Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL085C27326812081e-169
KLLA0F27577g172752741e-29
Kwal_47.18167227762528e-26
AFL223W165781945e-18
KLLA0F23672g123801853e-17
Kwal_26.8461123801783e-16
Scas_666.12121611704e-15
KLLA0A12111g236781775e-15
CAGL0L03828g121731662e-14
YNL111C (CYB5)120751634e-14
YML054C (CYB2)591981702e-13
Scas_571.1d609771665e-13
CAGL0K10736g593781631e-12
KLLA0B14795g556781622e-12
Sklu_2444.3564991579e-12
KLLA0D02640g589781552e-11
Sklu_2258.5580791481e-10
CAGL0K03069g194761394e-10
Kwal_23.2823560941428e-10
Scas_571.2602571383e-09
Kwal_27.10332378491345e-09
Kwal_14.807578861348e-09
Scas_717.14189791253e-08
Kwal_26.8046198551253e-08
Scas_696.36426531222e-07
KLLA0D01639g381781196e-07
YMR272C (SCS7)384531161e-06
AAL183W377691142e-06
YMR073C201801112e-06
KLLA0E18535g14878971e-04
CAGL0I00418g49049964e-04
Sklu_2299.348050870.006
AAL078W59245840.013
Kwal_23.569351351840.014
CAGL0F03399g38030810.029
KLLA0C05566g47750800.036
AAR153C47836790.048
YGL055W (OLE1)51035790.050
Sklu_2032.352240780.063
KLLA0C10692g52035770.098
Scas_563.649749760.11
Kwal_14.184528836671.2
YDL063C620145681.4
Kwal_47.17014155142662.4
AFL079W53849635.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL085C
         (268 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL085C [1656] [Homologous to NOHBY] (535296..536117) [822 bp, 2...   469   e-169
KLLA0F27577g 2556662..2557180 some similarities with sp|Q9M5B0 P...   110   1e-29
Kwal_47.18167                                                         101   8e-26
AFL223W [2972] [Homologous to ScYNL111C (CYB5) - SH] complement(...    79   5e-18
KLLA0F23672g 2212223..2212594 some similarities with sp|P40312 S...    76   3e-17
Kwal_26.8461                                                           73   3e-16
Scas_666.12                                                            70   4e-15
KLLA0A12111g 1053506..1054216 some similarities with sp|P09437 H...    73   5e-15
CAGL0L03828g 440663..441028 similar to sp|P40312 Saccharomyces c...    69   2e-14
YNL111C (CYB5) [4482] chr14 complement(416940..417302) Cytochrom...    67   4e-14
YML054C (CYB2) [3916] chr13 complement(165533..167308) Cytochrom...    70   2e-13
Scas_571.1d                                                            69   5e-13
CAGL0K10736g 1045298..1047079 highly similar to sp|P00175 Saccha...    67   1e-12
KLLA0B14795g 1299429..1301099 similar to sp|P00175 Saccharomyces...    67   2e-12
Sklu_2444.3 , Contig c2444 10960-12654                                 65   9e-12
KLLA0D02640g complement(225482..227251) gi|5262950|emb|CAB45871....    64   2e-11
Sklu_2258.5 YML054C, Contig c2258 8274-10016 reverse complement        62   1e-10
CAGL0K03069g complement(284361..284945) weakly similar to sp|Q04...    58   4e-10
Kwal_23.2823                                                           59   8e-10
Scas_571.2                                                             58   3e-09
Kwal_27.10332                                                          56   5e-09
Kwal_14.807                                                            56   8e-09
Scas_717.14                                                            53   3e-08
Kwal_26.8046                                                           53   3e-08
Scas_696.36                                                            52   2e-07
KLLA0D01639g complement(146344..147489) similar to sp|Q03529 Sac...    50   6e-07
YMR272C (SCS7) [4226] chr13 complement(809622..810776) Ceramide ...    49   1e-06
AAL183W [4] [Homologous to ScYMR272C (SCS7) - SH] complement(137...    49   2e-06
YMR073C (YMR073C) [4032] chr13 complement(412267..412872) Protei...    47   2e-06
KLLA0E18535g 1641507..1641953 some similarities with ca|CA1511|I...    42   1e-04
CAGL0I00418g 30058..31530 highly similar to sp|P21147 Saccharomy...    42   4e-04
Sklu_2299.3 YGL055W, Contig c2299 5338-6780 reverse complement         38   0.006
AAL078W [109] [Homologous to ScYGL055W - NSH] complement(209600....    37   0.013
Kwal_23.5693                                                           37   0.014
CAGL0F03399g complement(333955..335097) highly similar to sp|Q03...    36   0.029
KLLA0C05566g complement(497877..499310) similar to sp|P21147 Sac...    35   0.036
AAR153C [341] [Homologous to ScYGL055W (OLE1) - SH] (619953..621...    35   0.048
YGL055W (OLE1) [1924] chr7 (398629..400161) Stearoyl-CoA desatur...    35   0.050
Sklu_2032.3 , Contig c2032 4286-5854                                   35   0.063
KLLA0C10692g complement(916718..918280) weakly similar to sp|P21...    34   0.098
Scas_563.6                                                             34   0.11 
Kwal_14.1845                                                           30   1.2  
YDL063C (YDL063C) [803] chr4 complement(338272..340134) Protein ...    31   1.4  
Kwal_47.17014                                                          30   2.4  
AFL079W [3114] [Homologous to NOHBY] complement(290134..291750) ...    29   5.7  

>ADL085C [1656] [Homologous to NOHBY] (535296..536117) [822 bp, 273
           aa]
          Length = 273

 Score =  469 bits (1208), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 235/268 (87%), Positives = 235/268 (87%)

Query: 1   MQRYSRDLQTSLPAWVTCWVRVSWIVTWSRLGIIAEETNQXXXXXXXXXGKARQECSSGH 60
           MQRYSRDLQTSLPAWVTCWVRVSWIVTWSRLGIIAEETNQ         GKARQECSSGH
Sbjct: 1   MQRYSRDLQTSLPAWVTCWVRVSWIVTWSRLGIIAEETNQLALLLSLPLGKARQECSSGH 60

Query: 61  TSKRTDAIGIVNGSLLNSKAGGYNRGMGLLRKISIEEVSQHTSRDDCWFIIHGRVYDITG 120
           TSKRTDAIGIVNGSLLNSKAGGYNRGMGLLRKISIEEVSQHTSRDDCWFIIHGRVYDITG
Sbjct: 61  TSKRTDAIGIVNGSLLNSKAGGYNRGMGLLRKISIEEVSQHTSRDDCWFIIHGRVYDITG 120

Query: 121 LLENHPGGTKILLKYAGRDATLPFDDVGHSMESLIYDMAPGSYLGEVDGGENVNSCSSVV 180
           LLENHPGGTKILLKYAGRDATLPFDDVGHSMESLIYDMAPGSYLGEVDGGENVNSCSSVV
Sbjct: 121 LLENHPGGTKILLKYAGRDATLPFDDVGHSMESLIYDMAPGSYLGEVDGGENVNSCSSVV 180

Query: 181 SWRSLRWLRSWGKGASDDATVRSLGSQSEKLESDXXXXXXXXXXXXXXXXXXXXXXXXRY 240
           SWRSLRWLRSWGKGASDDATVRSLGSQSEKLESD                        RY
Sbjct: 181 SWRSLRWLRSWGKGASDDATVRSLGSQSEKLESDLQNWLQKTLLLLVICVCCVLLLVIRY 240

Query: 241 HNRTRRAGRIHSTQAPLPPDTSGMPSWW 268
           HNRTRRAGRIHSTQAPLPPDTSGMPSWW
Sbjct: 241 HNRTRRAGRIHSTQAPLPPDTSGMPSWW 268

>KLLA0F27577g 2556662..2557180 some similarities with sp|Q9M5B0
           Petunia hybrida Cytochrome b5 DIF-F, hypothetical start
          Length = 172

 Score =  110 bits (274), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 62/75 (82%)

Query: 93  ISIEEVSQHTSRDDCWFIIHGRVYDITGLLENHPGGTKILLKYAGRDATLPFDDVGHSME 152
           I+++EV++H+SR DCW +IHG+VYDIT  L  HPGG ++LLKYAG+D+TL FDD+GHSME
Sbjct: 6   ITMDEVARHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFDDIGHSME 65

Query: 153 SLIYDMAPGSYLGEV 167
           SL YD+ PG+  G +
Sbjct: 66  SLAYDLDPGALKGTL 80

>Kwal_47.18167
          Length = 227

 Score =  101 bits (252), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 43/76 (56%), Positives = 58/76 (76%)

Query: 90  LRKISIEEVSQHTSRDDCWFIIHGRVYDITGLLENHPGGTKILLKYAGRDATLPFDDVGH 149
           L  IS +EV+ HT  DDCW  IHG+VYD++  L  HPGG +++LK AG+DAT+PFD+VGH
Sbjct: 31  LPFISSDEVATHTDADDCWISIHGKVYDVSSYLPQHPGGAQVMLKLAGKDATVPFDEVGH 90

Query: 150 SMESLIYDMAPGSYLG 165
           S+ESLIY + P + +G
Sbjct: 91  SIESLIYGLGPRACVG 106

>AFL223W [2972] [Homologous to ScYNL111C (CYB5) - SH]
           complement(19601..20098) [498 bp, 165 aa]
          Length = 165

 Score = 79.3 bits (194), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 34/78 (43%), Positives = 54/78 (69%), Gaps = 2/78 (2%)

Query: 91  RKISIEEVSQHTSRDDCWFIIHGRVYDITGLLENHPGGTKILLKYAGRDATLPFDDVGHS 150
           +  + +E+++H S +D W II+G+VYD T   E HPGG ++L+  AG+DAT PF D+GHS
Sbjct: 42  KLYTYQEIAEHNSENDLWLIINGKVYDCTKFAEEHPGGDEVLIDLAGQDATEPFADIGHS 101

Query: 151 MESLIYDMAPGSYLGEVD 168
            +++   M  G Y+G++D
Sbjct: 102 DDAV--KMLEGLYVGDLD 117

>KLLA0F23672g 2212223..2212594 some similarities with sp|P40312
           Saccharomyces cerevisiae YNL111c CYB5 cytochrome b5
           singleton, hypothetical start
          Length = 123

 Score = 75.9 bits (185), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 55/80 (68%), Gaps = 2/80 (2%)

Query: 89  LLRKISIEEVSQHTSRDDCWFIIHGRVYDITGLLENHPGGTKILLKYAGRDATLPFDDVG 148
           + + ++ +EVS+H + DD W II G+VYD T  ++ HPGG +IL+   G+DAT PF+D+G
Sbjct: 1   MAKLLTYKEVSEHKTVDDLWMIIDGKVYDCTKFVDEHPGGDEILVDLGGQDATGPFEDIG 60

Query: 149 HSMESLIYDMAPGSYLGEVD 168
           HS +++   +    Y+G++D
Sbjct: 61  HSDDAI--KLLEPMYVGDID 78

>Kwal_26.8461
          Length = 123

 Score = 73.2 bits (178), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 52/80 (65%), Gaps = 2/80 (2%)

Query: 89  LLRKISIEEVSQHTSRDDCWFIIHGRVYDITGLLENHPGGTKILLKYAGRDATLPFDDVG 148
           + +  S +E+++H +  D W II G+VYD T  ++ HPGG ++L+   G+DAT PF D+G
Sbjct: 1   MAKLYSYKEIAEHNTEKDLWMIIDGKVYDCTKFMDEHPGGEEVLVDLGGQDATGPFADIG 60

Query: 149 HSMESLIYDMAPGSYLGEVD 168
           HS +++   M    Y+G+VD
Sbjct: 61  HSDDAV--KMLADLYVGDVD 78

>Scas_666.12
          Length = 121

 Score = 70.1 bits (170), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 44/61 (72%)

Query: 94  SIEEVSQHTSRDDCWFIIHGRVYDITGLLENHPGGTKILLKYAGRDATLPFDDVGHSMES 153
           S +++++H   DD W II G+VYD++  L+ HPGG +I+ + AG+DAT  F D+GHS ++
Sbjct: 6   SYQQIAEHNKPDDAWIIIEGKVYDVSKFLDEHPGGDEIIFELAGQDATEHFLDIGHSDDA 65

Query: 154 L 154
           L
Sbjct: 66  L 66

>KLLA0A12111g 1053506..1054216 some similarities with sp|P09437
           Hansenula anomala Cytochrome B2, mitochondrial precursor
           (EC 1.1.2.3) (L-lactate dehydrogenase [Cytochrome])
           (L-lactate ferricytochrome C oxidoreductase) (L-LCR),
           hypothetical start
          Length = 236

 Score = 72.8 bits (177), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 35/78 (44%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 93  ISIEEVSQHTSRDDCWFIIHGRVYDITGLLENHPGGTKILLKYAGRDATLPFDDVGHSME 152
           +S++EV  H   DDCW +I G VYDITG L  HPGG   L+++AGRDAT  F  + HS  
Sbjct: 81  VSVKEVKSHNRIDDCWIVIDGDVYDITGFLSKHPGGVTRLMEFAGRDATERFHQM-HSSA 139

Query: 153 SLIYDMAPGSYLGEVDGG 170
            L       +Y+G++ G 
Sbjct: 140 MLEKMKEHLTYIGKLKGA 157

>CAGL0L03828g 440663..441028 similar to sp|P40312 Saccharomyces
           cerevisiae YNL111c CYB5, start by similarity
          Length = 121

 Score = 68.6 bits (166), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 47/73 (64%), Gaps = 2/73 (2%)

Query: 96  EEVSQHTSRDDCWFIIHGRVYDITGLLENHPGGTKILLKYAGRDATLPFDDVGHSMESLI 155
           ++VS+H    DCW II G VYD++  L+ HPGG +I+ ++ G DAT  F D+GHS ++L 
Sbjct: 8   KQVSEHNKEGDCWIIIDGSVYDVSKFLDEHPGGDEIIFEHRGTDATGDFVDIGHSDDAL- 66

Query: 156 YDMAPGSYLGEVD 168
             +     +GEVD
Sbjct: 67  -KILKTLKIGEVD 78

>YNL111C (CYB5) [4482] chr14 complement(416940..417302) Cytochrome
           b5 [363 bp, 120 aa]
          Length = 120

 Score = 67.4 bits (163), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 49/75 (65%), Gaps = 2/75 (2%)

Query: 94  SIEEVSQHTSRDDCWFIIHGRVYDITGLLENHPGGTKILLKYAGRDATLPFDDVGHSMES 153
           S +EV++H   ++ W II  +VYD++   + HPGG +I++   G+DAT  F D+GHS E+
Sbjct: 6   SYQEVAEHNGPENFWIIIDDKVYDVSQFKDEHPGGDEIIMDLGGQDATESFVDIGHSDEA 65

Query: 154 LIYDMAPGSYLGEVD 168
           L   +  G Y+G+VD
Sbjct: 66  L--RLLKGLYIGDVD 78

>YML054C (CYB2) [3916] chr13 complement(165533..167308) Cytochrome
           b2 [L-(+)-lactate cytochrome c oxidoreductase],
           catalyzes the conversion of L-lactate to pyruvate [1776
           bp, 591 aa]
          Length = 591

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 54/98 (55%), Gaps = 6/98 (6%)

Query: 72  NGSLLNSKAGGYNRGMGLLRKISIEEVSQHTSRDDCWFIIHGRVYDITGLLENHPGGTKI 131
           NG + N      N+     +KIS  EV++H   DDCW +I+G VYD+T  L NHPGG  +
Sbjct: 75  NGQIDNEPKLDMNK-----QKISPAEVAKHNKPDDCWVVINGYVYDLTRFLPNHPGGQDV 129

Query: 132 LLKYAGRDATLPFDDVGHSMESLIYDMAPGSYLGEVDG 169
           +   AG+D T  F+ + H+   +   +AP   LG + G
Sbjct: 130 IKFNAGKDVTAIFEPL-HAPNVIDKYIAPEKKLGPLQG 166

>Scas_571.1d
          Length = 609

 Score = 68.6 bits (166), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 50/77 (64%), Gaps = 1/77 (1%)

Query: 93  ISIEEVSQHTSRDDCWFIIHGRVYDITGLLENHPGGTKILLKYAGRDATLPFDDVGHSME 152
           IS +EV++H S +DCW +I+G+VYD+T  +  HPGG+ I+   AG+D +  F+ + H+  
Sbjct: 95  ISTDEVTKHNSENDCWIVINGQVYDLTSFMSIHPGGSDIIKLNAGKDVSAIFNPL-HAPN 153

Query: 153 SLIYDMAPGSYLGEVDG 169
           ++   + P  YLG + G
Sbjct: 154 AIERFLPPECYLGPLQG 170

>CAGL0K10736g 1045298..1047079 highly similar to sp|P00175
           Saccharomyces cerevisiae YML054c CYB2 lactate
           dehydrogenase cytochrome b2, hypothetical start
          Length = 593

 Score = 67.4 bits (163), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 92  KISIEEVSQHTSRDDCWFIIHGRVYDITGLLENHPGGTKILLKYAGRDATLPFDDVGHSM 151
           KIS  EV +H + +DCW +I G VYD+T  +  HPGG  I+   AG+D T  FD + H  
Sbjct: 89  KISPSEVIKHNTPEDCWVVIDGYVYDLTNFIALHPGGPDIIKTNAGKDVTAIFDPI-HPP 147

Query: 152 ESLIYDMAPGSYLGEVDG 169
           +++   + P  ++G +DG
Sbjct: 148 DAIEKYIKPEQHIGPLDG 165

>KLLA0B14795g 1299429..1301099 similar to sp|P00175 Saccharomyces
           cerevisiae YML054c CYB2 lactate dehydrogenase cytochrome
           b2 singleton, start by similarity
          Length = 556

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 93  ISIEEVSQHTSRDDCWFIIHGRVYDITGLLENHPGGTKILLKYAGRDATLPFDDVGHSME 152
           +S++EV  H   DDCW +I   VYDIT  L  HPGG   L+++AGRDAT  F  + HS  
Sbjct: 81  VSVKEVKMHNRIDDCWIVIDNEVYDITKFLSQHPGGVARLMEFAGRDATERFYQM-HSSA 139

Query: 153 SLIYDMAPGSYLGEVDGG 170
           +L        Y+G++ G 
Sbjct: 140 TLEKMKEHLVYIGKLKGA 157

>Sklu_2444.3 , Contig c2444 10960-12654
          Length = 564

 Score = 65.1 bits (157), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 56/99 (56%), Gaps = 16/99 (16%)

Query: 93  ISIEEVSQHTSRDDCWFIIHGRVYDITGLLENHPGGTKILLKYAGRDATLPF-----DDV 147
           I+++EV  H + DDCW +++G VYDIT  ++ HPGG   L++ AGRDAT  F     D+V
Sbjct: 88  ITVDEVKLHNNIDDCWIVLNGDVYDITEFIKIHPGGAARLMEVAGRDATEKFHMIHSDEV 147

Query: 148 GHSMESLIYDMAPGSYLGEVDGGENVNSCSSVVSWRSLR 186
              M+  I      + +G+++G       S+ VS   LR
Sbjct: 148 LEKMKEYI------TLVGKLEG-----EFSNEVSEEELR 175

>KLLA0D02640g complement(225482..227251) gi|5262950|emb|CAB45871.1
           Kluyveromyces lactis cytochrome b2, start by similarity
          Length = 589

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 92  KISIEEVSQHTSRDDCWFIIHGRVYDITGLLENHPGGTKILLKYAGRDATLPFDDVGHSM 151
           K+S  EV++H+S  DCW +I G VY++T  +  HPGG  I+   AG+D T  F  + H+ 
Sbjct: 89  KVSPTEVAKHSSPKDCWVVIEGYVYNLTDFISAHPGGPAIIENNAGKDVTKIFAPI-HAP 147

Query: 152 ESLIYDMAPGSYLGEVDG 169
           + +   +AP + +G +DG
Sbjct: 148 DVIEKYIAPENRIGPLDG 165

>Sklu_2258.5 YML054C, Contig c2258 8274-10016 reverse complement
          Length = 580

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 91  RKISIEEVSQHTSRDDCWFIIHGRVYDITGLLENHPGGTKILLKYAGRDATLPFDDVGHS 150
           + I  ++V++H    DCW +I G VYD+T  + +HPGG  I+   AG+D T  F  + H+
Sbjct: 79  KPIDPQDVAKHNDPKDCWVVIDGYVYDLTEFIHSHPGGPTIIENNAGKDVTAIFGPI-HA 137

Query: 151 MESLIYDMAPGSYLGEVDG 169
            + +   +AP   +G +DG
Sbjct: 138 PDVIEKYIAPEKRIGPLDG 156

>CAGL0K03069g complement(284361..284945) weakly similar to sp|Q04772
           Saccharomyces cerevisiae YMR073c, hypothetical start
          Length = 194

 Score = 58.2 bits (139), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 48/76 (63%), Gaps = 3/76 (3%)

Query: 93  ISIEEVSQHTSRDDCWFIIHGRVYDITGLLENHPGGTKILL-KYAGRDATLPFDDVGH-- 149
           I   E+++H + +DCW +I+G+VY I+  L  HPGG KIL+ K +G+D+T+ F+      
Sbjct: 119 IDAHELARHNTAEDCWTVINGKVYSISSYLSFHPGGAKILIDKSSGQDSTVLFNRYHRWI 178

Query: 150 SMESLIYDMAPGSYLG 165
           S+E ++     G Y+G
Sbjct: 179 SVEKMLETCLVGVYVG 194

>Kwal_23.2823
          Length = 560

 Score = 59.3 bits (142), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 6/94 (6%)

Query: 93  ISIEEVSQHTSRDDCWFIIHGRVYDITGLLENHPGGTKILLKYAGRDATLPFDDVGHSME 152
           I + EV  H   +DCW +++  VYD+T  +  HPGG + +L+ AG DAT  F  + HS +
Sbjct: 81  IPVSEVMLHNKLNDCWIVLNDEVYDVTSFIAAHPGGVQRILEVAGSDATEKFYQI-HSED 139

Query: 153 SLIYDMAPGSYLGEVDGGENVNSCSSVVSWRSLR 186
            L        Y+G++ G       S +V+   LR
Sbjct: 140 VLNKMKEKLVYVGKLKG-----KFSKIVTEEELR 168

>Scas_571.2
          Length = 602

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 35/57 (61%)

Query: 91  RKISIEEVSQHTSRDDCWFIIHGRVYDITGLLENHPGGTKILLKYAGRDATLPFDDV 147
           R I   EV++H +  DCW +I+G VYD+T  +  HPGG  I+   AG+D T  F+ +
Sbjct: 87  RVIDPSEVARHNTPADCWIVINGVVYDLTSFIPVHPGGADIIKSNAGKDVTAIFEPI 143

>Kwal_27.10332
          Length = 378

 Score = 56.2 bits (134), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 34/49 (69%), Gaps = 1/49 (2%)

Query: 94  SIEEVSQHTSRDDCWFIIHGR-VYDITGLLENHPGGTKILLKYAGRDAT 141
           S  +V +H S DDCW  +  R +YD+T  LE+HPGG  ++++YAG+D T
Sbjct: 10  SASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDIT 58

>Kwal_14.807
          Length = 578

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 48/86 (55%), Gaps = 1/86 (1%)

Query: 93  ISIEEVSQHTSRDDCWFIIHGRVYDITGLLENHPGGTKILLKYAGRDATLPFDDVGHSME 152
           I  +EV++H+  DDCW +I+G VYD++  +  HPGG  I+   AG+D +  F+   H+ +
Sbjct: 79  IRPQEVAKHSKPDDCWVVINGYVYDLSDFIAVHPGGPAIIKANAGKDVSAIFNAF-HASD 137

Query: 153 SLIYDMAPGSYLGEVDGGENVNSCSS 178
            +   +     +G ++G    N  S+
Sbjct: 138 VIEKFIPEKKRIGPLEGHMQPNHVSA 163

>Scas_717.14
          Length = 189

 Score = 52.8 bits (125), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 5/79 (6%)

Query: 92  KISIEEVSQHTSRDDCWFIIHGRVYDITGLLENHPGGTKILLK-YAGRDATLPFDDVGHS 150
           KI+   + +HTSR DCW I  G+VY ++  LE HPGG  I+ +  AG+D+T+ F+   HS
Sbjct: 112 KINNSILQRHTSRTDCWTIYKGKVYCVSDYLEYHPGGPDIIFQNCAGKDSTVLFNQY-HS 170

Query: 151 ---MESLIYDMAPGSYLGE 166
               E L+     G ++ E
Sbjct: 171 WVNAEKLLETCLIGIFVNE 189

>Kwal_26.8046
          Length = 198

 Score = 52.8 bits (125), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 38/55 (69%), Gaps = 1/55 (1%)

Query: 92  KISIEEVSQHTSRDDCWFIIHGRVYDITGLLENHPGGTKILLK-YAGRDATLPFD 145
           +I+  +++QH + +DCW +I+ +VY I+  L+ HPGG  IL+K  AG+D T  F+
Sbjct: 122 RINKAQLAQHKAPEDCWCVINQKVYCISSYLDFHPGGVDILMKGAAGKDCTSMFN 176

>Scas_696.36
          Length = 426

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 36/53 (67%), Gaps = 1/53 (1%)

Query: 90  LRKISIEEVSQHTSRDDCWFIIHGR-VYDITGLLENHPGGTKILLKYAGRDAT 141
           L   S ++V++H + +DCW  ++ R +YD++  L +HP G K +LK+AG+D T
Sbjct: 55  LELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDIT 107

>KLLA0D01639g complement(146344..147489) similar to sp|Q03529
           Saccharomyces cerevisiae YMR272c SCS7 required for
           hydroxylation of ceramide singleton, start by similarity
          Length = 381

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 89  LLRKISIEEVSQHTSRDDCWFIIHGR-VYDITGLLENHPGGTKILLKYAGRDATLPFDDV 147
           +L   S  ++ +H  ++DCW  ++ R +Y++T  L+ HPGG + +L YAG D T    DV
Sbjct: 6   ILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDV 65

Query: 148 -GHSMESLIYDMAPGSYL 164
             H      Y++   SYL
Sbjct: 66  LTHEHSESAYEIMDESYL 83

>YMR272C (SCS7) [4226] chr13 complement(809622..810776) Ceramide
           hydroxylase that hydroxylates the C-26 fatty-acyl moiety
           of inositol-phosphorylceramide [1155 bp, 384 aa]
          Length = 384

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 90  LRKISIEEVSQHTSRDDCWFIIHGR-VYDITGLLENHPGGTKILLKYAGRDAT 141
           L   S + V +H + +DCW     R +YD+T  L  HPGG + +L YAG+D T
Sbjct: 9   LELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDIT 61

>AAL183W [4] [Homologous to ScYMR272C (SCS7) - SH]
           complement(13713..14846) [1134 bp, 377 aa]
          Length = 377

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 38/69 (55%), Gaps = 2/69 (2%)

Query: 98  VSQHTSRDDCWFIIHGR-VYDITGLLENHPGGTKILLKYAGRDATLPF-DDVGHSMESLI 155
           + +HT R  CW  +  R +YD++  L+ HPGG + +L YAG+D T    D + H      
Sbjct: 14  LQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVLKDKLIHEHTEAA 73

Query: 156 YDMAPGSYL 164
           Y++   SYL
Sbjct: 74  YEILDESYL 82

>YMR073C (YMR073C) [4032] chr13 complement(412267..412872) Protein
           containing a heme-binding domain, has a region of
           moderate similarity to a region of flavohemoprotein
           b5+b5R (human b5&b5R), which is an NAD(P)H
           oxidoreductase that may act as an oxygen sensor [606 bp,
           201 aa]
          Length = 201

 Score = 47.4 bits (111), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 45/80 (56%), Gaps = 3/80 (3%)

Query: 71  VNGSLLNSKAGGYNRGMGLLRKISIEEVSQHTS-RDDCWFIIHGRVYDITGLLENHPGGT 129
           +   LL  K   Y + M  LR I+ + V +H    D+ W +I+G+VYDI+  L+ HPGGT
Sbjct: 105 LKNQLLVQKIPLY-KIMPPLR-INRKIVKKHCKGEDELWCVINGKVYDISSYLKFHPGGT 162

Query: 130 KILLKYAGRDATLPFDDVGH 149
            IL+K+   D  + + +  H
Sbjct: 163 DILIKHRNSDDLITYFNKYH 182

>KLLA0E18535g 1641507..1641953 some similarities with
           ca|CA1511|IPF9972.3eoc Candida albicans unknown
           function, 3-prime end, hypothetical start
          Length = 148

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 2/78 (2%)

Query: 93  ISIEEVSQHTSRDDCWFIIHGRVYDITGLLENHPGGTKILLKYAGRDATLPFDDVGH--S 150
           + + + +   ++D+ W +I+ +VY I   L  HPGG  IL + AG+D T  F+      +
Sbjct: 70  LRVNKEALKANKDNFWCVINRKVYCIKAYLSYHPGGEVILKQCAGKDVTSLFNKYHRWVN 129

Query: 151 MESLIYDMAPGSYLGEVD 168
            E L+     G Y+G  +
Sbjct: 130 YERLLETCFIGMYVGSAE 147

>CAGL0I00418g 30058..31530 highly similar to sp|P21147 Saccharomyces
           cerevisiae YGL055w OLE1 stearoyl-CoA desaturase, start
           by similarity
          Length = 490

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 28/49 (57%)

Query: 96  EEVSQHTSRDDCWFIIHGRVYDITGLLENHPGGTKILLKYAGRDATLPF 144
           EE  +    +D   I+ G V+D++G +  HPGG K+L    G+DAT  F
Sbjct: 392 EEFLEKNRENDGLVIVGGIVHDVSGYITEHPGGEKLLKNALGKDATKAF 440

>Sklu_2299.3 YGL055W, Contig c2299 5338-6780 reverse complement
          Length = 480

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%)

Query: 96  EEVSQHTSRDDCWFIIHGRVYDITGLLENHPGGTKILLKYAGRDATLPFD 145
           EE  +    +    I+ G V+D++G +  HPGG  ++   AG+DAT  F+
Sbjct: 385 EEFMKSLKSNPGLVIVSGIVHDVSGYITEHPGGETLIQAAAGKDATKAFN 434

>AAL078W [109] [Homologous to ScYGL055W - NSH]
           complement(209600..211378) [1779 bp, 592 aa]
          Length = 592

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 26/45 (57%)

Query: 101 HTSRDDCWFIIHGRVYDITGLLENHPGGTKILLKYAGRDATLPFD 145
           +  ++     I G ++D+T  + +HPGG  +++   G+DAT  F+
Sbjct: 482 YEEKEKALVAIEGIIHDVTPFMHDHPGGMALVVASVGKDATPAFN 526

>Kwal_23.5693
          Length = 513

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 100 QHTSRDDCWFIIHGRVYDITGLLENHPGGTKILLKYAGRDATLPFDDVGHS 150
           QH  R   +  I G V+D+T  + +HPGG  ++    G+DAT  F+   +S
Sbjct: 397 QHNRR--AFVAIEGVVHDVTPFIHDHPGGVALVETSIGKDATQAFNGAVYS 445

>CAGL0F03399g complement(333955..335097) highly similar to sp|Q03529
           Saccharomyces cerevisiae YMR272c SCS7 required for
           hydroxylation of ceramide, hypothetical start
          Length = 380

 Score = 35.8 bits (81), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 22/30 (73%), Gaps = 1/30 (3%)

Query: 98  VSQHTSRDDCWFIIHGR-VYDITGLLENHP 126
           +++H S+DDCW   H R +YD++  L++HP
Sbjct: 19  LAKHNSKDDCWVSTHERKIYDVSKYLKDHP 48

>KLLA0C05566g complement(497877..499310) similar to sp|P21147
           Saccharomyces cerevisiae YGL055w OLE1 stearoyl-CoA
           desaturase singleton, start by similarity
          Length = 477

 Score = 35.4 bits (80), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 28/50 (56%)

Query: 96  EEVSQHTSRDDCWFIIHGRVYDITGLLENHPGGTKILLKYAGRDATLPFD 145
           +E  +    ++   +I G V+D++G +  HPGG  ++    G+DAT  F+
Sbjct: 385 DEFMEKLKSNNGLVVISGIVHDVSGYITEHPGGETLIQASLGKDATKAFN 434

>AAR153C [341] [Homologous to ScYGL055W (OLE1) - SH]
           (619953..621389) [1437 bp, 478 aa]
          Length = 478

 Score = 35.0 bits (79), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 23/36 (63%)

Query: 110 IIHGRVYDITGLLENHPGGTKILLKYAGRDATLPFD 145
           +I G V+D++G +  HPGG  ++    G+DAT  F+
Sbjct: 398 VISGIVHDVSGYITEHPGGETLIQAALGKDATRAFN 433

>YGL055W (OLE1) [1924] chr7 (398629..400161) Stearoyl-CoA desaturase
           (delta-9 fatty acid desaturase), required for synthesis
           of unsaturated fatty acids [1533 bp, 510 aa]
          Length = 510

 Score = 35.0 bits (79), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 22/35 (62%)

Query: 110 IIHGRVYDITGLLENHPGGTKILLKYAGRDATLPF 144
           II G V+D++G +  HPGG  ++    G+DAT  F
Sbjct: 429 IISGIVHDVSGYISEHPGGETLIKTALGKDATKAF 463

>Sklu_2032.3 , Contig c2032 4286-5854
          Length = 522

 Score = 34.7 bits (78), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 24/40 (60%)

Query: 111 IHGRVYDITGLLENHPGGTKILLKYAGRDATLPFDDVGHS 150
           I G V+D+T  + +HPGG  ++    G+DAT  F+   +S
Sbjct: 415 IEGIVHDVTPFIYDHPGGVTLVETSIGKDATAAFNGAVYS 454

>KLLA0C10692g complement(916718..918280) weakly similar to sp|P21147
           Saccharomyces cerevisiae YGL055w OLE1 stearoyl-CoA
           desaturase singleton, hypothetical start
          Length = 520

 Score = 34.3 bits (77), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 22/35 (62%)

Query: 111 IHGRVYDITGLLENHPGGTKILLKYAGRDATLPFD 145
           I G V+D+T  + +HPGG  ++    G+DAT  F+
Sbjct: 413 IEGIVHDVTPFIYDHPGGVTLVETSIGKDATQAFN 447

>Scas_563.6
          Length = 497

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 26/49 (53%)

Query: 96  EEVSQHTSRDDCWFIIHGRVYDITGLLENHPGGTKILLKYAGRDATLPF 144
           +E  +    +    +I G ++DI+  +  HPGG  ++ +  G+DAT  F
Sbjct: 402 KEFVEQAQLNKNLVVISGIIHDISNYIPEHPGGESLIKQALGKDATRAF 450

>Kwal_14.1845
          Length = 288

 Score = 30.4 bits (67), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 21/36 (58%)

Query: 110 IIHGRVYDITGLLENHPGGTKILLKYAGRDATLPFD 145
           II G V+D++  +  HPGG  ++     +DAT  F+
Sbjct: 207 IISGIVHDVSNYITEHPGGETLIKAALNKDATKAFN 242

>YDL063C (YDL063C) [803] chr4 complement(338272..340134) Protein of
           unknown function, has weak similarity to uncharacterized
           S. pombe Spbc1703.03cp [1863 bp, 620 aa]
          Length = 620

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 60/145 (41%), Gaps = 25/145 (17%)

Query: 56  CSSGHTSK---RTDAIGIVNGSLLN-SKAGGYNRGMGLLRKISIEE---VSQHTSRDDCW 108
           C   H  +   +   + I+   LLN S +       GLLR +S+EE   VS +  R D W
Sbjct: 63  CEDAHMRQLLLKEKLVPIILNKLLNDSNSDIVVESFGLLRNLSLEEGYDVSIYLWRSDIW 122

Query: 109 FII---HGRVYDITGLL---ENHPGGTKILLKYAGRDAT----LPFDDVGHSMESLIYDM 158
             I    GR+ +    L   E  P      LK AG+       L F D   ++ SL+  +
Sbjct: 123 TSITSNFGRIVESLSALQAAEQQPQ-----LKPAGKSKIESKRLLF-DFADNLLSLVVAL 176

Query: 159 APGS--YLGEVDGGENVNSCSSVVS 181
           + GS   L E+     +N    V+S
Sbjct: 177 SNGSDDILNEILTESKINEIFQVIS 201

>Kwal_47.17014
          Length = 1551

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 21/42 (50%)

Query: 148 GHSMESLIYDMAPGSYLGEVDGGENVNSCSSVVSWRSLRWLR 189
           GHS    I + A G  LGEVD    +N  S+VV+ R     R
Sbjct: 872 GHSRVKAIREYAQGESLGEVDVLTAINRLSTVVALRDTELAR 913

>AFL079W [3114] [Homologous to NOHBY] complement(290134..291750)
           [1617 bp, 538 aa]
          Length = 538

 Score = 28.9 bits (63), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 23/49 (46%)

Query: 93  ISIEEVSQHTSRDDCWFIIHGRVYDITGLLENHPGGTKILLKYAGRDAT 141
           +S  EV +  +  +   I    V  +   ++ HPGG K +    GRDAT
Sbjct: 4   LSKSEVEERIANGEVIVIYKSAVLKLDKWIKYHPGGDKAIYHMVGRDAT 52

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.132    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,884,022
Number of extensions: 288798
Number of successful extensions: 650
Number of sequences better than 10.0: 49
Number of HSP's gapped: 647
Number of HSP's successfully gapped: 49
Length of query: 268
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 168
Effective length of database: 13,134,309
Effective search space: 2206563912
Effective search space used: 2206563912
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 60 (27.7 bits)