Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL086C55254228510.0
Sklu_2260.352349720750.0
Kwal_47.1816352251020040.0
KLLA0F27599g52249719980.0
CAGL0J02882g53050919430.0
Scas_715.4452849919160.0
YER052C (HOM3)52750419130.0
Scas_34.1*2392408351e-109
YDL010W23174770.16
YDR200C (VPS64)60495730.78
Scas_506.4564103721.00
Kwal_33.148542163149721.4
CAGL0H07601g108993692.4
Kwal_23.401087477693.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL086C
         (542 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL086C [1655] [Homologous to ScYER052C (HOM3) - SH] (533181..53...  1102   0.0  
Sklu_2260.3 YER052C, Contig c2260 3320-4891 reverse complement        803   0.0  
Kwal_47.18163                                                         776   0.0  
KLLA0F27599g 2558178..2559746 highly similar to sp|P10869 Saccha...   774   0.0  
CAGL0J02882g complement(277395..278987) highly similar to sp|P10...   753   0.0  
Scas_715.44                                                           742   0.0  
YER052C (HOM3) [1480] chr5 complement(256374..257957) Aspartate ...   741   0.0  
Scas_34.1*                                                            326   e-109
YDL010W (YDL010W) [848] chr4 (432327..433022) Protein predicted ...    34   0.16 
YDR200C (VPS64) [1040] chr4 complement(854272..856086) Class B v...    33   0.78 
Scas_506.4                                                             32   1.00 
Kwal_33.14854                                                          32   1.4  
CAGL0H07601g complement(742499..745768) weakly similar to sp|P51...    31   2.4  
Kwal_23.4010                                                           31   3.0  

>ADL086C [1655] [Homologous to ScYER052C (HOM3) - SH]
           (533181..534839) [1659 bp, 552 aa]
          Length = 552

 Score = 1102 bits (2851), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/542 (98%), Positives = 532/542 (98%)

Query: 1   MNKQNRRGLQLQLFPYSRSIAQRDTMRSIADQKTNWVVQKFGGTSIGKFPTNIVNDIVKV 60
           MNKQNRRGLQLQLFPYSRSIAQRDTMRSIADQKTNWVVQKFGGTSIGKFPTNIVNDIVKV
Sbjct: 1   MNKQNRRGLQLQLFPYSRSIAQRDTMRSIADQKTNWVVQKFGGTSIGKFPTNIVNDIVKV 60

Query: 61  FSHDYGKNVAVVCSARSSYTKSEGTTSRLLMACDAAASYDETFQDIVRVIREDHVENASH 120
           FSHDYGKNVAVVCSARSSYTKSEGTTSRLLMACDAAASYDETFQDIVRVIREDHVENASH
Sbjct: 61  FSHDYGKNVAVVCSARSSYTKSEGTTSRLLMACDAAASYDETFQDIVRVIREDHVENASH 120

Query: 121 HIKDAEIRVRLVEQTNDELDQVERYLQASQILGEVSNRTMDLVMSVGEKLSCLFLTALCE 180
           HIKDAEIRVRLVEQTNDELDQVERYLQASQILGEVSNRTMDLVMSVGEKLSCLFLTALCE
Sbjct: 121 HIKDAEIRVRLVEQTNDELDQVERYLQASQILGEVSNRTMDLVMSVGEKLSCLFLTALCE 180

Query: 181 DCGVTAEYVDFSSIVPTDFRCAEGSLDNSFYALLVVAFKERLAQIVQANKEGKRIVPVIT 240
           DCGVTAEYVDFSSIVPTDFRCAEGSLDNSFYALLVVAFKERLAQIVQANKEGKRIVPVIT
Sbjct: 181 DCGVTAEYVDFSSIVPTDFRCAEGSLDNSFYALLVVAFKERLAQIVQANKEGKRIVPVIT 240

Query: 241 GFFGLLPMGLLNGVGRGYTDLCXXXXXXXXXXDELQVWKEVDGIFTADPRKVPQARLLET 300
           GFFGLLPMGLLNGVGRGYTDLC          DELQVWKEVDGIFTADPRKVPQARLLET
Sbjct: 241 GFFGLLPMGLLNGVGRGYTDLCAALVAVALNADELQVWKEVDGIFTADPRKVPQARLLET 300

Query: 301 VTPEEAAELTYYGSEVIHPFTMEQVIRAKIPIRIKNVQNPTGDGTVIYADNIAKKGESTP 360
           VTPEEAAELTYYGSEVIHPFTMEQVIRAKIPIRIKNVQNPTGDGTVIYADNIAKKGESTP
Sbjct: 301 VTPEEAAELTYYGSEVIHPFTMEQVIRAKIPIRIKNVQNPTGDGTVIYADNIAKKGESTP 360

Query: 361 PHPPISVSSSFFEQRKRGATAITTKNDIVVLNIHSNKKTLSHGFLAQIFTILDNYKLIVD 420
           PHPPISVSSSFFEQRKRGATAITTKNDIVVLNIHSNKKTLSHGFLAQIFTILDNYKLIVD
Sbjct: 361 PHPPISVSSSFFEQRKRGATAITTKNDIVVLNIHSNKKTLSHGFLAQIFTILDNYKLIVD 420

Query: 421 LISTSEVHVSMALPVPDSDSQRSLRNAVEELKKLGTVDLIKKMAIVSLVGKQMKHFIGIA 480
           LISTSEVHVSMALPVPDSDSQRSLRNAVEELKKLGTVDLIKKMAIVSLVGKQMKHFIGIA
Sbjct: 421 LISTSEVHVSMALPVPDSDSQRSLRNAVEELKKLGTVDLIKKMAIVSLVGKQMKHFIGIA 480

Query: 481 GAMFTTLSEQNINIEMISQGANEINISCVIDEKNSVRALQSIHAKLLEPLAPTSSGAVLN 540
           GAMFTTLSEQNINIEMISQGANEINISCVIDEKNSVRALQSIHAKLLEPLAPTSSGAVLN
Sbjct: 481 GAMFTTLSEQNINIEMISQGANEINISCVIDEKNSVRALQSIHAKLLEPLAPTSSGAVLN 540

Query: 541 GR 542
           GR
Sbjct: 541 GR 542

>Sklu_2260.3 YER052C, Contig c2260 3320-4891 reverse complement
          Length = 523

 Score =  803 bits (2075), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/497 (75%), Positives = 436/497 (87%)

Query: 32  QKTNWVVQKFGGTSIGKFPTNIVNDIVKVFSHDYGKNVAVVCSARSSYTKSEGTTSRLLM 91
           +K+NW+VQKFGGTS+GKFP  IV  IVKV++  Y  NVAVVCSARSSYTK+EGTTSRLL 
Sbjct: 3   EKSNWIVQKFGGTSVGKFPEQIVEQIVKVYTTQYENNVAVVCSARSSYTKAEGTTSRLLN 62

Query: 92  ACDAAASYDETFQDIVRVIREDHVENASHHIKDAEIRVRLVEQTNDELDQVERYLQASQI 151
           AC+ AA+ D TF D+++++R DHV NA   IKD+ ++ +LV+ TN ELD VE+YL ASQI
Sbjct: 63  ACELAANNDPTFTDVLQLVRNDHVSNAQEKIKDSTLQQKLVKDTNAELDLVEKYLSASQI 122

Query: 152 LGEVSNRTMDLVMSVGEKLSCLFLTALCEDCGVTAEYVDFSSIVPTDFRCAEGSLDNSFY 211
           LGEVS+RTMDLVMS GEKLSCLF+ ALC D GV A+YVD S +VPTD+ C +GSLDN+FY
Sbjct: 123 LGEVSSRTMDLVMSCGEKLSCLFMAALCNDLGVPAQYVDLSFVVPTDYECKDGSLDNNFY 182

Query: 212 ALLVVAFKERLAQIVQANKEGKRIVPVITGFFGLLPMGLLNGVGRGYTDLCXXXXXXXXX 271
             LV AFKE L  +++++  GK +VPVITGFFGL+PMGLLNGVGRGYTDLC         
Sbjct: 183 TFLVNAFKEALQPVLKSHSIGKPVVPVITGFFGLVPMGLLNGVGRGYTDLCAALIAVGLN 242

Query: 272 XDELQVWKEVDGIFTADPRKVPQARLLETVTPEEAAELTYYGSEVIHPFTMEQVIRAKIP 331
            DELQVWKEVDGIFTADPRKVPQARLL +VTPEEA+ELTYYGSEVIHPFTMEQVIRAKIP
Sbjct: 243 ADELQVWKEVDGIFTADPRKVPQARLLSSVTPEEASELTYYGSEVIHPFTMEQVIRAKIP 302

Query: 332 IRIKNVQNPTGDGTVIYADNIAKKGESTPPHPPISVSSSFFEQRKRGATAITTKNDIVVL 391
           IRIKNVQNPTG+GTVIY DNIAKKGESTPPHPP++++SSFFE ++RGATAITTKNDIVVL
Sbjct: 303 IRIKNVQNPTGEGTVIYPDNIAKKGESTPPHPPVTLTSSFFETKRRGATAITTKNDIVVL 362

Query: 392 NIHSNKKTLSHGFLAQIFTILDNYKLIVDLISTSEVHVSMALPVPDSDSQRSLRNAVEEL 451
           NIHSNKKTLSHGFLAQIF++LD YKL+VDLISTSEVHVSMALPVPD++S R+L++AVEEL
Sbjct: 363 NIHSNKKTLSHGFLAQIFSVLDKYKLVVDLISTSEVHVSMALPVPDAESSRALKSAVEEL 422

Query: 452 KKLGTVDLIKKMAIVSLVGKQMKHFIGIAGAMFTTLSEQNINIEMISQGANEINISCVID 511
            +LG++DL KKMAIVSLVGKQMK FIGIAG MFTTL+EQNINIEMISQGANEINISCVID
Sbjct: 423 NRLGSIDLTKKMAIVSLVGKQMKQFIGIAGTMFTTLAEQNINIEMISQGANEINISCVID 482

Query: 512 EKNSVRALQSIHAKLLE 528
           E++S++ALQSIHAKLL+
Sbjct: 483 EQDSIKALQSIHAKLLD 499

>Kwal_47.18163
          Length = 522

 Score =  776 bits (2004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/510 (71%), Positives = 430/510 (84%)

Query: 33  KTNWVVQKFGGTSIGKFPTNIVNDIVKVFSHDYGKNVAVVCSARSSYTKSEGTTSRLLMA 92
           +TNW+VQKFGGTS+GKFP  IVN+IVKV++  Y  NVAVVCSARSS TK+EGTTSRLL A
Sbjct: 4   QTNWIVQKFGGTSVGKFPEQIVNEIVKVYTTKYKNNVAVVCSARSSDTKAEGTTSRLLRA 63

Query: 93  CDAAASYDETFQDIVRVIREDHVENASHHIKDAEIRVRLVEQTNDELDQVERYLQASQIL 152
           CD   + D  F D+++ +R+DH+ NA   I   +++ +L+  TN ELD VE+YL ASQ+L
Sbjct: 64  CDLVCNSDPAFADVLQKVRDDHISNAKQRITSPDLQQKLIHDTNAELDLVEKYLNASQVL 123

Query: 153 GEVSNRTMDLVMSVGEKLSCLFLTALCEDCGVTAEYVDFSSIVPTDFRCAEGSLDNSFYA 212
           GEVS RTMDLVMS GEKLSCLF+ ALC + GV A+YVD SS++P D+ C +G+LD SFY 
Sbjct: 124 GEVSLRTMDLVMSCGEKLSCLFMAALCNEYGVRAQYVDLSSVIPHDYECRQGTLDTSFYT 183

Query: 213 LLVVAFKERLAQIVQANKEGKRIVPVITGFFGLLPMGLLNGVGRGYTDLCXXXXXXXXXX 272
            LV AFKE+LA +++A+ +G  +VPVITGFFGL+PMGLLNGVGRGYTDLC          
Sbjct: 184 FLVRAFKEKLAPVLEAHSQGTPVVPVITGFFGLVPMGLLNGVGRGYTDLCAALIAVGLNA 243

Query: 273 DELQVWKEVDGIFTADPRKVPQARLLETVTPEEAAELTYYGSEVIHPFTMEQVIRAKIPI 332
           DELQVWKEVDGIFTADPRKVPQARLL +VTPEEA+ELTYYGSEVIHPFTMEQVIRAKIPI
Sbjct: 244 DELQVWKEVDGIFTADPRKVPQARLLGSVTPEEASELTYYGSEVIHPFTMEQVIRAKIPI 303

Query: 333 RIKNVQNPTGDGTVIYADNIAKKGESTPPHPPISVSSSFFEQRKRGATAITTKNDIVVLN 392
           RIKNVQNPTGDGTVIY DNIAKKGESTPPHPP+++S+SFFEQ+KRGATAIT+K+DIVV++
Sbjct: 304 RIKNVQNPTGDGTVIYPDNIAKKGESTPPHPPVTLSNSFFEQKKRGATAITSKSDIVVVS 363

Query: 393 IHSNKKTLSHGFLAQIFTILDNYKLIVDLISTSEVHVSMALPVPDSDSQRSLRNAVEELK 452
           IHSNKKTLSHGFLAQIFT LD YKL+VDLISTSEVHVSMALPVPD DS ++L+ AVEELK
Sbjct: 364 IHSNKKTLSHGFLAQIFTTLDKYKLVVDLISTSEVHVSMALPVPDVDSSKALKKAVEELK 423

Query: 453 KLGTVDLIKKMAIVSLVGKQMKHFIGIAGAMFTTLSEQNINIEMISQGANEINISCVIDE 512
            LG V+L KK+ IVSLVGKQMK FIGIAG MFTTL+EQ INIEMISQGANEINISCVIDE
Sbjct: 424 VLGAVELTKKLVIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISCVIDE 483

Query: 513 KNSVRALQSIHAKLLEPLAPTSSGAVLNGR 542
           +++++ALQSIH+KLL+  +    G  +N +
Sbjct: 484 EDALKALQSIHSKLLDLDSDVGLGKAVNEK 513

>KLLA0F27599g 2558178..2559746 highly similar to sp|P10869
           Saccharomyces cerevisiae YER052c HOM3 L-aspartate
           4-P-transferase singleton, start by similarity
          Length = 522

 Score =  774 bits (1998), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/497 (72%), Positives = 428/497 (86%)

Query: 32  QKTNWVVQKFGGTSIGKFPTNIVNDIVKVFSHDYGKNVAVVCSARSSYTKSEGTTSRLLM 91
           + +NWVVQKFGGTSIGKF   IVN+I+KV+S +Y  NVAVVCSARSSYTK+EGTTSRLL+
Sbjct: 3   ETSNWVVQKFGGTSIGKFSKQIVNEIIKVYSQEYDNNVAVVCSARSSYTKAEGTTSRLLL 62

Query: 92  ACDAAASYDETFQDIVRVIREDHVENASHHIKDAEIRVRLVEQTNDELDQVERYLQASQI 151
           ACD A++ +  +++++ ++  DHV NA   +KD  I+  L+E T  E++ V RYL ASQ+
Sbjct: 63  ACDLASNNNYEYKNVLDLVERDHVANAEESVKDITIQETLIEDTKREINIVRRYLDASQV 122

Query: 152 LGEVSNRTMDLVMSVGEKLSCLFLTALCEDCGVTAEYVDFSSIVPTDFRCAEGSLDNSFY 211
           LGEVS RT+DLVMS+GEKLSCL++TALC+D GV A YVD S IVP+D+ C EG+LDNSFY
Sbjct: 123 LGEVSTRTLDLVMSLGEKLSCLYVTALCQDNGVNARYVDLSFIVPSDYECKEGTLDNSFY 182

Query: 212 ALLVVAFKERLAQIVQANKEGKRIVPVITGFFGLLPMGLLNGVGRGYTDLCXXXXXXXXX 271
             LV AF+E+L+ I++  + G +I+PVITGFFG++PMGLLNGVGRGYTDLC         
Sbjct: 183 TFLVTAFREKLSPILKETENGTKIIPVITGFFGVVPMGLLNGVGRGYTDLCAALIAVALN 242

Query: 272 XDELQVWKEVDGIFTADPRKVPQARLLETVTPEEAAELTYYGSEVIHPFTMEQVIRAKIP 331
            DELQVWKEVDGIFTADPRKVPQARLL+TVTP+EAAELTYYGSEVIHPFTMEQVIR  IP
Sbjct: 243 ADELQVWKEVDGIFTADPRKVPQARLLDTVTPDEAAELTYYGSEVIHPFTMEQVIRTHIP 302

Query: 332 IRIKNVQNPTGDGTVIYADNIAKKGESTPPHPPISVSSSFFEQRKRGATAITTKNDIVVL 391
           IRIKNVQNP G+GT+IY  + AKKGESTPPHPP++++SS FE +K+GATAITTK+DIVV+
Sbjct: 303 IRIKNVQNPKGNGTIIYPSDQAKKGESTPPHPPVALTSSIFESKKKGATAITTKSDIVVV 362

Query: 392 NIHSNKKTLSHGFLAQIFTILDNYKLIVDLISTSEVHVSMALPVPDSDSQRSLRNAVEEL 451
           NIHSNKKTLSHGFLA++F+ LD YKL+VDLISTSEVHVSMALPVPDSDS ++LR AVEEL
Sbjct: 363 NIHSNKKTLSHGFLAEMFSTLDKYKLVVDLISTSEVHVSMALPVPDSDSLKALRCAVEEL 422

Query: 452 KKLGTVDLIKKMAIVSLVGKQMKHFIGIAGAMFTTLSEQNINIEMISQGANEINISCVID 511
           K+LGTVD+IKKMAIVSLVGKQMK F+GIAG MFTTL+EQ+INIEMISQGANEINISCVID
Sbjct: 423 KRLGTVDVIKKMAIVSLVGKQMKQFVGIAGTMFTTLAEQHINIEMISQGANEINISCVID 482

Query: 512 EKNSVRALQSIHAKLLE 528
           E N+VRALQSIHAKLL+
Sbjct: 483 ESNAVRALQSIHAKLLD 499

>CAGL0J02882g complement(277395..278987) highly similar to sp|P10869
           Saccharomyces cerevisiae YER052c HOM3, hypothetical
           start
          Length = 530

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/509 (70%), Positives = 424/509 (83%), Gaps = 11/509 (2%)

Query: 34  TNWVVQKFGGTSIGKFPTNIVNDIVKVFSHD-----YGKNVAVVCSARSSYTKSEGTTSR 88
           +NWVVQKFGGTS+GKFP  IV++IVK +S       +  +VAVVCSARSSYTK EGTTSR
Sbjct: 9   SNWVVQKFGGTSVGKFPVQIVDEIVKYYSSSKQDGGFDNDVAVVCSARSSYTKQEGTTSR 68

Query: 89  LLMACDAAASYDETFQDIVRVIREDHVENASHHIKDAEIRVRLVEQTNDELDQVERYLQA 148
           LL  CD A S D+ + DI+  IR+DHV NA   ++D+ +  +L++ TN EL  V++YL A
Sbjct: 69  LLKCCDLA-SQDQEYSDIIETIRQDHVSNAERFLEDSPLVAKLIDDTNKELALVDKYLSA 127

Query: 149 SQILGEVSNRTMDLVMSVGEKLSCLFLTALCEDCGVTAEYVDFSSIVPTDFRCAEGSLDN 208
           S++LGEVSNRT+DLVMS GEKLSCLF+TALC D G  A+YVD S++VP+D++    +LD 
Sbjct: 128 SKVLGEVSNRTIDLVMSCGEKLSCLFITALCNDRGCKAKYVDLSNVVPSDYQTT--TLDT 185

Query: 209 SFYALLVVAFKERLAQIVQANKEGKRIVPVITGFFGLLPMGLLNGVGRGYTDLCXXXXXX 268
           SFY  LV A KE+L   V + +   RIVPV TGFFG +PMGLLNGVGRGYTDLC      
Sbjct: 186 SFYTFLVQALKEKLEPFVNSKE---RIVPVFTGFFGFIPMGLLNGVGRGYTDLCAALIAV 242

Query: 269 XXXXDELQVWKEVDGIFTADPRKVPQARLLETVTPEEAAELTYYGSEVIHPFTMEQVIRA 328
               DELQVWKEVDGIFTADPRKVPQARLL++VTPEEA+ELTYYGSEVIHPFTMEQVIRA
Sbjct: 243 ALNADELQVWKEVDGIFTADPRKVPQARLLDSVTPEEASELTYYGSEVIHPFTMEQVIRA 302

Query: 329 KIPIRIKNVQNPTGDGTVIYADNIAKKGESTPPHPPISVSSSFFEQRKRGATAITTKNDI 388
           KIPIRIKNVQNP G+GT+IY DN+AKKGESTPPHPP ++SS+FFE+++RGATAITTKNDI
Sbjct: 303 KIPIRIKNVQNPKGNGTIIYPDNVAKKGESTPPHPPEALSSTFFEKKRRGATAITTKNDI 362

Query: 389 VVLNIHSNKKTLSHGFLAQIFTILDNYKLIVDLISTSEVHVSMALPVPDSDSQRSLRNAV 448
           VVLN+HSNKKTLSHGFLAQIFT+LD YKL+VDLISTSEVHVSMALP+PDSDS ++LR+AV
Sbjct: 363 VVLNVHSNKKTLSHGFLAQIFTVLDKYKLVVDLISTSEVHVSMALPIPDSDSMKALRSAV 422

Query: 449 EELKKLGTVDLIKKMAIVSLVGKQMKHFIGIAGAMFTTLSEQNINIEMISQGANEINISC 508
           E+LK LG+VD+IKKM+IVSLVGKQMK FIGIAG MFTTL+EQ INIEMISQGANEINISC
Sbjct: 423 EKLKPLGSVDIIKKMSIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISC 482

Query: 509 VIDEKNSVRALQSIHAKLLEPLAPTSSGA 537
           VIDE +S++ALQSIH KLL+ L    SG+
Sbjct: 483 VIDEMDSIKALQSIHKKLLDELPENGSGS 511

>Scas_715.44
          Length = 528

 Score =  742 bits (1916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/499 (71%), Positives = 416/499 (83%), Gaps = 10/499 (2%)

Query: 34  TNWVVQKFGGTSIGKFPTNIVNDIVKVFS----HDYGKNVAVVCSARSSYTKSEGTTSRL 89
           +NWVVQKFGGTS+GKFP  IV+DI+K +S      Y  NVAVVCSARSSYTK+EGTTSRL
Sbjct: 6   SNWVVQKFGGTSVGKFPVQIVDDIIKFYSDPSNKTYNNNVAVVCSARSSYTKAEGTTSRL 65

Query: 90  LMACDAAASYDETFQDIVRVIREDHVENASHHIKDAEIRVRLVEQTNDELDQVERYLQAS 149
           L  CD A S +  F DI+ VI+ DH++NA  +++D  ++ +L+  T  EL  V++YL AS
Sbjct: 66  LRCCDLA-SQEMEFNDIIEVIKADHIDNAERYVQDPVLQTKLIADTTKELTLVKKYLDAS 124

Query: 150 QILGEVSNRTMDLVMSVGEKLSCLFLTALCEDCGVTAEYVDFSSIVPTDFRCAEGSLDNS 209
           +ILGEVS RT+DLVMSVGEKLSCLF+TAL  D G  A+YVD + IVP+D+      LDNS
Sbjct: 125 KILGEVSTRTIDLVMSVGEKLSCLFMTALLNDRGCKAKYVDLTHIVPSDYNAT--VLDNS 182

Query: 210 FYALLVVAFKERLAQIVQANKEGKRIVPVITGFFGLLPMGLLNGVGRGYTDLCXXXXXXX 269
           FY  L  AFKE+L   +++ +   R++PV TGFFGL+PMGLLNGVGRGYTDLC       
Sbjct: 183 FYTFLFQAFKEKLQPFIESKE---RVIPVFTGFFGLVPMGLLNGVGRGYTDLCAALIAVA 239

Query: 270 XXXDELQVWKEVDGIFTADPRKVPQARLLETVTPEEAAELTYYGSEVIHPFTMEQVIRAK 329
              DELQVWKEVDGIFTADPRKVPQARLL +VTPEEA+ELTYYGSEVIHPFTMEQVI+AK
Sbjct: 240 VNADELQVWKEVDGIFTADPRKVPQARLLASVTPEEASELTYYGSEVIHPFTMEQVIQAK 299

Query: 330 IPIRIKNVQNPTGDGTVIYADNIAKKGESTPPHPPISVSSSFFEQRKRGATAITTKNDIV 389
           IPIRIKNVQNP G+GT+IY DNIAKKGESTPPHPP ++SSSFFE+RKRGATAITTKNDIV
Sbjct: 300 IPIRIKNVQNPRGEGTIIYPDNIAKKGESTPPHPPETLSSSFFERRKRGATAITTKNDIV 359

Query: 390 VLNIHSNKKTLSHGFLAQIFTILDNYKLIVDLISTSEVHVSMALPVPDSDSQRSLRNAVE 449
           V+NIHSNKKTLSHGFLAQIFTILD +KL+VDLISTSEVHVSMALP+PDS+S +SLR AVE
Sbjct: 360 VINIHSNKKTLSHGFLAQIFTILDKFKLVVDLISTSEVHVSMALPIPDSESHKSLRQAVE 419

Query: 450 ELKKLGTVDLIKKMAIVSLVGKQMKHFIGIAGAMFTTLSEQNINIEMISQGANEINISCV 509
           +L+ LG VD+ KKMAIVSLVGKQMK FIGIAG MFTTL+EQ INIEMISQGANEINISCV
Sbjct: 420 KLRVLGHVDVTKKMAIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISCV 479

Query: 510 IDEKNSVRALQSIHAKLLE 528
           IDE +S++ALQSIHAKLL+
Sbjct: 480 IDETDSLKALQSIHAKLLD 498

>YER052C (HOM3) [1480] chr5 complement(256374..257957) Aspartate
           kinase (L-aspartate 4-P-transferase), catalyzes the
           first step in the common pathway for methionine and
           threonine biosynthesis [1584 bp, 527 aa]
          Length = 527

 Score =  741 bits (1913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/504 (71%), Positives = 421/504 (83%), Gaps = 8/504 (1%)

Query: 34  TNWVVQKFGGTSIGKFPTNIVNDIVKVFSHDYG--KNVAVVCSARSSYTKSEGTTSRLLM 91
           +NWVVQKFGGTS+GKFP  IV+DIVK +S   G   NVAVVCSARSSYTK+EGTTSRLL 
Sbjct: 12  SNWVVQKFGGTSVGKFPVQIVDDIVKHYSKPDGPNNNVAVVCSARSSYTKAEGTTSRLLK 71

Query: 92  ACDAAASYDETFQDIVRVIREDHVENASHHIKDAEIRVRLVEQTNDELDQVERYLQASQI 151
            CD A+   E FQDI+ VIR+DH++NA   I +  ++ +LV+ TN EL+ V++YL AS++
Sbjct: 72  CCDLASQESE-FQDIIEVIRQDHIDNADRFILNPALQAKLVDDTNKELELVKKYLNASKV 130

Query: 152 LGEVSNRTMDLVMSVGEKLSCLFLTALCEDCGVTAEYVDFSSIVPTDFRCAEGSLDNSFY 211
           LGEVS+RT+DLVMS GEKLSCLF+TALC D G  A+YVD S IVP+DF  +  +LDNSFY
Sbjct: 131 LGEVSSRTVDLVMSCGEKLSCLFMTALCNDRGCKAKYVDLSHIVPSDFSAS--ALDNSFY 188

Query: 212 ALLVVAFKERLAQIVQANKEGKRIVPVITGFFGLLPMGLLNGVGRGYTDLCXXXXXXXXX 271
             LV A KE+LA  V A +   RIVPV TGFFGL+P GLLNGVGRGYTDLC         
Sbjct: 189 TFLVQALKEKLAPFVSAKE---RIVPVFTGFFGLVPTGLLNGVGRGYTDLCAALIAVAVN 245

Query: 272 XDELQVWKEVDGIFTADPRKVPQARLLETVTPEEAAELTYYGSEVIHPFTMEQVIRAKIP 331
            DELQVWKEVDGIFTADPRKVP+ARLL++VTPEEA+ELTYYGSEVIHPFTMEQVIRAKIP
Sbjct: 246 ADELQVWKEVDGIFTADPRKVPEARLLDSVTPEEASELTYYGSEVIHPFTMEQVIRAKIP 305

Query: 332 IRIKNVQNPTGDGTVIYADNIAKKGESTPPHPPISVSSSFFEQRKRGATAITTKNDIVVL 391
           IRIKNVQNP G+GT+IY DN+AKKGESTPPHPP ++SSSF+E+RKRGATAITTKNDI V+
Sbjct: 306 IRIKNVQNPLGNGTIIYPDNVAKKGESTPPHPPENLSSSFYEKRKRGATAITTKNDIFVI 365

Query: 392 NIHSNKKTLSHGFLAQIFTILDNYKLIVDLISTSEVHVSMALPVPDSDSQRSLRNAVEEL 451
           NIHSNKKTLSHGFLAQIFTILD YKL+VDLISTSEVHVSMALP+PD+DS +SLR A E+L
Sbjct: 366 NIHSNKKTLSHGFLAQIFTILDKYKLVVDLISTSEVHVSMALPIPDADSLKSLRQAEEKL 425

Query: 452 KKLGTVDLIKKMAIVSLVGKQMKHFIGIAGAMFTTLSEQNINIEMISQGANEINISCVID 511
           + LG+VD+ KK++IVSLVGK MK +IGIAG MFTTL+E+ INIEMISQGANEINISCVI+
Sbjct: 426 RILGSVDITKKLSIVSLVGKHMKQYIGIAGTMFTTLAEEGINIEMISQGANEINISCVIN 485

Query: 512 EKNSVRALQSIHAKLLEPLAPTSS 535
           E +S++ALQ IHAKLL     TS+
Sbjct: 486 ESDSIKALQCIHAKLLSERTNTSN 509

>Scas_34.1*
          Length = 239

 Score =  326 bits (835), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 156/240 (65%), Positives = 186/240 (77%), Gaps = 1/240 (0%)

Query: 86  TSRLLMACDAAASYDETFQDIVRVIREDHVENASHHIKDAEIRVRLVEQTNDELDQVERY 145
           TSRLL AC+ AA+ D TF D+++++R DHV NA   IKD+ ++ +LV+ TN ELD VE+Y
Sbjct: 1   TSRLLNACELAANNDPTFTDVLQLVRNDHVSNAQEKIKDSTLQQKLVKDTNAELDLVEKY 60

Query: 146 LQASQILGEVSNRTMDLVMSVGEKLSCLFLTALCEDCGVTAEYVDFSSIVPTDFRCAEGS 205
           L ASQILGEVS+RTMDLVMS GEKLSCLF+ ALC D GV A+YVD S +VPTD+ C +GS
Sbjct: 61  LSASQILGEVSSRTMDLVMSCGEKLSCLFMAALCNDLGVPAQYVDLSFVVPTDYECKDGS 120

Query: 206 LDNSFYALLVVAFKERLAQIVQANKEGKRIVPVITGFFGLLPMGLLNGVGRGYTDLCXXX 265
           LDN+FY  LV AFKE L  +++++  GK +VPVITGFFGL+PMGLLNGVGRGYTDLC   
Sbjct: 121 LDNNFYTFLVNAFKEALQPVLKSHSIGKPVVPVITGFFGLVPMGLLNGVGRGYTDLCAAL 180

Query: 266 XXXXXXXDELQVWKEVDGIFTADPRKVPQARLLETVTPEEAAELTYYGSEVIHPFTMEQV 325
                  DELQVWKEVDGIFTADPR+  +   L +VTPE A  LTYYGS VIHPFTMEQV
Sbjct: 181 IAVGLNADELQVWKEVDGIFTADPRRFLKQDCLSSVTPERAL-LTYYGSGVIHPFTMEQV 239

>YDL010W (YDL010W) [848] chr4 (432327..433022) Protein predicted to
           have structural similarity to disulfide oxidoreductases
           [696 bp, 231 aa]
          Length = 231

 Score = 34.3 bits (77), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 8/74 (10%)

Query: 225 IVQANKEG-----KRIVPVITGFFGLLPMGLLNGVGRGYTDLCXXXXXXXXXXDELQVWK 279
           I++ +K G     +  + ++TG  G +P  L+NGV RG  +            + LQVW 
Sbjct: 158 IIELDKHGHGEELQEYIKLVTGR-GTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWS 216

Query: 280 EVDGIFTADPRKVP 293
             DG F+ + R+ P
Sbjct: 217 --DGKFSVEQREKP 228

>YDR200C (VPS64) [1040] chr4 complement(854272..856086) Class B
           vacuolar sorting protein involved in Prc1p trafficking
           and alpha-factor secretion, component of a
           high-molecular-weight complex containing Far3p, may
           function in the Far3p-dependent pathway for G1 phase
           arrest [1815 bp, 604 aa]
          Length = 604

 Score = 32.7 bits (73), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 47/95 (49%), Gaps = 15/95 (15%)

Query: 449 EELKKLGTVDLIKKMAIVSL--VGKQM-----KHFIGIAGAMFTTLSEQN--------IN 493
           +EL+KL ++    +   ++L  + K M     KH + ++ A+  TLSE N          
Sbjct: 421 QELEKLHSMQNFMQNYTINLDFINKHMIDMNEKHLLKLSTALQKTLSENNDALLKESEDQ 480

Query: 494 IEMISQGANEINISCVIDEKNSVRALQSIHAKLLE 528
           ++ I Q  N++  +C + EK +   LQ + ++L E
Sbjct: 481 LKEIKQQNNKVKSACSLKEKQNHEKLQELESELRE 515

>Scas_506.4
          Length = 564

 Score = 32.3 bits (72), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 47/103 (45%), Gaps = 11/103 (10%)

Query: 76  RSSYTKSEGTTSRLLMA--CDAAASYDETFQDIVRVIRED-------HVENASHHIKDAE 126
           R +Y  SE     ++ +   D   +YD+   DI++ + ++       H+  ASH+ K   
Sbjct: 416 RGAYMHSELNRDSIIHSNKFDTDMNYDQIVMDIIKDLSKNGDQSIYGHLVVASHNYKSQL 475

Query: 127 IRVRLVEQTNDELDQVERYLQASQILGEVSNRTMDLVMSVGEK 169
           I  +L++++          L   Q+LG   N T DLV + G K
Sbjct: 476 IATKLLKESKSLYANSNVVL--GQLLGMADNVTHDLVYNHGAK 516

>Kwal_33.14854
          Length = 2163

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 62/149 (41%), Gaps = 19/149 (12%)

Query: 54   VNDIVKVFSHDYGKNVAVVCSARSSYTKSEGTTS---RLLMACDAAASYDETFQDIVRVI 110
            + + VKV   DY K V    +A  +  K + T++   +   + D  +       D +R  
Sbjct: 1560 LKNFVKVIPTDY-KKVLEKAAAEEAKLKEKNTSNFLKKFNSSTDLKSDATNGEVDAIRSA 1618

Query: 111  REDHVENASHH-------IKDAEIRVRLVEQTNDELDQVER------YLQASQILGEVSN 157
            +   + N SH        ++D E  V  VEQT    +++E+      Y    +    V++
Sbjct: 1619 KTQAIRNISHKATLAEPKVQDLEDAVLDVEQTEKNSEKIEKTRGFMLYKLRHEKYRGVTS 1678

Query: 158  RTMDL--VMSVGEKLSCLFLTALCEDCGV 184
            RT D   + S   K    + TA C DCGV
Sbjct: 1679 RTKDWKELSSCVTKKDAKYQTARCMDCGV 1707

>CAGL0H07601g complement(742499..745768) weakly similar to sp|P51979
           Saccharomyces cerevisiae YGL251c HFM1, hypothetical
           start
          Length = 1089

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 48/93 (51%), Gaps = 8/93 (8%)

Query: 446 NAVEELKKLGTVDLIKKMAIVSLVGKQMKHFIGIAGAMFTTLSEQNINIEMISQGANEIN 505
           NAVE+L K+G   L     + S+  +Q++ ++G+     T L ++   + ++S      +
Sbjct: 778 NAVEKLSKMGINSL---QQLTSMNREQLELYLGLKPGAGTKLLDEIRRLPILS-----FH 829

Query: 506 ISCVIDEKNSVRALQSIHAKLLEPLAPTSSGAV 538
               ID+KNS+     I AK+ +P+  ++  +V
Sbjct: 830 YQAFIDDKNSLNISPYISAKVAKPIGKSNEISV 862

>Kwal_23.4010
          Length = 874

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 34/77 (44%), Gaps = 12/77 (15%)

Query: 465 IVSLVGKQMKHFIGIAGAMFTTLSEQNINIEMISQGANEINISCVIDEKNSVRALQSIHA 524
           I+ L   + +HFI    ++FTT+    +    +    +  + S  +   +S         
Sbjct: 444 IMQLFRWKNRHFIPPLWSIFTTIKTMTLEKRRVKSDCSNTSASPPVAATDS--------- 494

Query: 525 KLLEPLAPTSSGAVLNG 541
              +P+APTSS  VLNG
Sbjct: 495 ---QPIAPTSSNTVLNG 508

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.133    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,271,518
Number of extensions: 660436
Number of successful extensions: 2093
Number of sequences better than 10.0: 24
Number of HSP's gapped: 2146
Number of HSP's successfully gapped: 24
Length of query: 542
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 435
Effective length of database: 12,891,983
Effective search space: 5608012605
Effective search space used: 5608012605
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)