Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL084W2332298101e-110
KLLA0F27555g2791185155e-65
Kwal_47.181722731184686e-58
Sklu_2260.42691184608e-57
CAGL0L00825g2651254163e-50
Scas_704.423111214152e-49
YIL044C (AGE2)2981204123e-49
Scas_677.6357771952e-17
Sklu_2267.43591181953e-17
Kwal_33.131018731051946e-17
Kwal_23.4569370751928e-17
ABL164C360771901e-16
CAGL0G05445g354751882e-16
YDL226C (GCS1)352771793e-15
KLLA0D18942g357771785e-15
Scas_685.258771081752e-14
AFR725C8731051743e-14
Kwal_27.106764661181682e-13
AGL279C451811663e-13
YDR524C (AGE1)4821141663e-13
CAGL0H01617g3491081644e-13
KLLA0E06787g5151131644e-13
CAGL0G03707g4861011611e-12
Scas_672.9485821557e-12
YNL204C (SPS18)300801521e-11
ACL055W4711221531e-11
YER122C (GLO3)493881531e-11
Kwal_47.172483111241404e-10
Sklu_2181.34141271415e-10
YGL181W (GTS1)3961251406e-10
Scas_707.333961251398e-10
CAGL0L06028g5051251319e-09
KLLA0C17138g3831231256e-08
Scas_602.104471241248e-08
CAGL0K08514g148972690.85
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL084W
         (229 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL084W [1657] [Homologous to ScYIL044C (AGE2) - SH] complement(...   316   e-110
KLLA0F27555g complement(2554571..2555410) some similarities with...   202   5e-65
Kwal_47.18172                                                         184   6e-58
Sklu_2260.4 YIL044C, Contig c2260 5970-6779                           181   8e-57
CAGL0L00825g complement(102709..103506) similar to sp|P40529 Sac...   164   3e-50
Scas_704.42                                                           164   2e-49
YIL044C (AGE2) [2623] chr9 complement(272949..273845) GTPase-act...   163   3e-49
Scas_677.6                                                             80   2e-17
Sklu_2267.4 YDL226C, Contig c2267 4691-5770 reverse complement         80   3e-17
Kwal_33.13101                                                          79   6e-17
Kwal_23.4569                                                           79   8e-17
ABL164C [428] [Homologous to ScYDL226C (GCS1) - SH; ScYNL204C (S...    78   1e-16
CAGL0G05445g complement(514769..515833) similar to sp|P35197 Sac...    77   2e-16
YDL226C (GCS1) [649] chr4 complement(51116..52174) GTPase-activa...    74   3e-15
KLLA0D18942g 1594560..1595633 similar to sp|P35197 Saccharomyces...    73   5e-15
Scas_685.25                                                            72   2e-14
AFR725C [3918] [Homologous to ScYDR524C (AGE1) - SH] (1771660..1...    72   3e-14
Kwal_27.10676                                                          69   2e-13
AGL279C [4033] [Homologous to ScYER122C (GLO3) - SH] (182187..18...    69   3e-13
YDR524C (AGE1) [1336] chr4 complement(1487530..1488978) ADP-ribo...    69   3e-13
CAGL0H01617g 157279..158328 similar to tr|Q04412 Saccharomyces c...    68   4e-13
KLLA0E06787g 618131..619678 similar to sp|P38682 Saccharomyces c...    68   4e-13
CAGL0G03707g complement(355469..356929) similar to sp|P38682 Sac...    67   1e-12
Scas_672.9                                                             64   7e-12
YNL204C (SPS18) [4399] chr14 complement(258374..259276) Sporulat...    63   1e-11
ACL055W [994] [Homologous to ScYGL181W (GTS1) - SH] complement(2...    64   1e-11
YER122C (GLO3) [1552] chr5 complement(402867..404348) GTPase-act...    64   1e-11
Kwal_47.17248                                                          59   4e-10
Sklu_2181.3 YGL181W, Contig c2181 6465-7709                            59   5e-10
YGL181W (GTS1) [1810] chr7 (157910..159100) Putative zinc-finger...    59   6e-10
Scas_707.33                                                            58   8e-10
CAGL0L06028g complement(675584..677101) weakly similar to sp|P40...    55   9e-09
KLLA0C17138g 1497245..1498396 some similarities with sp|P40956 S...    53   6e-08
Scas_602.10                                                            52   8e-08
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...    31   0.85 

>ADL084W [1657] [Homologous to ScYIL044C (AGE2) - SH]
           complement(536243..536944) [702 bp, 233 aa]
          Length = 233

 Score =  316 bits (810), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 160/229 (69%), Positives = 160/229 (69%)

Query: 1   MTSVEVRRVLEQLLRDPCNQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTHVSKV 60
           MTSVEVRRVLEQLLRDPCNQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTHVSKV
Sbjct: 1   MTSVEVRRVLEQLLRDPCNQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTHVSKV 60

Query: 61  KSVDLDTWKEEHLQQVVRFGNNQQANKVFEGRLGGGSYVPDQSKMGQFIKTKYEVRKWYL 120
           KSVDLDTWKEEHLQQVVRFGNNQQANKVFEGRLGGGSYVPDQSKMGQFIKTKYEVRKWYL
Sbjct: 61  KSVDLDTWKEEHLQQVVRFGNNQQANKVFEGRLGGGSYVPDQSKMGQFIKTKYEVRKWYL 120

Query: 121 EEGACXXXXXXXXXXXXXXXXXXXXXXXXGVGREXXXXXXXXXXXXXXXXXXXXXXXRPD 180
           EEGAC                        GVGRE                       RPD
Sbjct: 121 EEGACEPALPEAAPAAASPLPVSVPMSPAGVGREASASPALAVSPAPASPPVYSANARPD 180

Query: 181 LKKSILSLYAKPRQQSPGVXXXXXXXXXXXXXXXXXXXXXXLEDNELFK 229
           LKKSILSLYAKPRQQSPGV                      LEDNELFK
Sbjct: 181 LKKSILSLYAKPRQQSPGVASSASSLNSAAASAGVSYSAASLEDNELFK 229

>KLLA0F27555g complement(2554571..2555410) some similarities with
           sp|P40529 Saccharomyces cerevisiae YIL044c AGE2,
           hypothetical start
          Length = 279

 Score =  202 bits (515), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 86/118 (72%), Positives = 105/118 (88%)

Query: 1   MTSVEVRRVLEQLLRDPCNQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTHVSKV 60
           MTSVEV++VL  LLRDP N +C DCK + HPRWASWSLGVFVCI+CAGFHRS+GTH+SKV
Sbjct: 1   MTSVEVKKVLTTLLRDPENNRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTHISKV 60

Query: 61  KSVDLDTWKEEHLQQVVRFGNNQQANKVFEGRLGGGSYVPDQSKMGQFIKTKYEVRKW 118
           KSVDLDTW EEHL+ V+ FGNN++ N+ +E +LGGG+YVPDQSK+GQFI+TKYE++KW
Sbjct: 61  KSVDLDTWTEEHLEAVLEFGNNKKFNEYYENKLGGGTYVPDQSKIGQFIRTKYELKKW 118

 Score = 29.6 bits (65), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/13 (100%), Positives = 13/13 (100%)

Query: 178 RPDLKKSILSLYA 190
           RPDLKKSILSLYA
Sbjct: 197 RPDLKKSILSLYA 209

>Kwal_47.18172
          Length = 273

 Score =  184 bits (468), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 79/118 (66%), Positives = 96/118 (81%), Gaps = 1/118 (0%)

Query: 1   MTSVEVRRVLEQLLRDPCNQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTHVSKV 60
           M+S  V++VL  LLRDP N  CADCK + HPRWASWSLGVF+CIRCAG HRSLGTH+SKV
Sbjct: 1   MSSPAVKKVLSALLRDPANGTCADCKTAGHPRWASWSLGVFICIRCAGIHRSLGTHISKV 60

Query: 61  KSVDLDTWKEEHLQQVVRFGNNQQANKVFEGRLGGGSYVPDQSKMGQFIKTKYEVRKW 118
           KSVDLDTW+EEHL++VV FGNN  AN V+E +L G  + PD SK+  FI++KYE++KW
Sbjct: 61  KSVDLDTWQEEHLRKVVEFGNNAAANAVYECKLSGN-HTPDASKLSDFIRSKYELKKW 117

 Score = 36.6 bits (83), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 26/68 (38%), Gaps = 16/68 (23%)

Query: 178 RPDLKKSILSLYAKPRQQSPGVXXXXXXXXX----------------XXXXXXXXXXXXX 221
           RPDLKKSILSLY++PR  +  V                                      
Sbjct: 202 RPDLKKSILSLYSRPRASATSVASGASNISLGSSTGNSSNSTPGANFSVPAGSNTTASAS 261

Query: 222 LEDNELFK 229
           LEDNELFK
Sbjct: 262 LEDNELFK 269

>Sklu_2260.4 YIL044C, Contig c2260 5970-6779
          Length = 269

 Score =  181 bits (460), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 80/118 (67%), Positives = 101/118 (85%), Gaps = 1/118 (0%)

Query: 1   MTSVEVRRVLEQLLRDPCNQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTHVSKV 60
           M+S +V++VL  LLRDP N +CADCK S+HPRW SWSLGVFVCI+CAG HRSLGTH+SKV
Sbjct: 1   MSSPQVKKVLATLLRDPDNARCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTHISKV 60

Query: 61  KSVDLDTWKEEHLQQVVRFGNNQQANKVFEGRLGGGSYVPDQSKMGQFIKTKYEVRKW 118
           KSVDLDTW+E+HLQQV+R+GNN++AN  +E +L  GS+ PD SK+  FI+TKYE++KW
Sbjct: 61  KSVDLDTWQEQHLQQVIRWGNNKRANLYYEAKL-QGSHTPDPSKLQSFIRTKYELKKW 117

 Score = 33.5 bits (75), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/24 (66%), Positives = 20/24 (83%), Gaps = 2/24 (8%)

Query: 178 RPDLKKSILSLYAKPR--QQSPGV 199
           RP+LKKSILSLYAKP+  Q +P +
Sbjct: 199 RPELKKSILSLYAKPKVTQSAPSL 222

>CAGL0L00825g complement(102709..103506) similar to sp|P40529
           Saccharomyces cerevisiae YIL044c AGE2, hypothetical
           start
          Length = 265

 Score =  164 bits (416), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 94/125 (75%), Gaps = 6/125 (4%)

Query: 1   MTSVEVRRVLEQLLRDPCNQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTHVSKV 60
           MTSV V++ L  LLRDP N  CADCK+ +HPRWASWSLGVF+CI+CAG HRSLGTH+SKV
Sbjct: 1   MTSVPVKKALTTLLRDPGNASCADCKSQSHPRWASWSLGVFICIKCAGVHRSLGTHISKV 60

Query: 61  KSVDLDTWKEEHLQQVVRFGNNQQANKVFEGRL------GGGSYVPDQSKMGQFIKTKYE 114
           KSVDLDTWKEEHL+++V+  NN  AN+V+E +L       G S   D + + +FI+ KYE
Sbjct: 61  KSVDLDTWKEEHLKELVQMRNNVNANRVYEAKLPDSSKFNGKSLGNDINLLQEFIRQKYE 120

Query: 115 VRKWY 119
            ++W 
Sbjct: 121 RKRWM 125

>Scas_704.42
          Length = 311

 Score =  164 bits (415), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 72/121 (59%), Positives = 91/121 (75%), Gaps = 4/121 (3%)

Query: 2   TSVEVRRVLEQLLRDPCNQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTHVSKVK 61
           TS  V++ L  LLRDP N  CADCK  +HPRWASWSLGVFVCI+CAG HRSLGTH++KVK
Sbjct: 3   TSPSVKKALTALLRDPGNSNCADCKLQSHPRWASWSLGVFVCIKCAGVHRSLGTHITKVK 62

Query: 62  SVDLDTWKEEHLQQVVRFGNNQQANKVFEGRLGGGSY----VPDQSKMGQFIKTKYEVRK 117
           SVDLDTWKEEHL+ +++  NN +AN+ +E  L   S     + D +K+  FI+TKYE++K
Sbjct: 63  SVDLDTWKEEHLEMLIKMRNNVEANRYYEANLPDSSSLKNGITDTNKLQLFIRTKYELKK 122

Query: 118 W 118
           W
Sbjct: 123 W 123

 Score = 33.5 bits (75), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 15/15 (100%)

Query: 178 RPDLKKSILSLYAKP 192
           RPDLKKSILSLY+KP
Sbjct: 212 RPDLKKSILSLYSKP 226

>YIL044C (AGE2) [2623] chr9 complement(272949..273845)
           GTPase-activating protein for Arf1p, has overlapping
           function with Gcs1p in transport from the trans-Golgi
           network (TGN), involved in endocytosis [897 bp, 298 aa]
          Length = 298

 Score =  163 bits (412), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 73/120 (60%), Positives = 87/120 (72%), Gaps = 3/120 (2%)

Query: 2   TSVEVRRVLEQLLRDPCNQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTHVSKVK 61
           TSV V++ L  LLRDP N  CADCK   HPRWASWSLGVF+CI+CAG HRSLGTH+SKVK
Sbjct: 3   TSVPVKKALSALLRDPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVK 62

Query: 62  SVDLDTWKEEHLQQVVRFGNNQQANKVFEGRLGG---GSYVPDQSKMGQFIKTKYEVRKW 118
           SVDLDTWKEEHL ++++F NN +AN  +E  L        + D S +  FIK KYE +KW
Sbjct: 63  SVDLDTWKEEHLVKLIQFKNNLRANSYYEATLADELKQRKITDTSSLQNFIKNKYEYKKW 122

 Score = 31.2 bits (69), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 14/19 (73%), Positives = 16/19 (84%)

Query: 178 RPDLKKSILSLYAKPRQQS 196
           R DLKKSILSLY+KP  Q+
Sbjct: 225 RNDLKKSILSLYSKPSAQT 243

>Scas_677.6
          Length = 357

 Score = 79.7 bits (195), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 54/77 (70%), Gaps = 1/77 (1%)

Query: 5  EVRRVLEQLLRDPCNQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTHVSKVKSVD 64
          + RR L QL +   N++C DC ++ +P+WAS   GVF+C+ CAG HRSLG H+S V+S+ 
Sbjct: 9  DTRRRLLQLQKIGANKKCVDC-HAPNPQWASPKFGVFICLECAGTHRSLGVHISFVRSIT 67

Query: 65 LDTWKEEHLQQVVRFGN 81
          +D +K E L+++ + GN
Sbjct: 68 MDQFKPEELERMEKGGN 84

>Sklu_2267.4 YDL226C, Contig c2267 4691-5770 reverse complement
          Length = 359

 Score = 79.7 bits (195), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 66/118 (55%), Gaps = 3/118 (2%)

Query: 7   RRVLEQLLRDPCNQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTHVSKVKSVDLD 66
           RR L QL +   N++C DC N+ +P+WAS   G+F+C+ CAG HR LG H+S V+S+ +D
Sbjct: 12  RRRLLQLQKIGSNKKCIDC-NAPNPQWASPKFGIFICLECAGIHRGLGVHISFVRSITMD 70

Query: 67  TWKEEHLQQVVRFGNNQQANKVFEGRLGGGSYVPDQSKMGQFIKTKYEVRKWYLEEGA 124
            +K E L ++ + GN  +    +    G    +P + K    I T Y+ +   L EG 
Sbjct: 71  QFKPEELARMEKGGN--EGFNEYMSSHGVDLKLPPKVKYDNPIATDYKNKLTSLVEGT 126

>Kwal_33.13101
          Length = 873

 Score = 79.3 bits (194), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 36/105 (34%), Positives = 62/105 (59%), Gaps = 2/105 (1%)

Query: 16  DPCNQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTHVSKVKSVDLDTWKEEHLQQ 75
           D  N  C DC +S    W S +L   +CI+C+  HRSLG+H+SKV+S+ LD++    +++
Sbjct: 575 DASNTTCCDCGDSNQVEWISINLLCVLCIQCSAVHRSLGSHISKVRSLLLDSFTSREIKE 634

Query: 76  VVRFGNNQQANKVFEGRLGGGSYVPDQS--KMGQFIKTKYEVRKW 118
           ++++ +N+  N ++E  L   S +P  S     +FI  KY  +K+
Sbjct: 635 LLKYVSNKNLNSIYEAELTQKSIIPGSSVADRTRFITDKYVSKKY 679

>Kwal_23.4569
          Length = 370

 Score = 78.6 bits (192), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 52/75 (69%), Gaps = 1/75 (1%)

Query: 7  RRVLEQLLRDPCNQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTHVSKVKSVDLD 66
          RR L QL +   N++C DC+ + +P+WAS   G+F+C+ CAG HR LG H+S V+S+ +D
Sbjct: 12 RRRLLQLQKVGSNKKCVDCE-APNPQWASPKFGIFICLECAGLHRGLGVHISFVRSITMD 70

Query: 67 TWKEEHLQQVVRFGN 81
           +K E L+++ + GN
Sbjct: 71 QFKPEELERMEKGGN 85

>ABL164C [428] [Homologous to ScYDL226C (GCS1) - SH; ScYNL204C
          (SPS18) - SH] (91566..92648) [1083 bp, 360 aa]
          Length = 360

 Score = 77.8 bits (190), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 52/77 (67%), Gaps = 1/77 (1%)

Query: 7  RRVLEQLLRDPCNQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTHVSKVKSVDLD 66
          RR L QL +   N++CADC  + +P+WAS   G+F+C+ CAG HR LG H+S V+S+ +D
Sbjct: 11 RRRLLQLQKLGGNKKCADC-GAPNPQWASPKFGIFICLECAGIHRGLGVHISFVRSITMD 69

Query: 67 TWKEEHLQQVVRFGNNQ 83
           +K E L+++   GN Q
Sbjct: 70 QFKPEELERMEHGGNAQ 86

>CAGL0G05445g complement(514769..515833) similar to sp|P35197
          Saccharomyces cerevisiae YDL226c GCS1 ADP-ribosylation
          factor GTPase-activating protein, start by similarity
          Length = 354

 Score = 77.0 bits (188), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 51/75 (68%), Gaps = 1/75 (1%)

Query: 7  RRVLEQLLRDPCNQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTHVSKVKSVDLD 66
          RR L QL +   N++C DC  + +P+WAS   G+F+C+ CAG HRSLG H+S V+S+ +D
Sbjct: 11 RRRLLQLQKIGANKKCVDC-GAPNPQWASPKFGIFICLECAGTHRSLGVHISFVRSITMD 69

Query: 67 TWKEEHLQQVVRFGN 81
           +K+E L ++   GN
Sbjct: 70 QFKQEELVRMEEGGN 84

>YDL226C (GCS1) [649] chr4 complement(51116..52174)
          GTPase-activating protein (GAP) for ADP-ribosylation
          factors Arf1p and Arf2p, involved in endocytosis,
          exocytosis, secretion, and mitochondrial and vacuolar
          organization, member of the Gcs1p/Glo3p/Sps18p family
          [1059 bp, 352 aa]
          Length = 352

 Score = 73.6 bits (179), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 50/77 (64%), Gaps = 1/77 (1%)

Query: 5  EVRRVLEQLLRDPCNQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTHVSKVKSVD 64
          + RR L QL +   N++C DC  + +P+WA+   G F+C+ CAG HR LG H+S V+S+ 
Sbjct: 9  DTRRRLLQLQKIGANKKCMDC-GAPNPQWATPKFGAFICLECAGIHRGLGVHISFVRSIT 67

Query: 65 LDTWKEEHLQQVVRFGN 81
          +D +K E L ++ + GN
Sbjct: 68 MDQFKPEELLRMEKGGN 84

>KLLA0D18942g 1594560..1595633 similar to sp|P35197 Saccharomyces
          cerevisiae YDL226c GCS1 ADP-ribosylation factor
          GTPase-activating protein (ARF-GAP), start by
          similarity
          Length = 357

 Score = 73.2 bits (178), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 51/77 (66%), Gaps = 1/77 (1%)

Query: 7  RRVLEQLLRDPCNQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTHVSKVKSVDLD 66
          RR L QL +   N++C DC  + +P+WAS   GVF+C+ CAG HR LG H+S V+S+ +D
Sbjct: 11 RRRLLQLQKVGGNKKCLDC-GAHNPQWASPKFGVFICLECAGIHRGLGVHISFVRSITMD 69

Query: 67 TWKEEHLQQVVRFGNNQ 83
           +K + L ++   GN++
Sbjct: 70 QFKSDELVRMENGGNDK 86

>Scas_685.25
          Length = 877

 Score = 72.0 bits (175), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 35/108 (32%), Positives = 60/108 (55%), Gaps = 6/108 (5%)

Query: 17  PCNQQCADCKNS-AHPRWASWSLGVFVCIRCAGFHRSLGTHVSKVKSVDLDTWKEEHLQQ 75
           P NQ+C DC  S     W S +L   VCI+C+G HRS+G H+SK++S+ LD +  + +  
Sbjct: 590 PSNQRCCDCNTSDGTVEWISLNLLCLVCIKCSGVHRSMGAHISKIRSLTLDNFTSKEMIY 649

Query: 76  VVR-FGNNQQANKVFEGRLGGG----SYVPDQSKMGQFIKTKYEVRKW 118
           +++ + +N++ N ++E          S     S+  Q+I  KY  +K+
Sbjct: 650 LIKNYISNEKVNSIYESGTNNTQTRISSNATDSRRSQYINDKYRFKKF 697

>AFR725C [3918] [Homologous to ScYDR524C (AGE1) - SH]
           (1771660..1774281) [2622 bp, 873 aa]
          Length = 873

 Score = 71.6 bits (174), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 57/105 (54%), Gaps = 3/105 (2%)

Query: 16  DPCNQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTHVSKVKSVDLDTWKEEHLQQ 75
           DP N  C DC++     W S ++   VCI C+G HRSLG HVSK++S+ LD++      Q
Sbjct: 559 DPSNSACCDCRSDKQVEWISLNILCVVCINCSGVHRSLGAHVSKMRSLTLDSFSSPESLQ 618

Query: 76  VVRFGNNQQANKVFEGRLGGGSYVPDQS--KMGQFIKTKYEVRKW 118
           +++  +NQ  N ++E         P+ S  +   +I  KY  +K+
Sbjct: 619 LLKCVSNQNVNSLYESE-DLPPIFPENSIDQRKSYITDKYVSKKY 662

>Kwal_27.10676
          Length = 466

 Score = 69.3 bits (168), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 59/118 (50%), Gaps = 13/118 (11%)

Query: 2   TSVEVRRVLEQLLRDPCNQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTHVSKVK 61
           T  E  +V ++L     N+ C DC  + +P W S   GV +CI+C+  HR+LG H++ VK
Sbjct: 11  TKEETTKVFQKLASKQDNRACFDC-GTKNPTWTSVPFGVMLCIQCSAVHRNLGVHITFVK 69

Query: 62  SVDLDTWKEEHLQQVVRFGNNQQANKVFEGRLGGGSYVPDQSKMGQFIKTKYEVRKWY 119
           S +LD W   +L++  + G N +A + F    G            QF+ T  + R  Y
Sbjct: 70  SSNLDKWTVNNLRR-FKLGGNHKAREFFMKNNG-----------KQFLGTNVDARMKY 115

>AGL279C [4033] [Homologous to ScYER122C (GLO3) - SH]
          (182187..183542) [1356 bp, 451 aa]
          Length = 451

 Score = 68.6 bits (166), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 48/81 (59%), Gaps = 2/81 (2%)

Query: 9  VLEQLLRDPCNQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTHVSKVKSVDLDTW 68
          +  +L   P N+ C DC N  +P W S   G+ +CI+C+G HR LG H++ VKS +LD W
Sbjct: 18 IFSKLNSKPENRTCFDCGNK-NPTWTSVPFGIMLCIQCSGEHRKLGVHITFVKSSNLDKW 76

Query: 69 KEEHLQQVVRFGNNQQANKVF 89
             +L++  + G N +A + F
Sbjct: 77 TINNLRR-FKMGGNHRAREFF 96

>YDR524C (AGE1) [1336] chr4 complement(1487530..1488978)
           ADP-ribosylation factor (ARF) GTPase activating protein
           (GAP) with effector functions, involved in endocytosis
           and protein secretion [1449 bp, 482 aa]
          Length = 482

 Score = 68.6 bits (166), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 61/114 (53%), Gaps = 6/114 (5%)

Query: 16  DPCNQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTHVSKVKSVDLDTWKEEHLQQ 75
           D  N +C DC ++A   W S +L   +CI+C+G HRSLG+H+SK++S+ LD +    L  
Sbjct: 180 DKSNLKCCDCGSTATVEWVSINLLCILCIKCSGVHRSLGSHISKIRSLTLDNFTSLELMH 239

Query: 76  VVRFGNNQQANK-VFEGRLGGG-----SYVPDQSKMGQFIKTKYEVRKWYLEEG 123
           +++   +      ++E  L        +   D S+  +FI  KY+ +K+ ++  
Sbjct: 240 LLQNNVSNSNVNAIYESNLRNFPVKKITANSDDSERSKFIIDKYQFKKFVIDSN 293

>CAGL0H01617g 157279..158328 similar to tr|Q04412 Saccharomyces
           cerevisiae YDR524c AGE1, hypothetical start
          Length = 349

 Score = 67.8 bits (164), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 60/108 (55%), Gaps = 5/108 (4%)

Query: 16  DPCNQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTHVSKVKSVDLDTW--KEEHL 73
           D  N++C DC +  +  W S +L   VCI+C+G HRSLG+H+SKV+S+++D      E  
Sbjct: 18  DESNKRCCDCGSRHNVDWVSINLLCVVCIQCSGVHRSLGSHISKVRSLNMDDLHSNRELK 77

Query: 74  QQVVRFGNNQQANKVFEGRLGGGSYVPDQSK---MGQFIKTKYEVRKW 118
             +V    N+  N V+E R+  G  +   ++     ++I  KY  +K+
Sbjct: 78  YLLVNHLINRNVNSVYEARIPAGIKIRKDAQPADRARYIVDKYMHKKY 125

>KLLA0E06787g 618131..619678 similar to sp|P38682 Saccharomyces
           cerevisiae YER122c GLO3 zinc finger protein, start by
           similarity
          Length = 515

 Score = 67.8 bits (164), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 59/113 (52%), Gaps = 4/113 (3%)

Query: 6   VRRVLEQLLRDPCNQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTHVSKVKSVDL 65
           V +V  +L     N+ C DC  + +P W S   GV +CI C+G HR++GTH++ VKS +L
Sbjct: 17  VTKVFARLTTKSENRACFDC-GAKNPTWTSVPFGVLLCIDCSGEHRNMGTHITFVKSSNL 75

Query: 66  DTWKEEHLQQVVRFGNNQQANKVFEGRLGGGSYVPDQSKMGQFIKTKYEVRKW 118
           D W   +L++  + G N +A   F    G        ++M ++  T    +KW
Sbjct: 76  DKWTVNNLRR-FKLGGNDKAKDFFLKNNGKQYLGSSSNRMAKY--TSQVAKKW 125

>CAGL0G03707g complement(355469..356929) similar to sp|P38682
           Saccharomyces cerevisiae YER122c GLO3, hypothetical
           start
          Length = 486

 Score = 66.6 bits (161), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 54/101 (53%), Gaps = 6/101 (5%)

Query: 19  NQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTHVSKVKSVDLDTWKEEHLQQVVR 78
           N+ C DC N  +P W S   GV +CI+C+  HR+LG H++ VKS  LD W   +L++  +
Sbjct: 26  NRVCFDCGNK-NPTWTSVPFGVLLCIQCSAVHRNLGVHITFVKSSTLDKWTVNNLRR-FK 83

Query: 79  FGNNQQANKVFEGRLG----GGSYVPDQSKMGQFIKTKYEV 115
           +G N +A + F    G      S V  Q+K    +  KY+ 
Sbjct: 84  YGGNHKAKEYFMKNNGKQYLNSSNVNAQAKYTSLVAKKYKA 124

>Scas_672.9
          Length = 485

 Score = 64.3 bits (155), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 49/82 (59%), Gaps = 2/82 (2%)

Query: 3  SVEVRR-VLEQLLRDPCNQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTHVSKVK 61
          S E+R+ V ++L     N+ C DC N  +P W S   GV +CI+C+  HR+LG H++ VK
Sbjct: 11 SDELRQQVFQKLSSKLENRVCFDCGNK-NPTWTSVPFGVMLCIQCSAVHRNLGVHITFVK 69

Query: 62 SVDLDTWKEEHLQQVVRFGNNQ 83
          S  LD W   +L++    GNN+
Sbjct: 70 SSTLDKWTINYLRRFKLGGNNK 91

>YNL204C (SPS18) [4399] chr14 complement(258374..259276)
          Sporulation-specific zinc finger protein involved in
          activation of sporulation, member of Gcs1p/Glo3p/Sps18p
          family of zinc-finger proteins [903 bp, 300 aa]
          Length = 300

 Score = 63.2 bits (152), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 52/80 (65%), Gaps = 1/80 (1%)

Query: 4  VEVRRVLEQLLRDPCNQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTHVSKVKSV 63
          +E R+ L +  +   N  C +CK S +P++ S S G+F+C+ CA   R +GT++  VKS+
Sbjct: 10 MENRKRLLRAKKAAGNNNCFECK-SVNPQFVSCSFGIFICVNCANLLRGMGTNIFCVKSI 68

Query: 64 DLDTWKEEHLQQVVRFGNNQ 83
           +D ++E+ +++V + GNN+
Sbjct: 69 TMDNFEEKDVRRVEKSGNNR 88

>ACL055W [994] [Homologous to ScYGL181W (GTS1) - SH]
           complement(267925..269340) [1416 bp, 471 aa]
          Length = 471

 Score = 63.5 bits (153), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 64/122 (52%), Gaps = 9/122 (7%)

Query: 2   TSVEVRRVLEQLLRDPCN-QQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSL-----GT 55
           +S  V R L+ L+  P N  +C +C  + +P W S +LG F+C RCA  HR +     G 
Sbjct: 5   SSRTVERELKALVSSPENANRCGEC-GATYPTWCSVNLGAFLCGRCAAVHRKVLTGEQGG 63

Query: 56  HVSKVKSVDLDTWKEEHLQQVVRFGNNQQANKVFEGRLGGGSY--VPDQSKMGQFIKTKY 113
             S VKS+ LD W  + L+++   G N++ +  +  R     Y    D+S++  FI+ KY
Sbjct: 64  PESHVKSLTLDRWTVDELEEITNSGGNRRNHHTWNVRNVAFPYDGDDDRSRVEDFIRNKY 123

Query: 114 EV 115
            V
Sbjct: 124 IV 125

>YER122C (GLO3) [1552] chr5 complement(402867..404348)
          GTPase-activating protein (GAP) for ADP-ribosylation
          factors Arf1p and Arf2p, involved in retrograde
          transport between Golgi and ER as well as endocytosis
          [1482 bp, 493 aa]
          Length = 493

 Score = 63.5 bits (153), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 50/88 (56%), Gaps = 2/88 (2%)

Query: 2  TSVEVRRVLEQLLRDPCNQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTHVSKVK 61
          T    ++V ++L  +  N+ C DC N  +P W S   GV +CI+C+  HR++G H++ VK
Sbjct: 11 TEQTTQQVFQKLGSNMENRVCFDCGN-KNPTWTSVPFGVMLCIQCSAVHRNMGVHITFVK 69

Query: 62 SVDLDTWKEEHLQQVVRFGNNQQANKVF 89
          S  LD W   +L++  + G N +A   F
Sbjct: 70 SSTLDKWTINNLRR-FKLGGNHKARDFF 96

>Kwal_47.17248
          Length = 311

 Score = 58.5 bits (140), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 62/124 (50%), Gaps = 19/124 (15%)

Query: 3   SVEVRRVLEQLLRDPCN-QQCADCKNSAHPRWASWSLGVFVCIRCAGFHRS-LGTH---- 56
           S    R L+ +L  P N  +C +C N+  P W S +LGVF+C RCA  HR+ LG      
Sbjct: 7   SKAAERELKNILNSPENGNKCGECGNT-FPTWCSINLGVFLCGRCASVHRNILGNRDDEI 65

Query: 57  VSKVKSVDLDTWKEEHLQQVVRFGNNQQANKVFEGRLGGGSYVP-------DQSKMGQFI 109
            S V+S+ +D W    L ++   G N++   ++  +      VP       D+S + QF+
Sbjct: 66  YSDVRSLTMDRWSTRDLDEIAESGGNRRNRMLWNPQ-----NVPFPFDGDEDKSAVEQFV 120

Query: 110 KTKY 113
           + KY
Sbjct: 121 REKY 124

>Sklu_2181.3 YGL181W, Contig c2181 6465-7709
          Length = 414

 Score = 58.9 bits (141), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 65/127 (51%), Gaps = 15/127 (11%)

Query: 3   SVEVRRVLEQLLRDPCN-QQCADCKNSAHPRWASWSLGVFVCIRCAGFHRS-LGTHV--- 57
           S  V + L+ L+  P N  +C +C  + +P W S +LGVF+C RCA  HR  LG      
Sbjct: 6   SKAVEKELKDLVNLPENGNRCGEC-GAPYPTWCSVNLGVFLCGRCASVHRKVLGNRDDDA 64

Query: 58  -SKVKSVDLDTWKEEHLQQVVRFGNNQQANKVFEGR-----LGGGSYVPDQSKMGQFIKT 111
            S VKS+ LD WKE  L  V   G N++   V+  +       G     D+S + +FI+ 
Sbjct: 65  HSDVKSLTLDRWKESDLDCVNNGGGNRRNKSVWNPKDHPFPFDGDD---DKSAVEKFIRD 121

Query: 112 KYEVRKW 118
           KY + K+
Sbjct: 122 KYILGKF 128

>YGL181W (GTS1) [1810] chr7 (157910..159100) Putative zinc-finger
           transcription factor of the Gcs1p/Glo3p/Sps18p family,
           involved in heat resistance, flocculation, timing of bud
           emergence, and regulation of biological rhythms [1191
           bp, 396 aa]
          Length = 396

 Score = 58.5 bits (140), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 63/125 (50%), Gaps = 9/125 (7%)

Query: 6   VRRVLEQLLRDPCN-QQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSL-----GTHVSK 59
           V R L++L+    N  +C +C N  +P W S +LGVF+C RCA  HR +         S 
Sbjct: 13  VDRELKELINSSENANKCGECGN-FYPTWCSVNLGVFLCGRCASVHRKVFGSRDDDAFSN 71

Query: 60  VKSVDLDTWKEEHLQQVVRFGNNQQANKVFEGRLGGGSYVPDQSK--MGQFIKTKYEVRK 117
           VKS+ +D W  E + ++V  G N+   + +  +     +  D  K  +  +I+ KY + K
Sbjct: 72  VKSLSMDRWTREDIDELVSLGGNKGNARFWNPKNVPFPFDGDDDKAIVEHYIRDKYILGK 131

Query: 118 WYLEE 122
           +  +E
Sbjct: 132 FRYDE 136

>Scas_707.33
          Length = 396

 Score = 58.2 bits (139), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 59/125 (47%), Gaps = 9/125 (7%)

Query: 6   VRRVLEQLLRDPCN-QQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSL-----GTHVSK 59
           +   L  LL  P N  +C +C  S  P W S +LGVF+C RCA  HR +         S 
Sbjct: 21  IENELRDLLNAPENANKCGEC-GSTFPTWCSINLGVFLCGRCASVHRKILNGREDDVFSN 79

Query: 60  VKSVDLDTWKEEHLQQVVRFGNNQQANKVFEGRLGGGSYVPDQSK--MGQFIKTKYEVRK 117
           +KS+ LD W  + +  +   G N+  +K +  +     +  D  K  +  FI+ KY + K
Sbjct: 80  LKSLSLDKWNNDDMDILAELGGNKGNHKFWNPKHEPFPFDGDDDKSIVEHFIRDKYILGK 139

Query: 118 WYLEE 122
           +  +E
Sbjct: 140 FRYDE 144

>CAGL0L06028g complement(675584..677101) weakly similar to sp|P40956
           Saccharomyces cerevisiae YGL181w GTS1, start by
           similarity
          Length = 505

 Score = 55.1 bits (131), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 62/125 (49%), Gaps = 22/125 (17%)

Query: 10  LEQLLRDPCN-QQCADCKNSAHPRWASWSLGVFVCIRCAGFHRS-LGTH-------VSKV 60
           L+ ++  P N  +C +C  SA P W S +LGVF+C RCA  HR  LGT         S V
Sbjct: 20  LKDIVNAPENGNRCGEC-GSAVPTWCSTNLGVFLCGRCASVHRKILGTDPDEESGIFSNV 78

Query: 61  KSVDLDTWKEEHLQQVVRFGNNQ-------QANKVFEGRLGGGSYVPDQSKMGQFIKTKY 113
           KS+ ++ W+ E +  V   G N+         N+ F     G     D+S + +F++ KY
Sbjct: 79  KSLSMERWEAEDIDSVASSGGNKGNMRKWNPKNEPFP--FDGDE---DKSAVERFVREKY 133

Query: 114 EVRKW 118
            + K+
Sbjct: 134 IIGKY 138

>KLLA0C17138g 1497245..1498396 some similarities with sp|P40956
           Saccharomyces cerevisiae YGL181w GTS1 transcription
           factor of the GCS1P/GLO3P/SPS18P family singleton,
           hypothetical start
          Length = 383

 Score = 52.8 bits (125), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 59/123 (47%), Gaps = 18/123 (14%)

Query: 19  NQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRS-LGTH----VSKVKSVDLDTWKEEHL 73
           + +C +C  +  P + S +LGVF+C RCA  HR  LG+      S VKS+ LD W +  +
Sbjct: 23  SNKCGEC-GTPFPTYCSVNLGVFLCGRCASVHRKVLGSREDGATSIVKSLSLDRWSKRDV 81

Query: 74  QQVVRFGNNQQANKV---------FEG---RLGGGSYVPDQSKMGQFIKTKYEVRKWYLE 121
           Q V   G N+  +           F+G   R     ++ D+   G+F  T  +V  + LE
Sbjct: 82  QTVADLGGNKHNSSFWNPKKEPFPFDGDEDRTAVEMFIRDKYLKGKFRHTAVKVEDFNLE 141

Query: 122 EGA 124
           + +
Sbjct: 142 DDS 144

>Scas_602.10
          Length = 447

 Score = 52.4 bits (124), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 60/124 (48%), Gaps = 8/124 (6%)

Query: 3   SVEVRRVLEQLLRDPCN-QQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTH---VS 58
           S   +R L + L    N  +C +C    +P W S +  +F+C RCA  H+ +  H   +S
Sbjct: 5   SDSYQRELNRFLDSSENHNKCGECG-LPNPTWCSTTYNLFLCTRCATVHKKILNHDPDLS 63

Query: 59  KVKSVDLDTWKEEHLQQVVRFGNNQQANKVFEGRLGGGSYVPDQSKMGQFIKTKYEVRKW 118
            +KS+ LD W  + L + +  G N   NK F       ++  D +    F++ KY ++K+
Sbjct: 64  IIKSIKLDYWTNDELNKFINSGGN-AYNKRFWNPKDIKNF--DDANWENFLRDKYILKKF 120

Query: 119 YLEE 122
             E+
Sbjct: 121 RYEQ 124

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
            Saccharomyces cerevisiae YKL101w serine/threonine-protein
            kinase, hypothetical start
          Length = 1489

 Score = 31.2 bits (69), Expect = 0.85,   Method: Composition-based stats.
 Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 6/72 (8%)

Query: 11   EQLLRDPCNQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTHVSKVKSVDLDTWKE 70
            EQ +R P   Q    + +  P W S  +  F     +G  + +  H +K+      T++E
Sbjct: 1337 EQQVRKPTESQEKAVQKTTKPSWFSKLIHGFKTTGGSGHTKLIREHSTKM------TFEE 1390

Query: 71   EHLQQVVRFGNN 82
             H+  V  FGNN
Sbjct: 1391 VHMITVKEFGNN 1402

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.135    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,142,787
Number of extensions: 164812
Number of successful extensions: 474
Number of sequences better than 10.0: 36
Number of HSP's gapped: 449
Number of HSP's successfully gapped: 41
Length of query: 229
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 131
Effective length of database: 13,203,545
Effective search space: 1729664395
Effective search space used: 1729664395
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 60 (27.7 bits)