Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL088W48647724940.0
Kwal_47.1815546546711681e-157
Sklu_2260.147747611671e-157
KLLA0F27643g47847311531e-155
YER051W4924729821e-129
CAGL0J02860g4033768691e-113
Kwal_56.24206150254810.087
KLLA0C16203g145461800.11
YMR176W (ECM5)141149770.28
Kwal_56.24115148531720.94
Scas_420.243441711.2
YJL084C104658701.6
AFL127C152132701.9
YJR119C72843682.9
Scas_720.39145549683.0
YKL005C (BYE1)59426674.0
Kwal_26.791454739664.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL088W
         (477 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL088W [1653] [Homologous to ScYER051W - SH] complement(530548....   965   0.0  
Kwal_47.18155                                                         454   e-157
Sklu_2260.1 YER051W, Contig c2260 321-1754                            454   e-157
KLLA0F27643g complement(2561213..2562649) similar to sp|P40034 S...   448   e-155
YER051W (YER051W) [1479] chr5 (254655..256133) Protein containin...   382   e-129
CAGL0J02860g 276002..277213 similar to sp|P40034 Saccharomyces c...   339   e-113
Kwal_56.24206                                                          36   0.087
KLLA0C16203g complement(1414169..1418533) weakly similar to sp|Q...    35   0.11 
YMR176W (ECM5) [4131] chr13 (611739..615974) Protein involved in...    34   0.28 
Kwal_56.24115                                                          32   0.94 
Scas_420.2                                                             32   1.2  
YJL084C (YJL084C) [2830] chr10 complement(274778..277918) Protei...    32   1.6  
AFL127C [3068] [Homologous to ScYMR176W (ECM5) - SH] (193474..19...    32   1.9  
YJR119C (YJR119C) [3011] chr10 complement(644219..646405) Protei...    31   2.9  
Scas_720.39                                                            31   3.0  
YKL005C (BYE1) [3252] chr11 complement(432736..434520) Protein w...    30   4.0  
Kwal_26.7914                                                           30   4.2  

>ADL088W [1653] [Homologous to ScYER051W - SH]
           complement(530548..532008) [1461 bp, 486 aa]
          Length = 486

 Score =  965 bits (2494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/477 (97%), Positives = 464/477 (97%)

Query: 1   MLQQVTSTTVTGADIQLRAKLLLFSMTDDQCVYCKGKMEHRMWVQCEACPQWVHVQCIPE 60
           MLQQVTSTTVTGADIQLRAKLLLFSMTDDQCVYCKGKMEHRMWVQCEACPQWVHVQCIPE
Sbjct: 1   MLQQVTSTTVTGADIQLRAKLLLFSMTDDQCVYCKGKMEHRMWVQCEACPQWVHVQCIPE 60

Query: 61  ECLSGGEYPSRSSDIAAFECSAHGTXXXXXXXXXXXXXVEAKEEPERAGTRRYRLRKRGP 120
           ECLSGGEYPSRSSDIAAFECSAHGT             VEAKEEPERAGTRRYRLRKRGP
Sbjct: 61  ECLSGGEYPSRSSDIAAFECSAHGTARARLALKGKRRRVEAKEEPERAGTRRYRLRKRGP 120

Query: 121 LDYIALNEGQDVRLRHEHPHRAAFQGCFTKWSGLGRTVTSAELQQSFAELREPVLVADPE 180
           LDYIALNEGQDVRLRHEHPHRAAFQGCFTKWSGLGRTVTSAELQQSFAELREPVLVADPE
Sbjct: 121 LDYIALNEGQDVRLRHEHPHRAAFQGCFTKWSGLGRTVTSAELQQSFAELREPVLVADPE 180

Query: 181 HSGMQTPAMDEQVLADVLGADYSLDVMDVQSQQNERWTMGQWKEYMHTARGVRDRIRNVI 240
           HSGMQTPAMDEQVLADVLGADYSLDVMDVQSQQNERWTMGQWKEYMHTARGVRDRIRNVI
Sbjct: 181 HSGMQTPAMDEQVLADVLGADYSLDVMDVQSQQNERWTMGQWKEYMHTARGVRDRIRNVI 240

Query: 241 SLEVSHVPEFGQRIRRPRAVEDNDLVDLVWPVQPAPEIGAKPKVQKYVLMSAANAYTDFH 300
           SLEVSHVPEFGQRIRRPRAVEDNDLVDLVWPVQPAPEIGAKPKVQKYVLMSAANAYTDFH
Sbjct: 241 SLEVSHVPEFGQRIRRPRAVEDNDLVDLVWPVQPAPEIGAKPKVQKYVLMSAANAYTDFH 300

Query: 301 LDFAGTSVYYSLLRGAKQFLLFPPTPANLGAYKAWCADDNQGLIFLGDRLQDGVLFSLRP 360
           LDFAGTSVYYSLLRGAKQFLLFPPTPANLGAYKAWCADDNQGLIFLGDRLQDGVLFSLRP
Sbjct: 301 LDFAGTSVYYSLLRGAKQFLLFPPTPANLGAYKAWCADDNQGLIFLGDRLQDGVLFSLRP 360

Query: 361 GDLFMIPSGFIHAVYTPEDSFVVGGNYLCLRDLSTHIRIVRIEQETQVPKKFTFPKFERV 420
           GDLFMIPSGFIHAVYTPEDSFVVGGNYLCLRDLSTHIRIVRIEQETQVPKKFTFPKFERV
Sbjct: 361 GDLFMIPSGFIHAVYTPEDSFVVGGNYLCLRDLSTHIRIVRIEQETQVPKKFTFPKFERV 420

Query: 421 MGLTAEWLLEGLPERLQLITHEHAVALLDYLRDTRLKYKPAHYHTKSTMLASLEKAL 477
           MGLTAEWLLEGLPERLQLITHEHAVALLDYLRDTRLKYKPAHYHTKSTMLASLEKAL
Sbjct: 421 MGLTAEWLLEGLPERLQLITHEHAVALLDYLRDTRLKYKPAHYHTKSTMLASLEKAL 477

>Kwal_47.18155
          Length = 465

 Score =  454 bits (1168), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 222/467 (47%), Positives = 291/467 (62%), Gaps = 19/467 (4%)

Query: 26  MTDDQCVYCKGKMEHRM-WVQCEACPQWVHVQCIP------EECLSGGEYPSRSSDIAAF 78
           M  D C YC      ++ WVQCE C  WVHV C+P      E   +   YP  +  I  F
Sbjct: 1   MVSDNCAYCSSSDPDKLLWVQCEVCDSWVHVTCVPIKDIVNEMGEASKTYPQDADQIKRF 60

Query: 79  ECSAHGTXXXXXXXXXXXXXVEAKEEPERAGTRRYRLRKRGPLDYIALNEGQDVRLRHEH 138
            C+ H               + +      A  +R  LRK+  +DYI+LNEG D RL++EH
Sbjct: 61  SCAEHPYPALEINMGLKKRKLNSTMADLSA--KRQGLRKKKQVDYISLNEGADRRLKNEH 118

Query: 139 PHRAAFQGCFTKWSGLGRTVTSAELQQSFAELREPVLVADPEHSGMQTPA------MDEQ 192
           PH  AF  CF++W      +   EL+  F  ++ P+ + DPE+SGMQ P           
Sbjct: 119 PHMHAFLACFSRWENKTNVMDCLELEDKFNSIKVPLKIKDPENSGMQIPKDVDGGNFTVD 178

Query: 193 VLADVLGADYSLDVMDVQSQQNERWTMGQWKEY-MHTARGVRDRIRNVISLEVSHVPEFG 251
            +   LG DY +DVMDVQSQQN  WTM +W +Y M T    RDRIRNVISLEVSHV +F 
Sbjct: 179 TVTRFLGEDYRVDVMDVQSQQNSTWTMAEWNKYFMQTPIESRDRIRNVISLEVSHVEQFK 238

Query: 252 QRIRRPRAVEDNDLVDLVWPVQPAPEIGAKPKVQKYVLMSAANAYTDFHLDFAGTSVYYS 311
             +RRPR VE ND+VDL+W     P+   +PKV KY+LMS  NAYTDFHLDFAGTSVYY 
Sbjct: 239 SGLRRPRVVESNDVVDLLW--NAIPDNTVRPKVTKYILMSVQNAYTDFHLDFAGTSVYYK 296

Query: 312 LLRGAKQFLLFPPTPANLGAYKAWCADDNQGLIFLGDRLQDGVLFSLRPGDLFMIPSGFI 371
           ++ G+K+F+LFPPTP NL AY  WC +D+Q LIFLGD+L++G+   L  GDLFMIP G+I
Sbjct: 297 VISGSKKFILFPPTPRNLAAYTQWCGNDDQNLIFLGDQLEEGIAMDLSAGDLFMIPCGYI 356

Query: 372 HAVYTPEDSFVVGGNYLCLRDLSTHIRIVRIEQETQVPKKFTFPKFERVMGLTAEWLLEG 431
           HAVYTP D+ V+GGN+L LRDL T + IV IE+ T+VPKKFTFP+FE VMG T E++++ 
Sbjct: 357 HAVYTPVDTLVIGGNFLTLRDLKTQLMIVDIEKVTKVPKKFTFPQFESVMGKTCEYIVKK 416

Query: 432 LPERLQL-ITHEHAVALLDYLRDTRLKYKPAHYHTKSTMLASLEKAL 477
               + L I +E   ALL Y++D + KY+P ++ TK  +L   +K++
Sbjct: 417 EANGIDLGIKNEQKEALLHYIQDPKFKYRPVNFSTKRQLLERFQKSV 463

>Sklu_2260.1 YER051W, Contig c2260 321-1754
          Length = 477

 Score =  454 bits (1167), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 236/476 (49%), Positives = 298/476 (62%), Gaps = 30/476 (6%)

Query: 26  MTDDQCVYCKGKMEHR-MWVQCEACPQWVHVQCIPEECL------SGGEYPSRSSDIAAF 78
           MT + C YC      + +WVQCE CPQWVHV+C+P + L      S   +P+ +S I  F
Sbjct: 1   MTTEICSYCSNDDPSKSLWVQCELCPQWVHVECVPLKHLRNDSDDSVTTHPTSASQIVKF 60

Query: 79  ECSAHGTXXXXXXXXXXXXXVEAKEEPERAGTRRYRLRKRGPLDYIALNEGQDVRLRHEH 138
            C  HG               + K+ P     ++Y LRK+  +DYIALNEG+D RL+ EH
Sbjct: 61  SCENHGEVLLQVKQQARKR--KQKDPPPTGNDKKYGLRKKKKIDYIALNEGEDRRLKDEH 118

Query: 139 PHRAAFQGCFTKWSGLGRTVTSAELQQSFAELREPVLVADPEHSGMQTPAMDE------- 191
           PH  AF  CF KWS     ++S  L+ +F  +  P+ V DPE+SGM+ P + E       
Sbjct: 119 PHIPAFLKCFDKWSNTTNIISSESLEATFDSITVPLKVKDPENSGMKIPTVQELGRENME 178

Query: 192 --------QVLADVLGADYSLDVMDVQSQQNERWTMGQWKEYM-HTARGVRDRIRNVISL 242
                     +A VLG DY LDVMDVQ+QQN  WT+ QW +Y   T    RDRIRNVISL
Sbjct: 179 NESSKITVNDIARVLGDDYPLDVMDVQTQQNSDWTISQWNDYFSKTPTEQRDRIRNVISL 238

Query: 243 EVSHVPEFGQRIRRPRAVEDNDLVDLVWP-VQPAPEIGAKPKVQKYVLMSAANAYTDFHL 301
           EVSHV +F   IRRP AVE NDL DLVW  V        +PKV KY+LMS  NAYTDFHL
Sbjct: 239 EVSHVQQFRDGIRRPTAVEVNDLADLVWEDVVDKKSDVPRPKVTKYILMSVGNAYTDFHL 298

Query: 302 DFAGTSVYYSLLRGAKQFLLFPPTPANLGAYKAWCADDNQGLIFLGDRLQDGVLFSLRPG 361
           DFAGTSVYY+++ G K+F+LFPPT  NLG YK WC  D+Q L+FLGD L+DGV   L  G
Sbjct: 299 DFAGTSVYYNVISGKKKFILFPPTIHNLGQYKRWCDSDHQNLVFLGDMLEDGVAMELNSG 358

Query: 362 DLFMIPSGFIHAVYTPEDSFVVGGNYLCLRDLSTHIRIVRIEQETQVPKKFTFPKFERVM 421
           DLFMIP G+IHAVYTP DS VVGGN+L LRD++T ++IV IE+ T+VPK+FTFP F+ VM
Sbjct: 359 DLFMIPCGYIHAVYTPIDSLVVGGNFLTLRDITTQLKIVEIERLTKVPKRFTFPHFDIVM 418

Query: 422 GLTAEWLLEGLPERLQLITHEHAVALLDYLRDTRLKYKPAHYHTKSTMLASLEKAL 477
           G T EW+L    +  + I  EH   L+ ++ D ++KYKP +Y  K  +L  LEK +
Sbjct: 419 GKTCEWVL----KHRKAIPDEHIKTLISHMSDPKVKYKPVNYRNKKELLQELEKKV 470

>KLLA0F27643g complement(2561213..2562649) similar to sp|P40034
           Saccharomyces cerevisiae YER051w singleton, start by
           similarity
          Length = 478

 Score =  448 bits (1153), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 224/473 (47%), Positives = 296/473 (62%), Gaps = 32/473 (6%)

Query: 30  QCVYCKGKMEHR----MWVQCEACPQWVHVQCIPEE-CLSGGEYPS-----RSSDIAAFE 79
           +C +CK          +WV CE C  W H+ C+P +  +   E PS     +   + +F+
Sbjct: 7   KCHFCKKDDSEDKGQPIWVGCEFCDGWCHLTCVPIQFVVPKLENPSQLLAFKEKHVESFK 66

Query: 80  CSAHGTXXXXXXXXXXXXXVEAKEEPERAGTRRYRLRKRGPLDYIALNEGQDVRLRHEHP 139
           C+ H               V    E + A T+R RLR + P+DYIALNEG D RL+HEHP
Sbjct: 67  CTLHD---ESKCALLKLNGVSVGTE-DIAFTKRNRLRNKRPIDYIALNEGNDKRLKHEHP 122

Query: 140 HRAAFQGCFTKWSGLGRTVTSAELQQSFAELREPVLVADPEHSGMQTPAMDEQVLAD--- 196
           H  AF  CF KW    + ++S+EL+  F  ++ P+ V+DP  SGM   + +E  L D   
Sbjct: 123 HTQAFLACFEKWKD-PKAISSSELESDFQIIKVPLRVSDPADSGMYVISANELGLVDSKD 181

Query: 197 -----------VLGADYSLDVMDVQSQQNERWTMGQWKEYM-HTARGVRDRIRNVISLEV 244
                      ++G DY LDVMDVQ+Q NE+WT+ QW EY  HT+   RDRIRNVISLEV
Sbjct: 182 HVKLNVEYLTKIMGDDYPLDVMDVQTQMNEKWTLSQWNEYYSHTSPSDRDRIRNVISLEV 241

Query: 245 SHVPEFGQRIRRPRAVEDNDLVDLVWPVQPAPEIGAKPKVQKYVLMSAANAYTDFHLDFA 304
           SHV  F   IRRP AV +NDLVD+VW          +PKV KY+LMS  NAYTDFHLDFA
Sbjct: 242 SHVESFKDGIRRPNAVNNNDLVDIVWNFGRTETDIERPKVTKYILMSVGNAYTDFHLDFA 301

Query: 305 GTSVYYSLLRGAKQFLLFPPTPANLGAYKAWCADDNQGLIFLGDRLQDGVLFSLRPGDLF 364
           GTSVYY+++ G+K+F+LFPPT  NL  Y+ WC +DNQ  IFLGD+L+ G+   L  G+LF
Sbjct: 302 GTSVYYNVISGSKKFILFPPTDYNLKKYREWCDNDNQNDIFLGDQLEAGIAMELTEGNLF 361

Query: 365 MIPSGFIHAVYTPEDSFVVGGNYLCLRDLSTHIRIVRIEQETQVPKKFTFPKFERVMGLT 424
           MIP G+IHAVYTPEDSF+VGGN+L LRD++T + +V IE +T+VPKKFTFP+FE VMG T
Sbjct: 362 MIPCGYIHAVYTPEDSFIVGGNFLTLRDITTQLNVVEIEHQTKVPKKFTFPQFESVMGKT 421

Query: 425 AEWLLEGLPERLQLITHEHAVALLDYLRDTRLKYKPAHYHTKSTMLASLEKAL 477
            EWLL    + +Q I+ E    L+ YL  + +KYKP +Y +K  ++  L+  +
Sbjct: 422 CEWLLNS--DHIQSISSEDIENLVKYLSSSNIKYKPINYQSKKELITELKNKI 472

>YER051W (YER051W) [1479] chr5 (254655..256133) Protein containing a
           PHD-finger, which may be involved in chromatin-mediated
           transcriptional regulation, and a Jumonji (jmjC) domain,
           has low similarity to uncharacterized C. albicans
           Orf6.8281p [1479 bp, 492 aa]
          Length = 492

 Score =  382 bits (982), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 199/472 (42%), Positives = 277/472 (58%), Gaps = 44/472 (9%)

Query: 42  MWVQCEACPQWVHVQCIPEE-----CLSGGE---YPSRSSDIAAFECSAHGTXXXXXXXX 93
           +WV+C++CPQWVHV+C+P +      L+  E   YP+ +  I ++ C  H          
Sbjct: 20  IWVKCDSCPQWVHVKCVPLKRIHYSNLTSSEVLSYPNSAKQIKSYRCPNHKEGEYLTAYA 79

Query: 94  XXXXXVE---AKEEPERAG-TRRYRLRKRGPLDYIALNEGQDVRLRHEHPHRAAFQGCFT 149
                 +    KE PE +   +RY  RK+  LDYIALNEG+  R +  HPH+ +F   F 
Sbjct: 80  LITQKGKRQRNKENPEDSHINKRYNFRKKKLLDYIALNEGESKRDKMNHPHKESFMKSFE 139

Query: 150 KWSGLGRTVTSAELQQSFAELREPVLVADPEHSGMQTP-------AMDEQVLADVLGADY 202
           KW      + +A+  + F  +  P  + DP +SG+  P        +    + +++G DY
Sbjct: 140 KWKNGSNIINAADFAEKFDNIDVPYKIIDPLNSGVYVPNVGTDNGCLTVNYITEMIGEDY 199

Query: 203 SLDVMDVQSQQNERWTMGQWKEYM-HTARGVRDRIRNVISLEVSHVPEFGQRIRRPRAVE 261
            +DVMDVQSQ NE W +G W EY  +T    RDRIRNVISLEVS++   G  + RP AV 
Sbjct: 200 HVDVMDVQSQMNENWNLGSWNEYFTNTEPDRRDRIRNVISLEVSNIE--GLELERPTAVR 257

Query: 262 DNDLVDLVWPV---------QPAPEIGAKPKVQKYVLMSAANAYTDFHLDFAGTSVYYSL 312
            NDLVD +W           + A E   KPKV KY+LMS  +AYTDFHLDFAGTSVYY++
Sbjct: 258 QNDLVDKIWSFNGHLEKVNGEKAEENDPKPKVTKYILMSVKDAYTDFHLDFAGTSVYYNV 317

Query: 313 LRGAKQFLLFPPTPANLGAYKAWCADDNQGLIFLGDRLQDGVLFSLRPGDLFMIPSGFIH 372
           + G K+FLLFPPT +N+  Y  W   ++Q  +FLGD L+DG+   L  GDLFMIP+G+IH
Sbjct: 318 ISGQKKFLLFPPTQSNIDKYIEWSLKEDQNSVFLGDILEDGIAMELDAGDLFMIPAGYIH 377

Query: 373 AVYTPEDSFVVGGNYLCLRDLSTHIRIVRIEQETQVPKKFTFPKFERVMGLTAEWLL--- 429
           AVYTP DS V GGN+L +RDL TH++IV IE+ T+VP++FTFPKF++VMG   E+L    
Sbjct: 378 AVYTPVDSLVFGGNFLTIRDLETHLKIVEIEKLTKVPRRFTFPKFDQVMGKLCEYLALDK 437

Query: 430 --------EGLPERLQLITHEHAVALLDYLRDTRLKYKPAHYHTKSTMLASL 473
                   +G  + L   T+    +L  Y+    +KYKP ++ +K  +  +L
Sbjct: 438 NKITSDVSDG--DLLSRTTNCAIQSLHAYVIKPEVKYKPLNFTSKKHLAKAL 487

>CAGL0J02860g 276002..277213 similar to sp|P40034 Saccharomyces
           cerevisiae YER051w, hypothetical start
          Length = 403

 Score =  339 bits (869), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 170/376 (45%), Positives = 236/376 (62%), Gaps = 15/376 (3%)

Query: 111 RRYRLRKRGPLDYIALNEGQDVRLRHEHPHRAAFQGCFTK-WSGLGR--TVTSAELQQSF 167
           +RY  RK+  LDY ALNEG+D + +  HPH A F+  F K  S +    ++T +E  + F
Sbjct: 25  KRYNFRKKVELDYSALNEGEDKKSKFFHPHIALFEKEFEKCLSNVTEDMSMTCSEYCKRF 84

Query: 168 AELREPVLVADPEHSGMQTPAMDEQV-------LADVLGADYSLDVMDVQSQQNERWTMG 220
            ++  P+ ++DPE+SGM     ++         +   +G DY ++VMDVQSQ+NERW++ 
Sbjct: 85  DDIDFPLKISDPENSGMVVSTNNKTTRDLTVDDITQAVGDDYFVNVMDVQSQENERWSLR 144

Query: 221 QWKEYMHTARGVRDRIRNVISLEVSHVPEFGQRIRRPRAVEDNDLVDLVWPV--QPAPEI 278
           +W  Y +     +DRIRNVISLEVSHV +   +  RP  V+D DLVD+VW        E 
Sbjct: 145 EWCNYFNKPAEEKDRIRNVISLEVSHVEDL--QYDRPDIVDDKDLVDIVWNNVENLDTEN 202

Query: 279 GAKPKVQKYVLMSAANAYTDFHLDFAGTSVYYSLLRGAKQFLLFPPTPANLGAYKAWCAD 338
             +PKV KY LMS  NA+TD+HLDFAGTSVYY+L  G K+F+L+PPTP N+  Y  W   
Sbjct: 203 DPRPKVTKYCLMSVKNAFTDYHLDFAGTSVYYNLAFGKKKFILYPPTPENIENYIEWSTS 262

Query: 339 DNQGLIFLGDRLQDGVLFSLRPGDLFMIPSGFIHAVYTPEDSFVVGGNYLCLRDLSTHIR 398
             Q ++FLG++L  GV   L  GDLFMIPSG+IH VYTPEDS + GGNYL  RD+S  ++
Sbjct: 263 TYQNMLFLGEKLTGGVAMELNGGDLFMIPSGYIHVVYTPEDSLIFGGNYLTFRDISQQLK 322

Query: 399 IVRIEQETQVPKKFTFPKFERVMGLTAEWLLEGLPERLQL-ITHEHAVALLDYLRDTRLK 457
           IV +E++T V K++TFP F+ VMG T EWL +   +  Q+ +  E    L+ Y++  + K
Sbjct: 323 IVDVEKQTGVTKRYTFPMFDEVMGRTCEWLCQNQKKGKQMQVKKETVNDLISYMKSGKTK 382

Query: 458 YKPAHYHTKSTMLASL 473
           YKP ++  K  ML  L
Sbjct: 383 YKPTNFINKKQMLQEL 398

>Kwal_56.24206
          Length = 1502

 Score = 35.8 bits (81), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 5/54 (9%)

Query: 27   TDDQCVYCKGKMEHRMWVQCEACPQWVHVQCIPEECLSGGEYPSRSSDIAAFEC 80
            +D    +C+G       V CE C +W H+ CI     + G++   SS+   F C
Sbjct: 1268 SDGHYCFCRGGDSGSRMVACEVCGEWYHMNCI-----NKGKWALASSENTVFVC 1316

>KLLA0C16203g complement(1414169..1418533) weakly similar to sp|Q03214
            Saccharomyces cerevisiae YMR176w ECM5 involved in cell
            wall biogenesis and architecture singleton, start by
            similarity
          Length = 1454

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 29/61 (47%), Gaps = 8/61 (13%)

Query: 23   LFSMT---DDQCVYCKGKMEHRMWVQCEACPQWVHVQCIPEECLSGGEYPSRSSDIAAFE 79
            L+S T   +++  +C+      + VQCE C +W H  CI     +GG++     D   F 
Sbjct: 1267 LYSSTEENNNKYCFCRRGDNGNVMVQCEICSEWYHTSCI-----NGGKWLLPEDDGTVFC 1321

Query: 80   C 80
            C
Sbjct: 1322 C 1322

>YMR176W (ECM5) [4131] chr13 (611739..615974) Protein involved in cell
            wall structure or biosynthesis [4236 bp, 1411 aa]
          Length = 1411

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 21/49 (42%), Gaps = 5/49 (10%)

Query: 33   YCKGKMEHRMWVQCEACPQWVHVQCIPEECLSGGEYPSRSSDIAAFECS 81
            +C+   E    V+CE C +W HV CI     S GE          F CS
Sbjct: 1242 FCRRVEEGTAMVECEICKEWYHVDCI-----SNGELVPPDDPNVLFVCS 1285

>Kwal_56.24115
          Length = 1485

 Score = 32.3 bits (72), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 18/31 (58%)

Query: 28  DDQCVYCKGKMEHRMWVQCEACPQWVHVQCI 58
           D +C  C G  E   WV+C+ C  +VH+ C+
Sbjct: 296 DYKCGECGGWCEKNQWVKCDECHIYVHLFCL 326

>Scas_420.2
          Length = 434

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 25/41 (60%), Gaps = 3/41 (7%)

Query: 420 VMGLTAEWL--LEGLPERLQLITHEHAVALLDYLRDTRLKY 458
           V G+ + WL  LE LP   + IT E  V +LDYL D +L+Y
Sbjct: 186 VKGIPSFWLTALENLPTVSETIT-ERDVEVLDYLTDIKLEY 225

>YJL084C (YJL084C) [2830] chr10 complement(274778..277918) Protein
           containing an N-terminal arrestin (or S-antigen) domain,
           which form an Ig-like beta-sandwich, has moderate
           similarity to uncharacterized S. cerevisiae Ykr021p
           [3141 bp, 1046 aa]
          Length = 1046

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 28/58 (48%)

Query: 255 RRPRAVEDNDLVDLVWPVQPAPEIGAKPKVQKYVLMSAANAYTDFHLDFAGTSVYYSL 312
           +R   VE  D+VD  W + P  E  +K K+       + NA  +F    +G S+Y +L
Sbjct: 97  KRQEFVEIKDIVDHTWALYPPTEQKSKKKMDASAPNESNNAANNFLTKESGASLYRTL 154

>AFL127C [3068] [Homologous to ScYMR176W (ECM5) - SH] (193474..198039)
            [4566 bp, 1521 aa]
          Length = 1521

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 4/32 (12%)

Query: 30   QCVYC---KGKMEHRMWVQCEACPQWVHVQCI 58
            Q VYC   +G +   M V+CE C +W HV CI
Sbjct: 1294 QSVYCFCRQGDVGSTM-VECEICREWYHVACI 1324

>YJR119C (YJR119C) [3011] chr10 complement(644219..646405) Protein
           containing a PHD-finger and jumonji (jmjN) and jumonji
           (jmjC) domains, has low similarity to a region of
           selected mouse cDNA on the Y homolog (human SMCY), which
           is a male-specific protein that elicits transplant
           rejection in female recipients [2187 bp, 728 aa]
          Length = 728

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 11/43 (25%), Positives = 24/43 (55%), Gaps = 2/43 (4%)

Query: 28  DDQCVYCKGKMEHRMWVQCEACPQWVHVQCI--PEECLSGGEY 68
           DD C+ C+   + +  + C++C +  H+ C+  P E +  G++
Sbjct: 235 DDACIVCRKTNDPKRTILCDSCDKPFHIYCLSPPLERVPSGDW 277

>Scas_720.39
          Length = 1455

 Score = 30.8 bits (68), Expect = 3.0,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 6/49 (12%)

Query: 33   YCKGKMEHRMWVQCEACPQWVHVQCIPEECLSGGEYPSRSSDIAAFECS 81
            +C+G     M +QCE C +W H  CI     +GG++         F CS
Sbjct: 1264 FCRGGDIGTM-IQCELCQEWYHTACI-----NGGKWNVPDDPETIFICS 1306

>YKL005C (BYE1) [3252] chr11 complement(432736..434520) Protein with
           similarity to Drosophila transcription factor TFIIS,
           contains a PHD finger [1785 bp, 594 aa]
          Length = 594

 Score = 30.4 bits (67), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 14/26 (53%)

Query: 33  YCKGKMEHRMWVQCEACPQWVHVQCI 58
           Y   +  H   VQC+ C  W H++C+
Sbjct: 84  YDAAEYSHGDMVQCDGCDTWQHIKCM 109

>Kwal_26.7914
          Length = 547

 Score = 30.0 bits (66), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 20/39 (51%), Gaps = 2/39 (5%)

Query: 20 KLLLFSMTDDQCVYCKGKMEHRMWVQCEACPQWVHVQCI 58
          + L+   TDD   Y +    H   +QC+ C  W H++C+
Sbjct: 52 RCLVCGTTDDN--YDEADDPHGDMIQCDKCNTWQHIKCM 88

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.136    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,146,599
Number of extensions: 626079
Number of successful extensions: 1203
Number of sequences better than 10.0: 20
Number of HSP's gapped: 1198
Number of HSP's successfully gapped: 20
Length of query: 477
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 372
Effective length of database: 12,961,219
Effective search space: 4821573468
Effective search space used: 4821573468
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 63 (28.9 bits)