: 53  FMRHSRDTFRKHREASGEELQQLWERAQQEVGVLKR--QSVISQMYTFDKLVVEQL 106
           ++ HSRD F K+   +  +L+ L ER   E+  +     S  S  +T DK  +E+L
Sbjct: 803 WITHSRDVFFKNYNTNPSQLKILNER---EIATISSGTNSATSSKHTTDKFKLEEL 855

>CAGL0G00154g 14591..15892 highly similar to sp|P32527 Saccharomyces
           cerevisiae YGR285c ZUO1, start by similarity
          Length = 433

 Score = 26.9 bits (58), Expect = 3.1,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 5/54 (9%)

Query: 51  EYFMRHSRDTFRKHREASGEELQQLWERAQQEVGVLKRQSVISQMYTFDKLVVE 104
           +YFM H++ T R H  +  E+LQ     A+Q V  +   +V      FD+ + +
Sbjct: 34  KYFMHHAQRTLRNHTWSEFEKLQ-----AEQNVKKVDESNVDPDEALFDQEIAD 82

>Sklu_1666.1 YOL069W, Contig c1666 1807-3222
          Length = 471

 Score = 26.2 bits (56), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 5/59 (8%)

Query: 42  RQFNNYNFREYFM-RHSRDTFRKHREASGEELQQLWERAQQEVGVLKRQSVISQMYTFD 99
           ++F++YNF +  M ++S D+      A GE+L  L ER +     LK+ + I +  T D
Sbjct: 178 QKFDDYNFLQQQMNKYSEDSGL----AGGEDLTVLEERNKNLESQLKKLTQIQEALTID 232

>KLLA0E02574g complement(237959..238198) similar to sgd|S0007605
          Saccharomyces cerevisiae YDR379ca Pi, start by
          similarity
          Length = 79

 Score = 24.6 bits (52), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 30 VLHLYREFVRSARQFNNYNFREYFMRHSRDTFRKHREASGEELQQL 75
          V+HLYR+ VR+A +    N R +F+ + R  F K +  S ++   +
Sbjct: 12 VIHLYRQCVRTAHKKPIEN-RPHFITYIRTEFGKFKGLSRKDFSTI 56

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.323    0.131    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,892,586
Number of extensions: 97624
Number of successful extensions: 445
Number of sequences better than 10.0: 16
Number of HSP's gapped: 437
Number of HSP's successfully gapped: 16
Length of query: 106
Length of database: 16,596,109
Length adjustment: 76
Effective length of query: 30
Effective length of database: 13,965,141
Effective search space: 418954230
Effective search space used: 418954230
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 54 (25.4 bits)