Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL087W28728214240.0
Kwal_47.181592872838891e-120
KLLA0F27621g2812488861e-120
Sklu_2260.23502728901e-120
CAGL0L00847g2852767501e-99
Scas_704.433162777531e-99
YIL043C (CBR1)3222607462e-98
Kwal_33.142603082814481e-53
AFR439C3102704383e-52
Sklu_2184.23102714375e-52
KLLA0C16918g3102444357e-52
Scas_692.63142414306e-51
YML125C3122404253e-50
CAGL0B02519g3122374253e-50
YML087C3122483974e-46
KLLA0D04488g2962303885e-45
ACR054C3062643757e-43
YKL150W (MCR1)3022083731e-42
Kwal_23.54713122603704e-42
Scas_678.62992393661e-41
CAGL0E06424g2982233539e-40
Scas_699.4131893955e-04
KLLA0E21901g357117860.006
Kwal_55.21561349150830.016
Sklu_2216.562094770.11
YOR037W (CYC2)36677760.11
CAGL0I00990g343109740.21
YPR003C75439700.84
Kwal_55.204251036118691.1
Kwal_56.23144288988691.2
YGL045W (RIM8)54245671.6
Scas_690.2968879662.7
ACR090C36662652.8
KLLA0B12155g624111644.0
ADL306C62088635.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL087W
         (282 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL087W [1654] [Homologous to ScYIL043C (CBR1) - SH] complement(...   553   0.0  
Kwal_47.18159                                                         347   e-120
KLLA0F27621g complement(2560055..2560900) similar to sp|P38626 S...   345   e-120
Sklu_2260.2 YIL043C, Contig c2260 2185-3237                           347   e-120
CAGL0L00847g complement(104034..104891) similar to sp|P38626 Sac...   293   1e-99
Scas_704.43                                                           294   1e-99
YIL043C (CBR1) [2624] chr9 complement(274071..275039) Cytochrome...   291   2e-98
Kwal_33.14260                                                         177   1e-53
AFR439C [3631] [Homologous to ScYML125C - SH; ScYML087C - SH] (1...   173   3e-52
Sklu_2184.2 YML125C, Contig c2184 1732-2664 reverse complement        172   5e-52
KLLA0C16918g 1478540..1479472 similar to sp|Q12746 Saccharomyces...   172   7e-52
Scas_692.6                                                            170   6e-51
YML125C (YML125C) [3847] chr13 complement(20762..21700) Protein ...   168   3e-50
CAGL0B02519g 240486..241424 highly similar to sp|Q12746 Saccharo...   168   3e-50
YML087C (YML087C) [3882] chr13 complement(94431..95369) Protein ...   157   4e-46
KLLA0D04488g complement(381861..382751) similar to sp|P36060 Sac...   154   5e-45
ACR054C [1102] [Homologous to ScYKL150W (MCR1) - SH] (454023..45...   149   7e-43
YKL150W (MCR1) [3118] chr11 (166549..167457) NADH-cytochrome b5 ...   148   1e-42
Kwal_23.5471                                                          147   4e-42
Scas_678.6                                                            145   1e-41
CAGL0E06424g 644026..644922 similar to sp|P36060 Saccharomyces c...   140   9e-40
Scas_699.41                                                            41   5e-04
KLLA0E21901g 1946190..1947263 similar to sp|P38909 Saccharomyces...    38   0.006
Kwal_55.21561                                                          37   0.016
Sklu_2216.5 YPR048W, Contig c2216 7954-9816 reverse complement         34   0.11 
YOR037W (CYC2) [4849] chr15 (401554..402654) Cytochrome c mitoch...    34   0.11 
CAGL0I00990g complement(81437..82468) similar to sp|P38909 Sacch...    33   0.21 
YPR003C (YPR003C) [5439] chr16 complement(561499..563763) Protei...    32   0.84 
Kwal_55.20425                                                          31   1.1  
Kwal_56.23144                                                          31   1.2  
YGL045W (RIM8) [1932] chr7 (414104..415732) Protein of unknown f...    30   1.6  
Scas_690.29                                                            30   2.7  
ACR090C [1137] [Homologous to ScYOR037W (CYC2) - SH] (519431..52...    30   2.8  
KLLA0B12155g complement(1062000..1063874) similar to sgd|S000625...    29   4.0  
ADL306C [1435] [Homologous to ScYPR048W (TAH18) - SH] (158654..1...    29   5.3  

>ADL087W [1654] [Homologous to ScYIL043C (CBR1) - SH]
           complement(532195..533058) [864 bp, 287 aa]
          Length = 287

 Score =  553 bits (1424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/282 (95%), Positives = 270/282 (95%)

Query: 1   MDYKFEALVTALVLAVSFIFIYGKFSGAKQSQPAVKTTLNKDWQEFSLLTKTVLTHNTAI 60
           MDYKFEALVTALVLAVSFIFIYGKFSGAKQSQPAVKTTLNKDWQEFSLLTKTVLTHNTAI
Sbjct: 1   MDYKFEALVTALVLAVSFIFIYGKFSGAKQSQPAVKTTLNKDWQEFSLLTKTVLTHNTAI 60

Query: 61  YRFGLPEADAVLGLPIGQHISISGVIDGKEMLRSYTPTSLDSDATGYFELLVKSYEKGNI 120
           YRFGLPEADAVLGLPIGQHISISGVIDGKEMLRSYTPTSLDSDATGYFELLVKSYEKGNI
Sbjct: 61  YRFGLPEADAVLGLPIGQHISISGVIDGKEMLRSYTPTSLDSDATGYFELLVKSYEKGNI 120

Query: 121 SKMLAELAIGDRIKVRGPKGFYHYEPNMYKEIGMIAGGTGISPMYQIIRAIFSNPRDKTR 180
           SKMLAELAIGDRIKVRGPKGFYHYEPNMYKEIGMIAGGTGISPMYQIIRAIFSNPRDKTR
Sbjct: 121 SKMLAELAIGDRIKVRGPKGFYHYEPNMYKEIGMIAGGTGISPMYQIIRAIFSNPRDKTR 180

Query: 181 VCLVYGNQTKDDILLKPELDAMVAAKPDQFKILYMLDKVAEGEQWEGKLGYITEAIMREH 240
           VCLVYGNQTKDDILLKPELDAMVAAKPDQFKILYMLDKVAEGEQWEGKLGYITEAIMREH
Sbjct: 181 VCLVYGNQTKDDILLKPELDAMVAAKPDQFKILYMLDKVAEGEQWEGKLGYITEAIMREH 240

Query: 241 XXXXXXXXXXXXCGPPPMVSSAKRIAVSLGFEKAKPISKKGD 282
                       CGPPPMVSSAKRIAVSLGFEKAKPISKKGD
Sbjct: 241 LPAPSSSAQLLLCGPPPMVSSAKRIAVSLGFEKAKPISKKGD 282

>Kwal_47.18159
          Length = 287

 Score =  347 bits (889), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 165/283 (58%), Positives = 217/283 (76%), Gaps = 5/283 (1%)

Query: 1   MDYKFEALVTALVLAVSFIFIYGKFSGAKQSQPAVKTTLNKDWQEFSLLTKTVLTHNTAI 60
           + +  + ++   ++A+  ++   +   +K S+P +   L  ++QEF L++KTVLTHNTA+
Sbjct: 4   LPFSLKTILIGGLIALGAVYFVSQLLSSKASKPIL---LKDEFQEFPLVSKTVLTHNTAV 60

Query: 61  YRFGLPEADAVLGLPIGQHISISGVI-DGKEMLRSYTPTSLDSDATGYFELLVKSYEKGN 119
           YRFGLP+   VLGLPIGQHISI G + DGKE++RSYTPTSLDSD+ G+FELL+KSYE+GN
Sbjct: 61  YRFGLPKHTDVLGLPIGQHISIQGTLKDGKEIMRSYTPTSLDSDSVGFFELLIKSYEQGN 120

Query: 120 ISKMLAELAIGDRIKVRGPKGFYHYEPNMYKEIGMIAGGTGISPMYQIIRAIFSNPRDKT 179
           +SKM+ EL IGD+IKVRGPKGFY Y PNM  EIGMIAGGTGI+PMYQII++I S+P+D+T
Sbjct: 121 VSKMIGELQIGDKIKVRGPKGFYTYTPNMNSEIGMIAGGTGIAPMYQIIKSIHSDPKDRT 180

Query: 180 RVCLVYGNQTKDDILLKPELDAMVAAKPDQFKILYMLDKVAEGEQWEGKLGYITEAIMRE 239
           +V ++YG+QT+DDILLK E+DA+V + PDQFK+ Y+LDK A  + W G +GY+T  +M+E
Sbjct: 181 KVSIIYGSQTEDDILLKKEIDAIVESNPDQFKVHYLLDKPAR-DTWTGGVGYVTAEVMKE 239

Query: 240 HXXXXXXXXXXXXCGPPPMVSSAKRIAVSLGFEKAKPISKKGD 282
           H            CGPP MVSS KR AV+LGFEKAKPISK GD
Sbjct: 240 HLPAAGDGVQLLVCGPPGMVSSIKRNAVALGFEKAKPISKMGD 282

>KLLA0F27621g complement(2560055..2560900) similar to sp|P38626
           Saccharomyces cerevisiae YIL043c CBR1 cytochrome-b5
           reductase, hypothetical start
          Length = 281

 Score =  345 bits (886), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 169/248 (68%), Positives = 198/248 (79%), Gaps = 3/248 (1%)

Query: 36  KTTLNKD-WQEFSLLTKTVLTHNTAIYRFGLPEADAVLGLPIGQHISISGVIDGKEMLRS 94
           K  L+K+  QEF L+ KTVLTHNTAIYRFGLP++  VLGLPIGQHIS+   I+GK++LRS
Sbjct: 31  KPVLDKEKLQEFPLVAKTVLTHNTAIYRFGLPKSTQVLGLPIGQHISVQANINGKDILRS 90

Query: 95  YTPTSLDSDATGYFELLVKSYEKGNISKMLAELAIGDRIKVRGPKGFYHYEPNMYKEIGM 154
           YTPTSLDSDA G+FELL+KSYEKGNISK  A+L IGD+IKVRGPKGFYHY+PNM +EIGM
Sbjct: 91  YTPTSLDSDAVGHFELLIKSYEKGNISKHFAQLNIGDKIKVRGPKGFYHYQPNMNEEIGM 150

Query: 155 IAGGTGISPMYQIIRAIFSNPRDKTRVCLVYGNQTKDDILLKPELDAMVAAKPDQFKILY 214
           IAGGTGI+PMYQI+++IF+N  DKT+V LVYGNQT++DILLK ELDA V  KPDQFK+ Y
Sbjct: 151 IAGGTGIAPMYQIMKSIFANDSDKTKVSLVYGNQTEEDILLKKELDAFVERKPDQFKVYY 210

Query: 215 MLDKVAEGEQWEGKLGYITEAIMREHXXXXXXXXXXXXCGPPPMVSSAKRIAVSLGFEKA 274
           +LDK  E   W G +GYIT   M+E             CGPPPMVSS KR AV+LG+EKA
Sbjct: 211 LLDKAPEA--WTGGVGYITVDTMKERLPAPAEGVQLLVCGPPPMVSSIKRNAVTLGYEKA 268

Query: 275 KPISKKGD 282
           KPISK GD
Sbjct: 269 KPISKMGD 276

>Sklu_2260.2 YIL043C, Contig c2260 2185-3237
          Length = 350

 Score =  347 bits (890), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 170/272 (62%), Positives = 207/272 (76%), Gaps = 4/272 (1%)

Query: 11  ALVLAVSFIFIYGKFSGAKQSQPAVKTTLNKDWQEFSLLTKTVLTHNTAIYRFGLPEADA 70
           A VL ++   I  K   +K ++P +   +   +Q+F L++KTVLTHNTA+YRFGLP+   
Sbjct: 14  ATVLVIAVFAIINKTLSSKSARPVL---IKDQFQDFPLISKTVLTHNTAVYRFGLPKPTD 70

Query: 71  VLGLPIGQHISISGVIDGKEMLRSYTPTSLDSDATGYFELLVKSYEKGNISKMLAELAIG 130
           VLGLPIGQHISI G+IDGKE++RSYTPTSLDSDATG+FELL+KSYEKGNISKM+ EL IG
Sbjct: 71  VLGLPIGQHISIQGIIDGKEIVRSYTPTSLDSDATGHFELLIKSYEKGNISKMIGELKIG 130

Query: 131 DRIKVRGPKGFYHYEPNMYKEIGMIAGGTGISPMYQIIRAIFSNPRDKTRVCLVYGNQTK 190
           DRIKVRGPKGFY Y  NM   + M+AGGTGI+PMYQII+AI  N +DKT+V LVYGN ++
Sbjct: 131 DRIKVRGPKGFYTYTANMNSSLAMVAGGTGIAPMYQIIKAISVNLQDKTKVALVYGNVSE 190

Query: 191 DDILLKPELDAMVAAKPDQFKILYMLDKVAEGEQWEGKLGYITEAIMREHXXXXXXXXXX 250
           +DILLK ELDA+V + PDQFKI YMLDK    E W G +GY+T  +M+E+          
Sbjct: 191 EDILLKKELDAIVESNPDQFKIHYMLDK-PTSETWNGGIGYVTADVMKEYLPAAGEGVQL 249

Query: 251 XXCGPPPMVSSAKRIAVSLGFEKAKPISKKGD 282
             CGPPPMVSS KR AV+LGFE+AKPISK GD
Sbjct: 250 LVCGPPPMVSSIKRNAVALGFERAKPISKMGD 281

>CAGL0L00847g complement(104034..104891) similar to sp|P38626
           Saccharomyces cerevisiae YIL043c CBR1 cytochrome-b5
           reductase, hypothetical start
          Length = 285

 Score =  293 bits (750), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 146/276 (52%), Positives = 193/276 (69%), Gaps = 3/276 (1%)

Query: 8   LVTALVLAVSF-IFIYGKFSGAKQSQPAVKTTLNKDWQEFSLLTKTVLTHNTAIYRFGLP 66
           L T  VL + + +F Y K  G  Q + AVK  L  +++EF L+ K  LTHNTA Y+F L 
Sbjct: 7   LATFSVLVLFYKLFTYSKKGGVSQKE-AVKALLKTEFREFELVEKEQLTHNTAKYKFKLA 65

Query: 67  EADAVLGLPIGQHISISGVIDGKEMLRSYTPTSLDSDATGYFELLVKSYEKGNISKMLAE 126
           +   VLGLPIGQHI++  +I GK + RSYTPTSLD +  G+FELLVKSY +GNISK + +
Sbjct: 66  DESHVLGLPIGQHITVKTIIGGKPVSRSYTPTSLDEECVGFFELLVKSYPEGNISKHIGD 125

Query: 127 LAIGDRIKVRGPKGFYHYEPNMYKEIGMIAGGTGISPMYQIIRAIFSNPRDKTRVCLVYG 186
           + IG++I + GP+GFY Y PN++K + M+AGGTGI+PM+QI++AI  +P DKTRV L+YG
Sbjct: 126 MKIGEKINISGPRGFYEYVPNVHKHLAMVAGGTGITPMFQIMKAIARDPSDKTRVTLLYG 185

Query: 187 NQTKDDILLKPELDAMVAAKPDQFKILYMLDKVAEGEQWEGKLGYITEAIMREHXXXXXX 246
           N  ++DILLK ELD +V  +PDQFKI Y+LDK  E + WEG +GY+T  +M+E       
Sbjct: 186 NVLEEDILLKQELDDLVKQRPDQFKITYLLDK-PERDDWEGGVGYVTLDLMKESFPSAEE 244

Query: 247 XXXXXXCGPPPMVSSAKRIAVSLGFEKAKPISKKGD 282
                 CGPP MVSS KR AV+LGF +AKP+SK  D
Sbjct: 245 DVQLLVCGPPGMVSSVKRNAVALGFPRAKPVSKMED 280

>Scas_704.43
          Length = 316

 Score =  294 bits (753), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 150/277 (54%), Positives = 192/277 (69%), Gaps = 10/277 (3%)

Query: 8   LVTALVLAVSFIFIYGKFSGAKQSQPAVKTTLNK-DWQEFSLLTKTVLTHNTAIYRFGLP 66
           +V  L LA+ +I +  +         A K  L K  + +F L++KTVLTHNTAIY FGLP
Sbjct: 43  VVFILALAIRYISMRRRIH-------ANKAVLKKGTFHKFCLVSKTVLTHNTAIYNFGLP 95

Query: 67  EADAVLGLPIGQHISISGVIDGKEMLRSYTPTSLDSDATGYFELLVKSYEKGNISKMLAE 126
            AD VLGLPIGQHISI   IDGK+++RSYTPTSLDS+  G FELLVKSY  GNISK +  
Sbjct: 96  NADDVLGLPIGQHISIKENIDGKDIMRSYTPTSLDSETKGSFELLVKSYPNGNISKFIGN 155

Query: 127 LAIGDRIKVRGPKGFYHYEPNMYKEIGMIAGGTGISPMYQIIRAIFSNPRDKTRVCLVYG 186
           L IGD I V GP G YHYEPN   ++GMIAGGTGI+PM+QI++AI+ NP+D T V L+YG
Sbjct: 156 LNIGDEINVCGPAGNYHYEPNCRNKLGMIAGGTGIAPMFQIMKAIYLNPKDTTEVTLLYG 215

Query: 187 NQTKDDILLKPELDAMVAAKPDQFKILYMLDKVAEGEQWEGKLGYITEAIMREHX-XXXX 245
           N  + DILL+ ELD MV  +PDQFK++Y+LDK  + + WEG++GY+T  +M ++      
Sbjct: 216 NVQEADILLRKELDEMVKMRPDQFKVIYLLDK-TDRDDWEGEIGYVTLDLMEKYMPSPKE 274

Query: 246 XXXXXXXCGPPPMVSSAKRIAVSLGFEKAKPISKKGD 282
                  CGPP MV SAKR AV++G+ + KP+SK  D
Sbjct: 275 EGVQMLLCGPPRMVGSAKRNAVTMGYARGKPLSKMED 311

>YIL043C (CBR1) [2624] chr9 complement(274071..275039) Cytochrome b5
           reductase, converts 2 ferricytochrome B5 + NADH to 2
           ferrocytochrome B5 + NAD(+), uses FAD cofactor [969 bp,
           322 aa]
          Length = 322

 Score =  291 bits (746), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 143/260 (55%), Positives = 185/260 (71%), Gaps = 3/260 (1%)

Query: 24  KFSGAKQSQPAVKTTLNKDWQEFSLLTKTVLTHNTAIYRFGLPEADAVLGLPIGQHISIS 83
           KF    +++P +    N D+Q F L+ KT+LTHNT++Y+FGLP AD VLGLPIGQHI I 
Sbjct: 60  KFIIGPKTKPVLDPKRN-DFQSFPLVEKTILTHNTSMYKFGLPHADDVLGLPIGQHIVIK 118

Query: 84  GVIDGKEMLRSYTPTSLDSDATGYFELLVKSYEKGNISKMLAELAIGDRIKVRGPKGFYH 143
             I+GK++ RSYTPTSLD D  G FELLVKSY  GN+SKM+ EL IGD I+++GP+G YH
Sbjct: 119 ANINGKDITRSYTPTSLDGDTKGNFELLVKSYPTGNVSKMIGELKIGDSIQIKGPRGNYH 178

Query: 144 YEPNMYKEIGMIAGGTGISPMYQIIRAIFSNPRDKTRVCLVYGNQTKDDILLKPELDAMV 203
           YE N    +GMIAGGTGI+PMYQI++AI  +P D T+V LV+GN  ++DILLK EL+A+V
Sbjct: 179 YERNCRSHLGMIAGGTGIAPMYQIMKAIAMDPHDTTKVSLVFGNVHEEDILLKKELEALV 238

Query: 204 AAKPDQFKILYMLDKVAEGEQWEGKLGYITEAIMREHX-XXXXXXXXXXXCGPPPMVSSA 262
           A KP QFKI+Y LD   + E W G +GYIT+ +++EH             CGPP MV+S 
Sbjct: 239 AMKPSQFKIVYYLDS-PDREDWTGGVGYITKDVIKEHLPAATMDNVQILICGPPAMVASV 297

Query: 263 KRIAVSLGFEKAKPISKKGD 282
           +R  V LGF ++KP+SK  D
Sbjct: 298 RRSTVDLGFRRSKPLSKMED 317

>Kwal_33.14260
          Length = 308

 Score =  177 bits (448), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 100/281 (35%), Positives = 152/281 (54%), Gaps = 12/281 (4%)

Query: 2   DYKFEALVTALVLAVSFIFIYGKFSGAKQSQPAVKTTLNKDWQEFSLLTKTVLTHNTAIY 61
           DYKF  ++    + V F F+    +  K+     K+     W    L  +T+L+ NTA+Y
Sbjct: 35  DYKFLWILPFAAVIVGFRFL----TAYKRR----KSVFPDKWSALELEDQTLLSKNTAMY 86

Query: 62  RFGLPEADAVLGLPIGQHISISGVIDGKEMLRSYTPTSLDSDATGYFELLVKSYEKGNIS 121
           RF +  +   L  P+G H+++   IDGK+ +R YTP S      GYF+++VKSY  G +S
Sbjct: 87  RFKMKTSFETLNFPVGHHLAVRVPIDGKDQIRYYTPVSPQYQP-GYFDIIVKSYADGQVS 145

Query: 122 KMLAELAIGDRIKVRGPKGFYHYEPNMYKEIGMIAGGTGISPMYQIIRAIFSNPRDKTRV 181
           K  A L  G  +  +GP G ++Y  N YK+IGMIAGG+GI+PM QI+  I + P D T+V
Sbjct: 146 KYFAGLKAGSAVDFKGPVGRFNYVVNSYKQIGMIAGGSGITPMLQILNKIITTPEDLTKV 205

Query: 182 CLVYGNQTKDDILLKPELDAMVAAKPDQFKILYMLDKVAEGEQWEGKLGYITEAIMREHX 241
            L+Y N+T++DILLK E+D +    P+ F++ Y+L        W+G +G +T  +M+++ 
Sbjct: 206 SLIYANETENDILLKEEIDEIAEKYPN-FEVHYVLR--TPSSTWKGDVGLVTNELMQKYL 262

Query: 242 XXXXXXXXXXXCGPPPMVSSAKRIAVSLGFEKAKPISKKGD 282
                       G P M+      A  LG+ K    SK  D
Sbjct: 263 PISSSDNRLVMSGKPEMIRMLLEYAEELGWPKGIEKSKGDD 303

>AFR439C [3631] [Homologous to ScYML125C - SH; ScYML087C - SH]
           (1228716..1229648) [933 bp, 310 aa]
          Length = 310

 Score =  173 bits (438), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 96/270 (35%), Positives = 153/270 (56%), Gaps = 8/270 (2%)

Query: 13  VLAVSFIFIYGKFSGAKQSQPAVKTTLNKDWQEFSLLTKTVLTHNTAIYRFGLPEADAVL 72
           +LA++ +F+  +   A +S+ ++   L  +W    L  + VL+ N AIYRF L  +   L
Sbjct: 44  ILALA-MFVGARLLLAYRSRTSI---LPNEWTPLELEERIVLSKNAAIYRFKLRSSVETL 99

Query: 73  GLPIGQHISISGVIDGKEMLRSYTPTSLDSDATGYFELLVKSYEKGNISKMLAELAIGDR 132
            +P G H++   ++DG E +R YTP S +  A G+F+++VKSY  G +SK  A L  G  
Sbjct: 100 DIPTGFHLAAKVMLDGVEEVRYYTPIS-NKFAEGHFDIIVKSYVDGKVSKWFAGLQPGQT 158

Query: 133 IKVRGPKGFYHYEPNMYKEIGMIAGGTGISPMYQIIRAIFSNPRDKTRVCLVYGNQTKDD 192
           ++ +GP G + Y  N YK+IGM+ GG+ I+PM  ++  I + P D T+VCL+Y N+T++D
Sbjct: 159 VEFKGPVGRFSYVTNAYKKIGMVTGGSAITPMLSVLNKIVTTPEDTTQVCLIYANETEND 218

Query: 193 ILLKPELDAMVAAKPDQFKILYMLDKVAEGEQWEGKLGYITEAIMREHXXXXXXXXXXXX 252
           ILLK ELD + +  P+ F++ Y++ K      W G++GY+T+  + ++            
Sbjct: 219 ILLKDELDDLASKYPN-FEVHYVVRK--PSASWTGEVGYVTKQHLEKYLPPCNPAHRLLI 275

Query: 253 CGPPPMVSSAKRIAVSLGFEKAKPISKKGD 282
           CGPP M       A  LG+ K    SK  D
Sbjct: 276 CGPPKMKQMVLEYAEQLGWPKGAMKSKPED 305

>Sklu_2184.2 YML125C, Contig c2184 1732-2664 reverse complement
          Length = 310

 Score =  172 bits (437), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 97/271 (35%), Positives = 150/271 (55%), Gaps = 11/271 (4%)

Query: 12  LVLAVSFIFIYGKFSGAKQSQPAVKTTLNKDWQEFSLLTKTVLTHNTAIYRFGLPEADAV 71
           ++LA+     Y  +S  K   P         W    L  + +++ N+AIYRF L  +   
Sbjct: 46  ILLALLGFRFYSAYSRRKSVYPNA-------WTALELEDQILISKNSAIYRFKLKTSLET 98

Query: 72  LGLPIGQHISISGVIDGKEMLRSYTPTSLDSDATGYFELLVKSYEKGNISKMLAELAIGD 131
           L +P+G H+++   I+GK  +R YTP +   D TG+F+++VKSY  G +SK  A L  G 
Sbjct: 99  LKIPVGHHLAVKIPIEGKNEIRYYTPITQRYD-TGHFDIIVKSYTDGKVSKYFASLKPGQ 157

Query: 132 RIKVRGPKGFYHYEPNMYKEIGMIAGGTGISPMYQIIRAIFSNPRDKTRVCLVYGNQTKD 191
            ++ +GP G ++Y  N  K IGMIAGG+GI+PM Q++  I + P D T+V L+Y N+T++
Sbjct: 158 LVEFQGPVGRFNYATNSSKAIGMIAGGSGITPMLQVLSQIVTTPEDTTKVSLIYANETEN 217

Query: 192 DILLKPELDAMVAAKPDQFKILYMLDKVAEGEQWEGKLGYITEAIMREHXXXXXXXXXXX 251
           DILLK ELD M    P+ F++ Y+L K + G  W G  GY+T+  M+++           
Sbjct: 218 DILLKDELDEMADKYPN-FEVHYVLHKPSPG--WTGDTGYVTKDQMQKYLPGPSDENRLL 274

Query: 252 XCGPPPMVSSAKRIAVSLGFEKAKPISKKGD 282
            CGP  M++     +  LG+ +    SK  D
Sbjct: 275 ICGPLAMINMLLNYSEELGWPRGIVKSKPDD 305

>KLLA0C16918g 1478540..1479472 similar to sp|Q12746 Saccharomyces
           cerevisiae YML125c, start by similarity
          Length = 310

 Score =  172 bits (435), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 88/244 (36%), Positives = 143/244 (58%), Gaps = 4/244 (1%)

Query: 31  SQPAVKTTLNKDWQEFSLLTKTVLTHNTAIYRFGLPEADAVLGLPIGQHISISGVIDGKE 90
           ++  +K+  +  W    L  +T+++ NTAIYRF L  +   L +P G H+++   ++ K+
Sbjct: 58  ARSRLKSIYSDRWTALELEDQTIVSKNTAIYRFKLKTSLECLDIPTGHHLAVRIPLEDKD 117

Query: 91  MLRSYTPTSLDSDATGYFELLVKSYEKGNISKMLAELAIGDRIKVRGPKGFYHYEPNMYK 150
            +R YTP S +   TG+F+++VKSY  G +SK  A L  G  +  +GP G + YE N  K
Sbjct: 118 EIRYYTPIS-NKFETGHFDIMVKSYADGQVSKYFASLRPGQTVDFKGPVGRFAYEANSSK 176

Query: 151 EIGMIAGGTGISPMYQIIRAIFSNPRDKTRVCLVYGNQTKDDILLKPELDAMVAAKPDQF 210
            IGMIAGG+G++PM Q++  I + P D TRV L+Y N+T++DILLK ELD +    P+ F
Sbjct: 177 HIGMIAGGSGLTPMLQVLNTIITTPTDLTRVTLLYANETENDILLKDELDEISEKYPN-F 235

Query: 211 KILYMLDKVAEGEQWEGKLGYITEAIMREHXXXXXXXXXXXXCGPPPMVSSAKRIAVSLG 270
            + Y+++  +    W+G++G++T+ IM ++            CG P M  +  + A  LG
Sbjct: 236 LVHYLVNHPS--SSWQGEVGWVTKEIMSKYLPDPSAENRLLICGKPEMKKTLLKYAEELG 293

Query: 271 FEKA 274
           + K 
Sbjct: 294 WPKG 297

>Scas_692.6
          Length = 314

 Score =  170 bits (430), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 94/241 (39%), Positives = 140/241 (58%), Gaps = 7/241 (2%)

Query: 43  WQEFSLLTKTVLTHNTAIYRFGLPEADAVLGLPIGQHISISGVIDGKEMLRSYTPTSLDS 102
           W    L  +TV++ NTA+YRF L      L +P G HI++   ID KE +R Y P S   
Sbjct: 74  WTSLELDDQTVVSKNTALYRFKLKTNLESLDIPAGYHIAVRVFIDDKEEIRYYNPISSKL 133

Query: 103 DATGYFELLVKSYEKGNISKMLAELAIGDRIKVRGPKGFYHYEPNMYKEIGMIAGGTGIS 162
           D TG+F+LL+KSY  G +SK  A L  GD ++ +GP G  HY PN  K +G++AGG+GI+
Sbjct: 134 D-TGHFDLLIKSYADGKVSKYFAGLKPGDTVEFKGPIGELHYAPNSSKALGIVAGGSGIT 192

Query: 163 PMYQIIRAIFSNPRDKTRVCLVYGNQTKDDILLKPELDAMVAAKPDQFKILYMLDKVAEG 222
           P+ Q++  I + P D T++ L+Y N T++DILLK ELD M    P  F++ Y++   +E 
Sbjct: 193 PVLQMLNEIITVPEDLTKLSLIYANDTENDILLKDELDEMSEKYP-HFEVHYVVRNPSES 251

Query: 223 EQWEGKLGYITEAIMREHXXXXXXXXXXXXCGPPPMVSSAKRIAVSLGFEKAKPISK-KG 281
             WEG +G +++  M ++            CGP  M     + A  LG++++  +SK KG
Sbjct: 252 --WEGDVGLVSKEQMEKYLPKYSDDHRLLICGPEAMEKMVVKYAEELGWKQS--VSKNKG 307

Query: 282 D 282
           D
Sbjct: 308 D 308

>YML125C (YML125C) [3847] chr13 complement(20762..21700) Protein
           with similarity to NADH-cytochrome b5 reductase [939 bp,
           312 aa]
          Length = 312

 Score =  168 bits (425), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 91/240 (37%), Positives = 136/240 (56%), Gaps = 5/240 (2%)

Query: 43  WQEFSLLTKTVLTHNTAIYRFGLPEADAVLGLPIGQHISISGVIDGKEMLRSYTPTSLDS 102
           W    L  +T+++ NTA+YRF L      L +P G H+++   IDGK+ +R Y P S   
Sbjct: 72  WTSLELEDQTIISKNTALYRFKLKTRLESLDIPAGHHVAVRVPIDGKQEVRYYNPISSKL 131

Query: 103 DATGYFELLVKSYEKGNISKMLAELAIGDRIKVRGPKGFYHYEPNMYKEIGMIAGGTGIS 162
           ++ GY +L+VK+Y  G +SK  A L  GD +  +GP G  +YEPN  K +G++AGG+GI+
Sbjct: 132 ES-GYLDLVVKAYVDGKVSKYFAGLNSGDTVDFKGPIGTLNYEPNSSKHLGIVAGGSGIT 190

Query: 163 PMYQIIRAIFSNPRDKTRVCLVYGNQTKDDILLKPELDAMVAAKPDQFKILYMLDKVAEG 222
           P+ QI+  I + P D T+V L+Y N+T++DILLK ELD M    P  F++ Y++      
Sbjct: 191 PVLQILNEIITVPEDLTKVSLLYANETENDILLKDELDEMAEKYP-HFQVHYVVH--YPS 247

Query: 223 EQWEGKLGYITEAIMREHXXXXXXXXXXXXCGPPPMVSSAKRIAVSLGFEKAKPISKKGD 282
           ++W G +GYIT+  M  +            CGP  M + A + A  LG+ K       GD
Sbjct: 248 DRWTGDVGYITKDQMNRYLPEYSEDNRLLICGPDGMNNLALQYAKELGW-KVNSTRSSGD 306

>CAGL0B02519g 240486..241424 highly similar to sp|Q12746
           Saccharomyces cerevisiae YML125c, start by similarity
          Length = 312

 Score =  168 bits (425), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 89/237 (37%), Positives = 132/237 (55%), Gaps = 8/237 (3%)

Query: 43  WQEFSLLTKTVLTHNTAIYRFGLPEADAVLGLPIGQHISISGVIDGKEMLRSYTPTSLDS 102
           W    L  +T+++ NTAIYRF L      + +P G H+ +   IDGKE +R+Y P S   
Sbjct: 72  WTSLELEDQTLISRNTAIYRFKLKTPLETIDIPSGHHVQVRVFIDGKEEVRNYNPISTRF 131

Query: 103 DATGYFELLVKSYEKGNISKMLAELAIGDRIKVRGPKGFYHYEPNMYKEIGMIAGGTGIS 162
           +  G+ +LLVKSY+ G +SK  A +  G+ +  RGP G   Y+PN YK IGM+ GG+GI+
Sbjct: 132 EK-GHIDLLVKSYKDGKVSKYFASMKPGETVDFRGPVGSLVYKPNTYKNIGMVCGGSGIT 190

Query: 163 PMYQIIRAIFSNPRDKTRVCLVYGNQTKDDILLKPELDAMVAAKPDQFKILYMLDKVAEG 222
           P  Q++  I + P D T++ L+Y N+T+ DILLK ELD M    P  F + Y++ +    
Sbjct: 191 PALQMLNDIITVPEDLTKLSLIYCNETEKDILLKEELDEMAEKYP-HFNVHYIVSQPT-- 247

Query: 223 EQWEGKLGYITEAIMREHXXXXXXXXXXXXCGPP----PMVSSAKRIAVSLGFEKAK 275
            QWEG++G+I++  M +H            CGP      +   AK I   + + K K
Sbjct: 248 GQWEGEVGHISKETMVKHLPHPADDSRLLICGPEGFTQKVFDQAKEIGWKMDYTKTK 304

>YML087C (YML087C) [3882] chr13 complement(94431..95369) Protein
           containing an oxidoreductase FAD-binding domain and an
           oxidoreductase FAD or NAD-binding domain, has moderate
           similarity to cytochrome b5 reductase (S. cerevisiae
           Cbr1p), which converts 2 ferricytochrome B5 + NADH to 2
           ferrocytochrome B5 + NAD(+) [939 bp, 312 aa]
          Length = 312

 Score =  157 bits (397), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 84/248 (33%), Positives = 138/248 (55%), Gaps = 8/248 (3%)

Query: 36  KTTLNKDWQEFSLLTKTVLTHNTAIYRFGLPEADAVLGLPIGQHISISGVIDGKEMLRSY 95
           K+     W    L  KT ++ NT++Y F L      L +P+G H+++   I+G+ ++R Y
Sbjct: 65  KSLYRNKWVALPLSKKTRISRNTSLYCFKLKYPFERLHIPMGYHLAVRVTINGERLVRYY 124

Query: 96  TPTSLDSDATGYFELLVKSYEKGNISKMLAELAIGDRIKVRGPKGFYHYEPNMYKEIGMI 155
           TP ++  +  G+ EL+VK+Y+ G +SK   +L I   ++ +GP G   Y+ +   E+G+I
Sbjct: 125 TPVNV-PNTEGHLELVVKTYKHGVVSKYFDKLKIRQYVEFKGPLGELEYDQDTATELGII 183

Query: 156 AGGTGISPMYQIIRAIFSNPRDKTRVCLVYGNQTKDDILLKPELDAMVAAKPDQFKILYM 215
           AGG+GI+P+ Q+++ I  +P D T + L+Y N+T+DDIL+K +LD M    P  FK+ Y+
Sbjct: 184 AGGSGITPVLQVLQEIIPSPEDLTHISLIYANETEDDILMKSQLDHMAKEYP-HFKVHYV 242

Query: 216 LDKVAEGEQWEGKLGYITEAIMREHXXXXXXXXXXXXCGPPPM----VSSAKRIAVSLGF 271
           + K     +W G +GY+T   M+ +            CGPP M    ++ AK +  S GF
Sbjct: 243 IHK--PNGKWNGDVGYVTLEEMKRYLPKQAEDHRLLICGPPKMNEMVLNYAKELGWSNGF 300

Query: 272 EKAKPISK 279
            K     K
Sbjct: 301 HKGNGTDK 308

>KLLA0D04488g complement(381861..382751) similar to sp|P36060
           Saccharomyces cerevisiae YKL150w MCR1 cytochrome-b5
           reductase, start by similarity
          Length = 296

 Score =  154 bits (388), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 85/230 (36%), Positives = 123/230 (53%), Gaps = 4/230 (1%)

Query: 40  NKDWQEFSLLTKTVLTHNTAIYRFGLPEADAVLGLPIGQHISISGVI-DGKEMLRSYTPT 98
           + +W +  ++    L+H+T  + F LP+ D V GL     I    V   G  ++R YTP 
Sbjct: 46  DNEWIDLPIIKIEKLSHDTKRFTFALPKKDQVSGLITASCILAKFVTPKGSNVIRPYTPV 105

Query: 99  SLDSDATGYFELLVKSYEKGNISKMLAELAIGDRIKVRGPKGFYHYEPNMYKEIGMIAGG 158
           S D+   G  EL+VK YE G  +  L  L   D +  +GP   + ++PN Y  I ++  G
Sbjct: 106 S-DNGTKGKMELVVKHYENGKFTSHLFGLKENDTVSFKGPITKWEWKPNSYDSITLLGAG 164

Query: 159 TGISPMYQIIRAIFSNPRDKTRVCLVYGNQTKDDILLKPELDAMVAAKPDQFKILYMLDK 218
           TGI+P+YQ++  I  NP D T++ L YGN+T +DILLK ELD +    PDQ KI Y +DK
Sbjct: 165 TGINPLYQLVHHIAENPEDNTKIHLYYGNKTPEDILLKSELDNLQKKYPDQVKITYFVDK 224

Query: 219 VAEGEQWEGKLGYITEAIMREHXXXXXXXXXXXXCGPPPMVSSAKRIAVS 268
            AEG  +EG+ G+IT+  +               CGPPP + +     VS
Sbjct: 225 -AEG-NFEGETGFITKDYLSHQAPKPSEKNQVFVCGPPPFMKAYSGPKVS 272

>ACR054C [1102] [Homologous to ScYKL150W (MCR1) - SH]
           (454023..454943) [921 bp, 306 aa]
          Length = 306

 Score =  149 bits (375), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 85/264 (32%), Positives = 141/264 (53%), Gaps = 12/264 (4%)

Query: 7   ALVTALVLAVSFIFIYGKFS-------GAKQSQPAVKT-TLNKDWQEFSLLTKTVLTHNT 58
           AL T  V A  +++   + +       G    Q A +T T +  W    +     ++H+T
Sbjct: 15  ALGTTAVAAAGYLYAQSRGNLSTSLNKGDVTGQAAAQTFTGDGQWHALKIAKIEQVSHDT 74

Query: 59  AIYRFGLPEADAVLGLPIGQHISISGVI-DGKEMLRSYTPTSLDSDATGYFELLVKSYEK 117
             + F LP  D V GL     +    V   G  ++R YTP S D+ A G F+L++K Y+ 
Sbjct: 75  RRFTFALPSQDHVTGLTTASALLAKYVTPKGSNVIRPYTPVS-DNMARGMFQLVIKHYDG 133

Query: 118 GNISKMLAELAIGDRIKVRGPKGFYHYEPNMYKEIGMIAGGTGISPMYQIIRAIFSNPRD 177
           G  +  L  L   D ++ +GP   + ++PNM+  I ++  GTGI+P++Q++  I  NP D
Sbjct: 134 GKFTTHLFGLKENDTVEFKGPIQKWRWDPNMFDSIVLMGAGTGITPLFQMMHHIAENPTD 193

Query: 178 KTRVCLVYGNQTKDDILLKPELDAMVAAKPDQFKILYMLDKVAEGEQWEGKLGYITEAIM 237
            T+V L+YGN+T  DILL+ EL+ + +  PDQ K+ Y +DK  EG+ ++G+ G+IT+  +
Sbjct: 194 NTKVHLLYGNKTPQDILLRKELEELASKYPDQVKVTYFVDK-PEGD-YKGEKGFITKDFL 251

Query: 238 REHXXXXXXXXXXXXCGPPPMVSS 261
           +++            CGPPP + +
Sbjct: 252 KQNLPTPGSNSHIFVCGPPPFMDA 275

>YKL150W (MCR1) [3118] chr11 (166549..167457) NADH-cytochrome b5
           reductase, mitochondrial protein that may be involved in
           the response to oxidative damage [909 bp, 302 aa]
          Length = 302

 Score =  148 bits (373), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 74/208 (35%), Positives = 121/208 (58%), Gaps = 2/208 (0%)

Query: 55  THNTAIYRFGLPEADAVLGLPIGQHISISGVI-DGKEMLRSYTPTSLDSDATGYFELLVK 113
           +H+T  + F LP  D+ +GL +   +    V   G  ++R YTP S D    G+F+L+VK
Sbjct: 65  SHDTRRFTFKLPTEDSEMGLVLASALFAKFVTPKGSNVVRPYTPVS-DLSQKGHFQLVVK 123

Query: 114 SYEKGNISKMLAELAIGDRIKVRGPKGFYHYEPNMYKEIGMIAGGTGISPMYQIIRAIFS 173
            YE G ++  L  L   D +  +GP   + ++PN +K I ++  GTGI+P+YQ+   I  
Sbjct: 124 HYEGGKMTSHLFGLKPNDTVSFKGPIMKWKWQPNQFKSITLLGAGTGINPLYQLAHHIVE 183

Query: 174 NPRDKTRVCLVYGNQTKDDILLKPELDAMVAAKPDQFKILYMLDKVAEGEQWEGKLGYIT 233
           NP DKT+V L+YGN+T  DILL+ ELDA+    PD+F + Y +D   + + ++G++ +I+
Sbjct: 184 NPNDKTKVNLLYGNKTPQDILLRKELDALKEKYPDKFNVTYFVDDKQDDQDFDGEISFIS 243

Query: 234 EAIMREHXXXXXXXXXXXXCGPPPMVSS 261
           +  ++EH            CGPPP +++
Sbjct: 244 KDFIQEHVPGPKESTHLFVCGPPPFMNA 271

>Kwal_23.5471
          Length = 312

 Score =  147 bits (370), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 85/260 (32%), Positives = 143/260 (55%), Gaps = 16/260 (6%)

Query: 10  TALVLAVSFIFIYGKFSGAK--QSQPAVKTTLNKDWQEFSLLTKTVLTHNTAIYRFGLPE 67
           TAL LAV    +   +  ++   ++P    T +  W E  +     ++H+T  + F LP+
Sbjct: 30  TALPLAVGSAALAAAYLHSRPLHNEPLKTFTGDDSWVELPIAKIEDVSHDTRRFVFSLPQ 89

Query: 68  ADAVLGLPIGQHISISGVI------DGKEMLRSYTPTSLDSDATGYFELLVKSYEKGNIS 121
            D V GL     I+ S ++       G  ++R YTP S D    G+ E ++K Y+ G ++
Sbjct: 90  EDQVSGL-----ITASALLAKLQTPKGSNVIRPYTPVS-DVSTKGHIEFVIKHYKGGKMT 143

Query: 122 KMLAELAIGDRIKVRGPKGFYHYEPNMYKEIGMIAGGTGISPMYQIIRAIFSNPRDKTRV 181
           +ML +    D +  +GP   + ++PN +  I +I  G+GI+P+YQ++  I  NP DKT++
Sbjct: 144 EMLFDKKPSDTVAFKGPIIKWEWKPNSFDSITLIGAGSGITPLYQLLHHISQNPEDKTKI 203

Query: 182 CLVYGNQTKDDILLKPELDAMVAAKPDQFKILYMLDKVAEGEQWEGKLGYITEAIMREHX 241
            L+YGN+T +DILLK EL+ + A   DQ KI + +DK AEG  ++G++G+IT+  + ++ 
Sbjct: 204 HLLYGNKTPNDILLKKELEEVQAKYADQVKIHFFVDK-AEGP-FDGEIGFITKEFLEKNV 261

Query: 242 XXXXXXXXXXXCGPPPMVSS 261
                      CGPPP + +
Sbjct: 262 PKASEKNQVFVCGPPPFMQA 281

>Scas_678.6
          Length = 299

 Score =  145 bits (366), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 79/239 (33%), Positives = 125/239 (52%), Gaps = 9/239 (3%)

Query: 42  DWQEFSLLTKTVLTHNTAIYRFGLPEADAVLGLPIGQHISISGVI-DGKEMLRSYTPTSL 100
           +W +  ++     +H+T  + F LP  DA+ GL +   I    V   G  ++R YTP S 
Sbjct: 49  NWIDLPIVKIEDESHDTKRFTFKLPSEDAITGLTLASAIFTKYVTAKGNNVVRPYTPVS- 107

Query: 101 DSDATGYFELLVKSYEKGNISKMLAELAIGDRIKVRGPKGFYHYEPNMYKEIGMIAGGTG 160
             D  G FEL++K Y  G +S  L  L   D +  +GP   + + PN +K I ++  GTG
Sbjct: 108 PLDQQGTFELVIKHYNDGKMSSHLFSLKPNDVVSFKGPIKKWQWVPNSFKSITLLGAGTG 167

Query: 161 ISPMYQIIRAIFSNPRDKTRVCLVYGNQTKDDILLKPELDAMVAAKPDQFKILYMLDKVA 220
            +P+YQ+   I  NP DKT++ + YGN+T  DILLK E + +    PDQ K+ Y +DK+ 
Sbjct: 168 TTPLYQLASHIARNPEDKTKINVFYGNKTSSDILLKKEWNELQEKYPDQVKVTYFVDKLD 227

Query: 221 EGEQWEGKLGYITEAIMREHXXXXXXXXXXXXCGPPPMVSSAKRIAVSLGFEKAKPISK 279
           +G++   +LG+I++  + ++            CGPPP +        +   EKAKP  +
Sbjct: 228 DGKENGVELGFISKEFIAKNAPGPKEDTHLFICGPPPFMK-------AYSGEKAKPTDQ 279

>CAGL0E06424g 644026..644922 similar to sp|P36060 Saccharomyces
           cerevisiae YKL150w MCR1 cytochrome-b5 reductase, start
           by similarity
          Length = 298

 Score =  140 bits (353), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 75/223 (33%), Positives = 120/223 (53%), Gaps = 3/223 (1%)

Query: 40  NKDWQEFSLLTKTVLTHNTAIYRFGLPEADAVLGLPIGQHISISGVI-DGKEMLRSYTPT 98
           ++ W +  L      +H+T  + F LP  D+V GL +   +    +   G  ++R YTP 
Sbjct: 47  DRKWIDLELEKIIEESHDTKRFFFKLPTDDSVSGLTLASAVLTKFMTPKGNPVIRPYTPV 106

Query: 99  SLDSDATGYFELLVKSYEKGNISKMLAELAIGDRIKVRGPKGFYHYEPNMYKEIGMIAGG 158
           S D    GY E ++K YE G ++  L +L   D +  +GP   + ++PN +  I ++ GG
Sbjct: 107 S-DLSEKGYIEFVIKHYEGGKMTDHLFQLKPKDTLAFQGPIPKWQWKPNSFDTITLLGGG 165

Query: 159 TGISPMYQIIRAIFSNPRDKTRVCLVYGNQTKDDILLKPELDAMVAAKPDQFKILYMLDK 218
           TGI+P+YQ++  I  N  DKT++ L YG++T  DILLK ELD +    P+Q  I Y +DK
Sbjct: 166 TGITPLYQLVHHITQNKEDKTKINLFYGSKTPSDILLKKELDDLQKKYPEQLNIQYFVDK 225

Query: 219 VAEGEQWEGKLGYITEAIMREHXXXXXXXXXXXXCGPPPMVSS 261
              G +++G  G+IT+  + ++            CGPPP + S
Sbjct: 226 DDTG-KFDGNKGFITKDFLAKNAPGPKEKTQVFVCGPPPFMDS 267

>Scas_699.41
          Length = 318

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 42/93 (45%), Gaps = 15/93 (16%)

Query: 91  MLRSYTPTSL-------------DSDATGYFELLVKSYEKGNISKMLAELAIGDRIKVRG 137
           ++R+YTP  L             D + TG     +K Y  G +++ L  L +   +++RG
Sbjct: 101 VVRNYTPVPLSFVQDHNDLIPMTDKNDTGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRG 160

Query: 138 PKGFYHYEP--NMYKEIGMIAGGTGISPMYQII 168
           P   Y ++   N   ++ M   G G+   +Q++
Sbjct: 161 PFIDYKFQETDNTKFDVSMFTAGAGVVTAFQLL 193

>KLLA0E21901g 1946190..1947263 similar to sp|P38909 Saccharomyces
           cerevisiae YOR037w CYC2 cytochrome-c mitochondrial
           import factor singleton, hypothetical start
          Length = 357

 Score = 37.7 bits (86), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 48/117 (41%), Gaps = 43/117 (36%)

Query: 91  MLRSYTPTSL-------------DSDATGYFELLVKSYEKGNISKMLAELAIGDRIKVRG 137
           ++RSYTP  L             + +A+G     +K Y++G +++ +  L +G  +++RG
Sbjct: 116 VVRSYTPLPLTIEENGAVEVLRDEENASGALTFYIKQYKQGEVARWINHLPLGHVLELRG 175

Query: 138 P---------------------------KGFYHYEPNMYKEIGMIAGGTGISPMYQI 167
           P                           K  Y Y+P    +I    GGTGI P+ Q+
Sbjct: 176 PFVEYEFPDTADEITRDRSFLWGNEDCVKDNYKYQPF---DILFFTGGTGIVPLLQM 229

>Kwal_55.21561
          Length = 349

 Score = 36.6 bits (83), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 64/150 (42%), Gaps = 42/150 (28%)

Query: 91  MLRSYTPTSLDSDATGYFELL-------------VKSYEKGNISKMLAELAIGDRIKVRG 137
           ++R+YTP  L    +G F++L             +K Y+ G +++ L+ L  G  +++RG
Sbjct: 109 VVRNYTPLPLQHVGSGEFKVLADGDNGQGKLSFYLKKYQYGEVARWLSRLPEGHILELRG 168

Query: 138 PKGFYHYEPNMYK------------------------EIGMIAGGTGISPMYQIIRAIFS 173
           P   Y + P+M                          +I     GTGI+P+ Q++   F 
Sbjct: 169 PYIDYEF-PSMDNGEKLDRSFLWGAKPSSDKLMIQPFDISAFTAGTGIAPIMQLLLTEFP 227

Query: 174 NPRDKTRVCLVYGNQTKDDI-LLKPELDAM 202
               + R+ L +  + K ++  L P LD +
Sbjct: 228 F---RGRIHLFHSCRQKSELGPLGPILDVL 254

>Sklu_2216.5 YPR048W, Contig c2216 7954-9816 reverse complement
          Length = 620

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 46/94 (48%), Gaps = 6/94 (6%)

Query: 108 FELLVKSYEKGNISKMLAELAIGDRIKVRGPKGFYHYEPNMYKEIGMIAGGTGISPMYQI 167
           +  +++   KG  +  +  L+  D+I+ +  + F        K I MI+ G G++PM  +
Sbjct: 432 YRTILRRIRKGLCTDYIISLSGNDKIRYKLQRNFLLNSSMKGKPIIMISPGVGLAPMMSL 491

Query: 168 IRAIFSNPRDKTRVCLVYGNQTKD-DILLKPELD 200
           IR+ F        + L +GN+ K  D L + +L+
Sbjct: 492 IRSGFFED-----MHLFFGNRIKSKDFLYREDLE 520

>YOR037W (CYC2) [4849] chr15 (401554..402654) Cytochrome c
           mitochondrial import factor, primarily involved in
           import of Cyc1p and also involved in import of Cyc7p
           [1101 bp, 366 aa]
          Length = 366

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 36/77 (46%), Gaps = 17/77 (22%)

Query: 91  MLRSYTPTSLD--------------SDATGYFELLVKSYEKGNISKMLAELAIGDRIKVR 136
           ++R+YTP  L                +A G     +K YE G +++ L  L  G  I++R
Sbjct: 116 VVRNYTPLPLKFNPASKEIEILKDGDNADGKLSFYIKKYENGEVARWLHHLPKGHIIEIR 175

Query: 137 GPKGFYHYE-PNMYKEI 152
           GP  F  YE P++  E+
Sbjct: 176 GP--FIDYEFPHLPNEL 190

>CAGL0I00990g complement(81437..82468) similar to sp|P38909
           Saccharomyces cerevisiae YOR037w CYC2, hypothetical
           start
          Length = 343

 Score = 33.1 bits (74), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 43/109 (39%), Gaps = 31/109 (28%)

Query: 91  MLRSYTPTSLDSDATGYFELL--------------VKSYEKGNISKMLAELAIGDRIKVR 136
           ++R+YTP  L   + G    L              +KSY  G +++ +  L +G  +++R
Sbjct: 120 VVRNYTPLPLQLKSNGNIVPLDLNDPVESKKLLFYIKSYNNGEVARWIKSLPVGSTLELR 179

Query: 137 GPKGFYHYEPNMYKE-----------------IGMIAGGTGISPMYQII 168
           GP   Y +  ++ K                  +   AGGTGI    Q I
Sbjct: 180 GPFIDYKFRNDLSKHHRDANGSTLINKTQLSNVPFFAGGTGIVTALQPI 228

>YPR003C (YPR003C) [5439] chr16 complement(561499..563763) Protein
           with similarity to Sul1p, member of the sulfate permease
           family of membrane transporters [2265 bp, 754 aa]
          Length = 754

 Score = 31.6 bits (70), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 24/39 (61%)

Query: 98  TSLDSDATGYFELLVKSYEKGNISKMLAELAIGDRIKVR 136
           TS+DS A    E ++ SY++ N+   L  ++I D+++ R
Sbjct: 640 TSIDSSAAQVLEEIITSYKRRNVFIYLVNVSINDKVRRR 678

>Kwal_55.20425
          Length = 1036

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 51/118 (43%), Gaps = 14/118 (11%)

Query: 118 GNISKMLAELAIGDRIKVRGPKGFYHYEPNMYKEIGMIAGGTGISPMYQIIRAIFSNPRD 177
           G  SK L+ELA+G  + V          P+  + + M   GTG++P   I+   F   + 
Sbjct: 852 GQASKYLSELAVGSELVVSVKPSVMKLPPSPEQPVIMSGLGTGLAPFKAIVEEKFWQQQQ 911

Query: 178 KTRVCLVY---GNQTKDDILLKPEL-----DAMV------AAKPDQFKILYMLDKVAE 221
              +  VY   G++ K +  L  EL     DA +      A   DQ   +Y+ D++ E
Sbjct: 912 GHTIGKVYLFLGSRHKREEYLYGELWEAYKDAGIITHIGAAFSRDQPHKIYIQDRIRE 969

>Kwal_56.23144
          Length = 2889

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/88 (20%), Positives = 43/88 (48%), Gaps = 4/88 (4%)

Query: 146  PNMYKEIGMIAGGTGISPMYQIIRAIFSNPRDKTRVCLVYGNQTKDDILLKPELDAMVAA 205
            PN+YK + +     G   +  I+R +       TR+ ++Y       ++L+ +L +++  
Sbjct: 2226 PNLYKYVYLADDEKGPENVSFILRTLIRLSVRDTRLIMIYSQCIWSTLILEADLVSVIV- 2284

Query: 206  KPDQFKILYMLDKVAEGEQWEGKLGYIT 233
              D+  + + +D+ +EG  W+  +  +T
Sbjct: 2285 --DEI-VNHSIDRDSEGADWKNVISLLT 2309

>YGL045W (RIM8) [1932] chr7 (414104..415732) Protein of unknown
           function, has weak similarity to a region of C. albicans
           Rim8p, which is required for transcriptional induction
           of C. albicans Rim101p and repression of C. albicans
           Phr2p and functions in pH response, filamentous growth,
           and virulence [1629 bp, 542 aa]
          Length = 542

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 28/45 (62%), Gaps = 4/45 (8%)

Query: 67  EADAVLGLPIGQH--ISISGVID--GKEMLRSYTPTSLDSDATGY 107
           E++ ++G PIG+   + +   I+   ++MLR   P +L++D+ GY
Sbjct: 384 ESNRIIGTPIGEQNGLGVENNINRIQRKMLRMVNPETLENDSEGY 428

>Scas_690.29
          Length = 688

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 37/79 (46%), Gaps = 6/79 (7%)

Query: 152 IGMIAGGTGISPMYQIIRA----IFSNPRDKT--RVCLVYGNQTKDDILLKPELDAMVAA 205
           I M+  GTG++P    IR     + +N  + T  +  L YG++  DD L K E       
Sbjct: 536 IIMVGPGTGVAPFRAFIRERVKFLETNNDNLTLGKHLLFYGSRNHDDFLYKEEWPIYAEK 595

Query: 206 KPDQFKILYMLDKVAEGEQ 224
             D F+++    ++  G++
Sbjct: 596 LGDSFEMIVAHSRLDPGKK 614

>ACR090C [1137] [Homologous to ScYOR037W (CYC2) - SH]
           (519431..520531) [1101 bp, 366 aa]
          Length = 366

 Score = 29.6 bits (65), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 14/62 (22%)

Query: 91  MLRSYTPTSLDSD--------------ATGYFELLVKSYEKGNISKMLAELAIGDRIKVR 136
           ++R YTP  L +D                G   L +K Y  G +++ L +L  G  ++VR
Sbjct: 124 VVRQYTPLPLVADEDGEQLRALRDGDNGGGKLMLYIKEYGSGEVARWLRKLPKGHIVEVR 183

Query: 137 GP 138
           GP
Sbjct: 184 GP 185

>KLLA0B12155g complement(1062000..1063874) similar to sgd|S0006252
           Saccharomyces cerevisiae YPR048w TAH18, start by
           similarity
          Length = 624

 Score = 29.3 bits (64), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 49/111 (44%), Gaps = 14/111 (12%)

Query: 93  RSYTPTSLDSD-------ATGYFELLVKSYEKGNISKMLAELAIGDRIKVRGPKGFYHYE 145
           R Y+ +S  SD       A   ++ L++   KG  +  L  L   D ++ +       +E
Sbjct: 414 RFYSISSAPSDPNVELTIAIVRYKTLLRKVRKGLCTNYLLTLTENDTVRYKLQNNHLLHE 473

Query: 146 PNMYKEIGMIAGGTGISPMYQIIRA-IFSNPRDKTRVCLVYGNQTKDDILL 195
             + K I M + G G++PM  +I + +F +        L +GN+ KD   L
Sbjct: 474 DIIGKPIIMTSPGVGLAPMKCLIESNLFKDQY------LFFGNRMKDKDFL 518

>ADL306C [1435] [Homologous to ScYPR048W (TAH18) - SH]
           (158654..160516) [1863 bp, 620 aa]
          Length = 620

 Score = 28.9 bits (63), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 20/88 (22%), Positives = 42/88 (47%), Gaps = 5/88 (5%)

Query: 108 FELLVKSYEKGNISKMLAELAIGDRIKVRGPKGFYHYEPNMYKEIGMIAGGTGISPMYQI 167
           ++ +++   +G  +  +++L+ G  I+ +             + + MI+ G G++PM  +
Sbjct: 432 YKTILRRIRRGLCTNYISDLSEGSIIRYKVQYNDLLPAGKQDRPVIMISPGVGLAPMKCL 491

Query: 168 IRAIFSNPRDKTRVCLVYGNQTKDDILL 195
           I A   NP     + L +GN+ KD   L
Sbjct: 492 IYAQLFNP-----MLLFFGNRYKDKDFL 514

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.137    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,580,354
Number of extensions: 343250
Number of successful extensions: 796
Number of sequences better than 10.0: 40
Number of HSP's gapped: 755
Number of HSP's successfully gapped: 40
Length of query: 282
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 182
Effective length of database: 13,134,309
Effective search space: 2390444238
Effective search space used: 2390444238
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)