Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL083C35434818580.0
Sklu_2260.63993935611e-68
Kwal_23.57644624324072e-45
YER054C (GIP2)5484944061e-44
Scas_715.465701633534e-37
CAGL0J02904g5431563463e-36
CAGL0L00803g8272003353e-34
Scas_704.415821463061e-30
YIL045W (PIG2)5381442953e-29
KLLA0F27533g4981072343e-21
CAGL0H04037g915691066e-05
Scas_521.1579911049e-05
YOR178C (GAC1)793108993e-04
Scas_659.2159491993e-04
AGR275C67968870.011
Kwal_56.2326242957681.8
YNL148C (ALF1)25496652.8
YLR014C (PPR1)90469654.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL083C
         (348 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL083C [1658] [Homologous to ScYIL045W (PIG2) - SH; ScYER054C (...   720   0.0  
Sklu_2260.6 YIL045W, Contig c2260 9086-10285 reverse complement       220   1e-68
Kwal_23.5764                                                          161   2e-45
YER054C (GIP2) [1483] chr5 complement(262051..263697) Glc7p-inte...   160   1e-44
Scas_715.46                                                           140   4e-37
CAGL0J02904g complement(279516..281147) similar to sp|P40036 Sac...   137   3e-36
CAGL0L00803g 98548..101031 some similarities with sp|P40036 Sacc...   133   3e-34
Scas_704.41                                                           122   1e-30
YIL045W (PIG2) [2622] chr9 (271160..272776) Protein that interac...   118   3e-29
KLLA0F27533g 2549457..2550953 weakly similar to sp|P40036 Saccha...    95   3e-21
CAGL0H04037g complement(379169..381916) weakly similar to sp|P28...    45   6e-05
Scas_521.1                                                             45   9e-05
YOR178C (GAC1) [4975] chr15 complement(667860..670241) Regulator...    43   3e-04
Scas_659.21                                                            43   3e-04
AGR275C [4586] [Homologous to ScYOR178C (GAC1) - SH; ScYLR273C (...    38   0.011
Kwal_56.23262                                                          31   1.8  
YNL148C (ALF1) [4448] chr14 complement(349907..350671) alpha-Tub...    30   2.8  
YLR014C (PPR1) [3432] chr12 complement(172267..174981) Transcrip...    30   4.9  

>ADL083C [1658] [Homologous to ScYIL045W (PIG2) - SH; ScYER054C
           (GIP2) - SH] (537421..538485) [1065 bp, 354 aa]
          Length = 354

 Score =  720 bits (1858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/348 (100%), Positives = 348/348 (100%)

Query: 1   MNGGLGLQKSNIYIKPRSSQEGKYSSLALLRKPQRISSRTEREEQENILKRNTDYNRKRG 60
           MNGGLGLQKSNIYIKPRSSQEGKYSSLALLRKPQRISSRTEREEQENILKRNTDYNRKRG
Sbjct: 1   MNGGLGLQKSNIYIKPRSSQEGKYSSLALLRKPQRISSRTEREEQENILKRNTDYNRKRG 60

Query: 61  GGTWAADENIDPLDGDESPRRAGSPVVLTDYFSQSHAVYDNVGHQRSNSLPGTPTSALKR 120
           GGTWAADENIDPLDGDESPRRAGSPVVLTDYFSQSHAVYDNVGHQRSNSLPGTPTSALKR
Sbjct: 61  GGTWAADENIDPLDGDESPRRAGSPVVLTDYFSQSHAVYDNVGHQRSNSLPGTPTSALKR 120

Query: 121 PGGVRRSKSVHFDNRDVVSVKYFNSDESTLLVAHAQSFEDQLRLRQDARELAPNGLTLVA 180
           PGGVRRSKSVHFDNRDVVSVKYFNSDESTLLVAHAQSFEDQLRLRQDARELAPNGLTLVA
Sbjct: 121 PGGVRRSKSVHFDNRDVVSVKYFNSDESTLLVAHAQSFEDQLRLRQDARELAPNGLTLVA 180

Query: 181 PAGGMAGGAKSPRKPLRKSKCFRQYQLRPQLRTLRNVNFPILANKDPAVLTLNIFLNIAY 240
           PAGGMAGGAKSPRKPLRKSKCFRQYQLRPQLRTLRNVNFPILANKDPAVLTLNIFLNIAY
Sbjct: 181 PAGGMAGGAKSPRKPLRKSKCFRQYQLRPQLRTLRNVNFPILANKDPAVLTLNIFLNIAY 240

Query: 241 NRKVFLQDLSLDSMLVMTGRVLVKNIHYDKSVIVRYTWDNWAHTSDTASVWISSGNAVLP 300
           NRKVFLQDLSLDSMLVMTGRVLVKNIHYDKSVIVRYTWDNWAHTSDTASVWISSGNAVLP
Sbjct: 241 NRKVFLQDLSLDSMLVMTGRVLVKNIHYDKSVIVRYTWDNWAHTSDTASVWISSGNAVLP 300

Query: 301 GKDMDLFEFAIDVPAPVSGTPRLEFCIRYQVRDNSDFQTHWDNNHGNN 348
           GKDMDLFEFAIDVPAPVSGTPRLEFCIRYQVRDNSDFQTHWDNNHGNN
Sbjct: 301 GKDMDLFEFAIDVPAPVSGTPRLEFCIRYQVRDNSDFQTHWDNNHGNN 348

>Sklu_2260.6 YIL045W, Contig c2260 9086-10285 reverse complement
          Length = 399

 Score =  220 bits (561), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 158/393 (40%), Positives = 198/393 (50%), Gaps = 71/393 (18%)

Query: 12  IYIKPRS---SQEGKYSSLALLRKPQRISSRTEREEQENILKRNTDYNRKRGGGTWAADE 68
           +YIK  +   S E K  SL  L KPQR++ + +    E+ L+RNT+ NR    G     E
Sbjct: 1   MYIKKLTNNYSGENKPRSLDFLHKPQRVT-QLKTLYAEDSLQRNTNLNR----GPPPDYE 55

Query: 69  NIDPLD-----GDESPRRAGSPVVLTDYFSQSHAVYDNV---------------GHQRSN 108
           N+ P D     GD +  R GS   L  YF      Y                   H RS 
Sbjct: 56  NVAPTDSREYYGDGTLHR-GSIGSLNSYFPDVDEYYPPKPIRKKSGELVKSSLKQHHRSK 114

Query: 109 SLPGTPTSALKRPGGV-----RRSKSVHFDNRDVVSVKYFNSDESTLLVAHAQSFEDQLR 163
           SLP TPT    R   +     +RSKSVHFD RDVVSVKYF  DE  + VA  +  EDQL 
Sbjct: 115 SLPATPTGREPRTEIIIMEPPKRSKSVHFDQRDVVSVKYFQKDERPVEVAQREVEEDQLS 174

Query: 164 LRQDARELAPNGLTLVAPAGGMAGGAKSPRKPLRKSKCFRQYQ--------------LRP 209
                     + L+   P        +  ++PLR+SK                      P
Sbjct: 175 FTPKQLSFMNSWLSNSTP--------EETKRPLRRSKKHMMMMNGSGPSPATTASGSSMP 226

Query: 210 QLRTLRNVNFPILANKDPAVLTLNIFLNIAYNRKVFLQDLSL--DSMLVMTGRVLVKNIH 267
            +  L N NFPIL+NK+P  L LNIFLNIA+ ++VFLQDLSL  D   V+ G+VLVKNI 
Sbjct: 227 PVPGLYNKNFPILSNKNPTSLKLNIFLNIAHGKQVFLQDLSLLGDGNYVV-GKVLVKNIC 285

Query: 268 YDKSVIVRYTWDNWAHTSDTASVWISSGNAVLPGKDMDLFEFAIDVPAPVS--------- 318
           YDK VIVRYTWD W  T D   VW SSG+ VLPG +MD+F+F +DVP   +         
Sbjct: 286 YDKQVIVRYTWDQWNTTHDVQCVWFSSGDIVLPGMNMDMFKFVVDVPVDSAEATLATTDP 345

Query: 319 ---GTPRLEFCIRYQVRDNSDFQTHWDNNHGNN 348
              G   ++FCIRY  RD +  + HWDNN+G N
Sbjct: 346 DKEGGREVQFCIRYTTRDGNYREEHWDNNNGKN 378

>Kwal_23.5764
          Length = 462

 Score =  161 bits (407), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 143/432 (33%), Positives = 183/432 (42%), Gaps = 103/432 (23%)

Query: 17  RSSQEGKYS--SLALLRKPQRISSRTEREEQENILKRNTDYNRK---------------- 58
           R    G ++  SLA L KPQR++        E  L+RNTD NR                 
Sbjct: 12  REGSNGAFTDRSLAFLHKPQRVTQPRALYADE-WLRRNTDMNRGNVKVENCPEDYFSQNF 70

Query: 59  RGGG----TWAADEN-IDPLDGDESPRRAGSPVVLTDYF--SQSHAVYDNVG-------- 103
           +G G    T A++ N  DP   + S     SP+ +  YF   +   V D           
Sbjct: 71  KGDGPTKQTAASEANGFDPSASNASAGDTASPLRVNPYFPAEEDSVVADAAAPPLVRKKS 130

Query: 104 ----------HQRSNSLPGTPT--SALKRPGGV-----RRSKSVHFDNRDVVSVKYFNSD 146
                      QRS SLP TP+     KR GG      +RSKSVHFD RDVV  KYF  +
Sbjct: 131 GEVVRPSLKMAQRSRSLPATPSDREPDKRLGGPPAAGPKRSKSVHFDQRDVVKFKYFWQE 190

Query: 147 ESTLLVAHAQSFEDQL-----------------------------RLRQDARELAPNGLT 177
           +S L VA     E  L                             R  Q    ++ + LT
Sbjct: 191 DSPLDVAEQDVLEGPLDDQRAKTVVGPTSMARDLTVDDDDDGNDDRAVQRDLTMSLSNLT 250

Query: 178 LVAPAGGMAGGAKSPRKPLRKSKCFRQYQLRPQLRTLRNVNFPILANKDPAVLTLNIFLN 237
                   +GG    R+  R  K   Q    P    L + NF  LA+ D   L  NIFLN
Sbjct: 251 FERRMSNTSGGGL--RRSRRYQKLKAQGATPPTRPGLYHANFATLADDDQCSLKSNIFLN 308

Query: 238 IAYNRKVFLQDLSL-DSMLVMTGRVLVKNIHYDKSVIVRYTWDNWAHTSDTASVWISSGN 296
           IA+N   FLQ+LSL      + G VLVKN++Y+K+V+VRYT D+W  + D   VW SSG+
Sbjct: 309 IAHNSSCFLQELSLIGDQHYLVGHVLVKNVYYEKTVLVRYTRDSWRTSRDIECVWASSGD 368

Query: 297 AVLPGKDMDLFEFAIDVPAPVSG--------------------TPRLEFCIRYQVRDNSD 336
            VLPG  MD F+  ID+     G                    T RL+FCI+Y  RD + 
Sbjct: 369 DVLPGMHMDRFKLVIDLAGLQEGDTSRDSTPSHDSAGHACQLSTVRLQFCIQYVSRDANS 428

Query: 337 FQTHWDNNHGNN 348
              +WDNN G N
Sbjct: 429 RVEYWDNNAGRN 440

>YER054C (GIP2) [1483] chr5 complement(262051..263697)
           Glc7p-interacting protein, possible regulatory subunit
           for the PP1 family protein phosphatase Glc7p [1647 bp,
           548 aa]
          Length = 548

 Score =  160 bits (406), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 140/494 (28%), Positives = 201/494 (40%), Gaps = 159/494 (32%)

Query: 10  SNIYIKPR-SSQEGKYSSLALLRKPQRISSRTEREEQENILKRNTDYNRK---------- 58
           S++Y K R  S E   +SL  L KPQR++        E  ++RNTD N++          
Sbjct: 41  SDLYNKERDGSTEETLNSLKFLHKPQRVTQMRANRFPEEEVQRNTDLNKRIFSAGNDENV 100

Query: 59  ---RGGGTWAADEN---IDPLDGDESPR----------RAGSPVVLTDYFSQSHA----- 97
               G    AA +N   ++ L+G   P           ++  P      + ++ +     
Sbjct: 101 DNESGWSKIAAAKNHTSVESLNGSTRPPFKIELPPLSPKSTVPKSFQAEYPEAKSPGNDM 160

Query: 98  ---------------VYDNVGH-------QRSNSLPGTPTSALKRPGGVR---------R 126
                          VY   G        +RS SLP TP   ++   GV+         R
Sbjct: 161 NFEYDEEILIPFAPPVYKKSGELLKSSLKRRSKSLPTTP--GIRSGNGVQARDGSPMLIR 218

Query: 127 SKSVHFDNRDVVSVKYFNSDESTLLVAHAQSFEDQLRLRQ-------------------- 166
           SKSVHFD      VKYF  DES + V   +  ++ L  +                     
Sbjct: 219 SKSVHFD--QAAPVKYFAEDESPINVNKTEQHDNCLSFKHKPVNLMVDPEEETKMLSSGL 276

Query: 167 -------DARELAPNGLTLVAPAGGMAGGAKSPRKPLRKSKCFR-----QYQLRP----- 209
                  D   +AP G    A       G  +    LRKSK F+     +  + P     
Sbjct: 277 ETTSIDDDLTTVAPKGFAHPAKISNPNNGKGTNNTKLRKSKRFQNLLKNRTDMPPSKSNK 336

Query: 210 -------------------QLRTLRNVNFPILANKDPAVLTLNIFLNIAYNRKVFLQDLS 250
                               +  L + NFPIL+NK+P  L LNIF+N++ N+KVFLQ+LS
Sbjct: 337 KFVNGGGAHEISDRNSKNYHVVGLYSKNFPILSNKNPKSLKLNIFINLSQNKKVFLQELS 396

Query: 251 L------------------------------------DSMLVMTGRVLVKNIHYDKSVIV 274
           L                                        ++ GR+LVKNI YDK V+V
Sbjct: 397 LYIHRDNNYFSNSSSFYNIPNSHNGNDCNGVAKGYNAGCTRLIAGRILVKNIFYDKRVVV 456

Query: 275 RYTWDNWAHTSDTASVWISSGNAVLPGKDMDLFEFAIDVPAPVSGTPRLEFCIRYQVRDN 334
           RYTWD+W  T +   V+IS G+ +LPG +MD+F F ID  + V    +LEFCI Y  R++
Sbjct: 457 RYTWDSWRTTHEVECVYISDGDGILPGTNMDIFHFIIDDVSKVDPRGKLEFCIHYSTRND 516

Query: 335 SDFQTHWDNNHGNN 348
            + + +WDNN+GNN
Sbjct: 517 YEREEYWDNNNGNN 530

>Scas_715.46
          Length = 570

 Score =  140 bits (353), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 96/163 (58%), Gaps = 28/163 (17%)

Query: 214 LRNVNFPILANKDPAVLTLNIFLNIAYNRKVFLQDLSLD--------------------- 252
           L N+NFPIL+NK+P  L LNIF+ ++ ++K FLQ+++L                      
Sbjct: 391 LYNINFPILSNKNPKSLKLNIFIKLSKDKKCFLQEVTLHIEKENPLKRLLPANGSNSEFG 450

Query: 253 -------SMLVMTGRVLVKNIHYDKSVIVRYTWDNWAHTSDTASVWISSGNAVLPGKDMD 305
                  S  ++TG++LVKNI YDK VIVRYTW++W    D   +W+S G+ ++PG +MD
Sbjct: 451 QGSIIQRSTRLITGKILVKNIFYDKRVIVRYTWNDWRTVHDVECIWVSDGDGIVPGTNMD 510

Query: 306 LFEFAIDVPAPVSGTPRLEFCIRYQVRDNSDFQTHWDNNHGNN 348
           +F F ID    +    +LEFCI+Y  R++++   +WDNN G N
Sbjct: 511 VFRFLIDDANKLEARAKLEFCIQYTARNDTERLEYWDNNDGKN 553

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 68/232 (29%), Positives = 90/232 (38%), Gaps = 51/232 (21%)

Query: 17  RSSQEGKYSSLALLRKPQRISSRTEREEQENILKRNTDYN---RKRGGGTWAADEN---- 69
           R +     +S+  L KPQR++     +  E  +KRNTD N   R    G+ A DE     
Sbjct: 80  RKTSLNSLNSMDFLYKPQRVTQMNVDKFPEEEVKRNTDLNKNIRLVTSGSVAKDEEETGR 139

Query: 70  --IDPLDGDE-SPR--------------------RAGSPVVLTDYFSQSHAVYDNVGHQR 106
             + P+D  E SPR                    R      L+  + +S  +  +   +R
Sbjct: 140 EYMSPIDLPEISPRSTIQSSEFIQNNKTQEGVDERYDGITPLSPIYKKSGELLKSSLKRR 199

Query: 107 SNSLPGTPTSALKR------PGGVRRSKSVHFDNRDVVSVKYFNSDESTLLVAHAQSFED 160
           S SLP T     K          + RSKSVHFD +    VKYF  DES   V     F++
Sbjct: 200 SKSLPSTSEILQKSLRFENDAMEMVRSKSVHFDQK--APVKYFREDESPSTVNMMAEFDN 257

Query: 161 QLRLRQDA---------RELAPNGLTLVAPAGGMAGGAKSPRKPLRKSKCFR 203
            L L             +ELA  GL  V    G     K     LRKSK F+
Sbjct: 258 LLNLMHKPVNRVFEYGDKELAALGLDKV----GDTAVNKGAETKLRKSKRFQ 305

>CAGL0J02904g complement(279516..281147) similar to sp|P40036
           Saccharomyces cerevisiae YER054c GIP2, hypothetical
           start
          Length = 543

 Score =  137 bits (346), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 68/156 (43%), Positives = 91/156 (58%), Gaps = 21/156 (13%)

Query: 214 LRNVNFPILANKDPAVLTLNIFLNIAYNRKVFLQDLSLD--------------------S 253
           L N NFPIL+NK+P  L LNIF+N++  ++VFLQ+LSL                     +
Sbjct: 369 LYNENFPILSNKNPKSLKLNIFINLSQGKEVFLQELSLHIHRERAFYSPGSGVDIGTPIN 428

Query: 254 MLVMTGRVLVKNIHYDKSVIVRYTWDNWAHTSDTASVWISSGNAVLP-GKDMDLFEFAID 312
             +++GRVLVKNI +DK V++RYTWD W +  D   VW+SS   ++P G  MD+F F ID
Sbjct: 429 TRLLSGRVLVKNIFFDKRVLIRYTWDRWRNVQDVEGVWVSSAQGLVPGGAAMDVFHFVID 488

Query: 313 VPAPVSGTPRLEFCIRYQVRDNSDFQTHWDNNHGNN 348
                 G   LEFCI+Y  RD++     WDNN G N
Sbjct: 489 DATKWEGKASLEFCIQYTTRDDTQRLEFWDNNCGKN 524

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 54/181 (29%), Positives = 72/181 (39%), Gaps = 49/181 (27%)

Query: 22  GKYSSLALLRKPQRISSRTEREEQENILKRNTDYNR------------KRGGGTWAADEN 69
           GK +SL  L KPQR+S   +    E  L RNT  N+             +G G   A E 
Sbjct: 38  GKLTSLQFLHKPQRVSQLNKDRFPEEELLRNTQLNKNLHQVDSNYREYSQGPGDGGASER 97

Query: 70  ---------IDP---------------LDGDESPRRAG--SPVVLTDYFSQSHAVYDNVG 103
                    + P               LD D S       SP V    + +S     +V 
Sbjct: 98  QQARDDLIPLSPKSTLPELDTNMLDNTLDSDNSSNDLAPFSPPV----YKKSGEPVKSVL 153

Query: 104 HQRSNSLPGTP-----TSALKRPGGVRRSKSVHFDNRDVVSVKYFNSDESTLLVAHAQSF 158
            +RS SLPGTP           P  + RSKSVHFD      V+YFN +E  + V++A  +
Sbjct: 154 KRRSKSLPGTPGLNTSMHGASPPNKLMRSKSVHFDQ--TAPVRYFNENERPIDVSNADIY 211

Query: 159 E 159
           +
Sbjct: 212 Q 212

>CAGL0L00803g 98548..101031 some similarities with sp|P40036
           Saccharomyces cerevisiae YER054c GIP2 or sp|P40187
           Saccharomyces cerevisiae YIL045w PIG2, hypothetical
           start
          Length = 827

 Score =  133 bits (335), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 105/200 (52%), Gaps = 36/200 (18%)

Query: 182 AGGMAGGAKSPRKPLRKSKCFRQYQLRPQLRTLRNVNFPILANKDPAVLTLNIFLNIAYN 241
             G+    K P  P+ +S   ++ +   ++ TL + NFP L +K    L LNIFLN   +
Sbjct: 625 GSGLKDNFKDPTPPVSQSSTSKKEE---KMTTLVSKNFPTLGSKTSKSLKLNIFLNSTSD 681

Query: 242 RKVFLQDLSL---------------------------DSMLVMTGRVLVKNIHYDKSVIV 274
           +KV LQ++SL                           D  L++TG VLVKNI++DK V +
Sbjct: 682 KKVLLQEVSLNVQKRKSNYYNSNFGGPGIGFSTGRDEDDKLIITGTVLVKNIYFDKKVSI 741

Query: 275 RYTWDNWAHTSDTASVWISSGNAVLPGKDMDLFEFAIDVPAPVSG------TPRLEFCIR 328
           RYTWD+W   ++  S+++ SGN  LPG  MD+F F ID     +G      +  LEFCI+
Sbjct: 742 RYTWDHWRSCNEVESMYVGSGNNYLPGSQMDIFRFMIDNTVLSNGQYVSNRSRELEFCIQ 801

Query: 329 YQVRDNSDFQTHWDNNHGNN 348
           Y  R N+  + +WDNN+G N
Sbjct: 802 YTTRSNTAREEYWDNNNGKN 821

 Score = 36.2 bits (82), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 37/73 (50%), Gaps = 13/73 (17%)

Query: 105 QRSNSLPGTPTSALKRPG--GVR---------RSKSVHFDNRDVVSVKYFNSDESTLLVA 153
           +RS SLP TP S  +     GVR         RSKSVHFD R  + VKYF  +ES  +V+
Sbjct: 467 RRSKSLPVTPNSNRRTQNSRGVRMNNPRDQLIRSKSVHFDQR--LPVKYFFKEESPSVVS 524

Query: 154 HAQSFEDQLRLRQ 166
                +D L  + 
Sbjct: 525 IRDEEDDVLSFQH 537

 Score = 29.3 bits (64), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 2/61 (3%)

Query: 21  EGKYSSLALLRKPQRISS-RTEREEQENILKRNTDYNRKRGGGTWAADENI-DPLDGDES 78
           +G+ +SL  L KPQR++  ++E       LKRNTD N++        D+ I D +D   +
Sbjct: 307 KGRINSLDFLHKPQRVTQMKSEDFISPEELKRNTDMNKQILMAKILPDDRINDKIDDITT 366

Query: 79  P 79
           P
Sbjct: 367 P 367

>Scas_704.41
          Length = 582

 Score =  122 bits (306), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 84/146 (57%), Gaps = 15/146 (10%)

Query: 218 NFPILANKDPAVLTLNIFLNIAYNRKVFLQDLSL---------------DSMLVMTGRVL 262
           NFP L NK+P  L LNIF+N +  +KVFLQDL+L                    + GR L
Sbjct: 418 NFPTLNNKNPRSLKLNIFVNYSKGKKVFLQDLNLHIQNDYINNHVGNNNKQNKYIIGRAL 477

Query: 263 VKNIHYDKSVIVRYTWDNWAHTSDTASVWISSGNAVLPGKDMDLFEFAIDVPAPVSGTPR 322
           V+NI++DK V+++YTWDNW    D  ++++S    ++PG +MD+F+F ID          
Sbjct: 478 VENIYFDKKVVLKYTWDNWRSYRDIEAIYVSDAKQIIPGSNMDVFKFLIDDVNKSVSKCH 537

Query: 323 LEFCIRYQVRDNSDFQTHWDNNHGNN 348
           LEFCI+YQ R+  + +  WDNN   N
Sbjct: 538 LEFCIQYQTRNEKERKEFWDNNDDKN 563

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 40/75 (53%), Gaps = 15/75 (20%)

Query: 105 QRSNSLPGTPTSA---LKRPGG----------VRRSKSVHFDNRDVVSVKYFNSDESTLL 151
           +RS SLP TP  +   L+R  G          + RSKSVHF N   + V++F+ DES ++
Sbjct: 212 RRSQSLPVTPNISNLNLRRINGHANGNDRAHHLARSKSVHFAN--TLPVRFFSKDESPII 269

Query: 152 VAHAQSFEDQLRLRQ 166
           VA +    ++L  + 
Sbjct: 270 VAESHEITNELNFKH 284

>YIL045W (PIG2) [2622] chr9 (271160..272776) Protein that interacts
           with Gsy2p, possible regulatory subunit for the
           PP1-family protein phosphatase Glc7p [1617 bp, 538 aa]
          Length = 538

 Score =  118 bits (295), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 94/144 (65%), Gaps = 10/144 (6%)

Query: 214 LRNVNFPILANKDPAVLTLNIFLNIAYNRKVFLQDLSLDS---MLVMTGRVLVKNIHYDK 270
           L N NFPIL++++   L LNIFLN++  R VFLQ+++L +    +V+ G+V VKNI++DK
Sbjct: 362 LYNKNFPILSDRNRKSLKLNIFLNLSRGRPVFLQEITLLTGFHNMVIIGKVFVKNIYFDK 421

Query: 271 SVIVRYTWDNWAHTSDTASVWISSGNAVLPGKDMDLFEFAI-DVPAPV---SGTPRLEFC 326
            +IVRYTWD W    ++  V+ S+ N +LPG +MD+F+F+I D+  P    S   +LEFC
Sbjct: 422 KIIVRYTWDAWRTFHESECVYFSNANGILPGSNMDIFKFSIDDIHNPNDKDSNISQLEFC 481

Query: 327 IRYQV--RDNSDFQTHWDNNHGNN 348
           I+Y     D S  + +WDNN   N
Sbjct: 482 IQYLTWGVDRSR-KEYWDNNDSAN 504

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 76/190 (40%), Gaps = 51/190 (26%)

Query: 22  GKYSSLALLRKPQRISSRTEREEQENILKRNTDYNRK---------------RGGGTWAA 66
            + +SL  L KP+R+S+       ++ L+RNTD N+                  G  + A
Sbjct: 48  ARLNSLEFLHKPRRLSNVKLHRLPQDELQRNTDMNKGMYFNGKQVHAHHPFINSGANFNA 107

Query: 67  -----------DENIDPLDGD----ESPRRAG-SPVVLTDYFSQSHAVYDNVGHQRSNSL 110
                      ++ I PL  D    ES      SP +    + +S  +  +   +RS SL
Sbjct: 108 HHQDVSKLGEEEDEISPLSHDNFQYESEENGNPSPPI----YKKSGELVKSSLKRRSKSL 163

Query: 111 PGTPTSALKRPGG--------------VRRSKSVHFDNRDVVSVKYFNSDESTLLVAHAQ 156
           P TP S   + G               ++RSKSVHFD   V+ +K FN +E  + V    
Sbjct: 164 PITPKSIFNKTGSKSKHVNLDHVDTRLLQRSKSVHFDR--VLPIKLFNENEKPIDVGKQM 221

Query: 157 SFEDQLRLRQ 166
             +D L  + 
Sbjct: 222 VQQDVLNFKH 231

>KLLA0F27533g 2549457..2550953 weakly similar to sp|P40036
           Saccharomyces cerevisiae YER054c GIP2 GLC7P-interacting
           protein, hypothetical start
          Length = 498

 Score = 94.7 bits (234), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 67/107 (62%), Gaps = 5/107 (4%)

Query: 246 LQDLSLDSM-LVMTGRVLVKNIHYDKSVIVRYTWDNWAHTSDTASVWISSGNAVLPGK-- 302
           LQDL LD+   ++ G V+V+NI Y+K VIVRYT D+W    D  SVWI++   +  G   
Sbjct: 385 LQDLRLDTQGHMLIGNVIVRNISYEKRVIVRYTLDSWKSQQDVESVWITNHCNLKSGTGA 444

Query: 303 -DMDLFEFAIDVPAPVSGTPRLEFCIRYQVRDNSDFQTHWDNNHGNN 348
            D+D+F+FAID+   ++    +E CI YQ R+ S +  HWDNN G N
Sbjct: 445 IDIDVFQFAIDL-GKINTIEHIEMCILYQTREGSSWIDHWDNNSGQN 490

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 27/40 (67%)

Query: 20 QEGKYSSLALLRKPQRISSRTEREEQENILKRNTDYNRKR 59
          Q GK+SSL  LRKPQRIS + E     + LKRNTD N+ +
Sbjct: 11 QSGKFSSLNFLRKPQRISCQVETTAMNDALKRNTDLNKSK 50

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 29/51 (56%), Gaps = 4/51 (7%)

Query: 106 RSNSLPGTP----TSALKRPGGVRRSKSVHFDNRDVVSVKYFNSDESTLLV 152
           RS SLP +P     S  +RP   +RSKSVHF   +   VKYF  DES L +
Sbjct: 170 RSKSLPTSPLEGRVSQEQRPPVFKRSKSVHFAQSEKFEVKYFREDESPLFL 220

>CAGL0H04037g complement(379169..381916) weakly similar to sp|P28006
           Saccharomyces cerevisiae YOR178c GAC1 ser/thr
           phosphoprotein phosphatase 1, hypothetical start
          Length = 915

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 43/69 (62%), Gaps = 7/69 (10%)

Query: 247 QDLSLDSMLVMTGRVLVKNIHYDKSVIVRYTWDNWAHTSDTASVWISSGNAVLPGKDMDL 306
           QD ++D  +V  G++LVKN++Y+K + V+YT++NW       + +  S +A     ++D 
Sbjct: 290 QDSTIDDKIV--GKILVKNLNYEKFIEVKYTFNNWNDIHYITAYFTKSISA-----EIDE 342

Query: 307 FEFAIDVPA 315
           FEF I++ +
Sbjct: 343 FEFKINLSS 351

>Scas_521.1
          Length = 579

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 44/91 (48%), Gaps = 21/91 (23%)

Query: 257 MTGRVLVKNIHYDKSVIVRYTWDNWAHTSDTASVWISSGNAVLPGKDMDLFEFAIDVPA- 315
           + G +LV NI ++K++ V++T++NW +     + +  S NA       D F+F ID+ + 
Sbjct: 205 LVGLILVNNIQFEKNIEVKFTFNNWENICYQVAYFNRSLNA-----KFDEFKFTIDLTSF 259

Query: 316 --------------PVSGTP-RLEFCIRYQV 331
                         PV+  P  +E C RY V
Sbjct: 260 KSLLKLQKILYTKDPVTHCPINIEMCCRYDV 290

>YOR178C (GAC1) [4975] chr15 complement(667860..670241) Regulatory
           subunit for protein serine/threonine phosphatase Glc7p
           [2382 bp, 793 aa]
          Length = 793

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 53/108 (49%), Gaps = 25/108 (23%)

Query: 257 MTGRVLVKNIHYDKSVIVRYTWDNWAHTSDTASVWISSGNAVLPGKDMDLFEFAIDVPA- 315
           +TG V VKN+ ++K + +++T+++W         ++++        ++D F+F ID+ + 
Sbjct: 258 ITGLVYVKNLSFEKYLEIKFTFNSWRDIH-----YVTANFNRTINSNVDEFKFTIDLNSL 312

Query: 316 --------------PVSGTP-RLEFCIRYQVRDNSDFQTHWDNNHGNN 348
                           S  P  +E C RY V +    +T++DNN+G N
Sbjct: 313 KYILLIKRIITMEKNTSSCPLNIELCCRYDVNN----ETYYDNNNGKN 356

>Scas_659.21
          Length = 594

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 43/91 (47%), Gaps = 21/91 (23%)

Query: 257 MTGRVLVKNIHYDKSVIVRYTWDNWAHTSDTASVWISSGNAVLPGKDMDLFEFAIDVPA- 315
           + G +LV NI ++K++ V++T++NW +     + +  S N        D F+F ID+ + 
Sbjct: 223 LVGLILVNNIQFEKNIEVKFTFNNWENICYQVAYFNRSLNV-----KFDEFKFTIDLTSF 277

Query: 316 --------------PVSGTP-RLEFCIRYQV 331
                         PV+  P  +E C RY V
Sbjct: 278 KSLLKLQKILYTKDPVTHCPINIEMCCRYDV 308

>AGR275C [4586] [Homologous to ScYOR178C (GAC1) - SH; ScYLR273C
           (PIG1) - SH] (1254768..1256807) [2040 bp, 679 aa]
          Length = 679

 Score = 38.1 bits (87), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 37/68 (54%), Gaps = 5/68 (7%)

Query: 246 LQDLSLDSMLVMTGRVLVKNIHYDKSVIVRYTWDNWAHTSDTASVWISSGNAVLPGKDMD 305
           L  +SL  M  + G + V N+H++K + V++++D W +     + ++ +  +      +D
Sbjct: 275 LNKVSLVDMHTIKGSLYVTNLHFEKFIEVKFSFDEWKNIHYVTAQYLKTVTS-----KVD 329

Query: 306 LFEFAIDV 313
            F+F ID+
Sbjct: 330 EFQFIIDL 337

>Kwal_56.23262
          Length = 429

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 32/57 (56%), Gaps = 5/57 (8%)

Query: 257 MTGRVLVKNIHYDKSVIVRYTWDNWAHTSDTASVWISSGNAVLPGKDMDLFEFAIDV 313
           + G + V N++++KS+ +++T++NW    D   V      ++     +D F+F ID+
Sbjct: 36  LQGLIYVANLNFEKSLEIKFTFNNWR---DVHYVAAHHHRSITDA--IDEFKFTIDL 87

>YNL148C (ALF1) [4448] chr14 complement(349907..350671)
           alpha-Tubulin foldin cofactor B, assists in formation of
           the alpha-beta-tubulin heterodimer [765 bp, 254 aa]
          Length = 254

 Score = 29.6 bits (65), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 45/96 (46%), Gaps = 16/96 (16%)

Query: 40  TEREEQENILKRNTD----YNRKRGGGTWAADENIDPLDGDESPRRAGSPVVLTDYFSQS 95
            E E+ E ++KR  D    Y+ K+GG     DE+ + L G+E        VV+TD  +QS
Sbjct: 36  VEPEDMEIVVKRQYDNKEIYSTKKGGAYSNEDEDANFLKGEEE-----LIVVVTDSNAQS 90

Query: 96  HAVYDNVGHQRSNSLPGTPT-SALKRPGGVRRSKSV 130
                 + +Q +    G P+   +     +RR +SV
Sbjct: 91  ------ISNQLATQAEGIPSMEVISEEDYLRRDQSV 120

>YLR014C (PPR1) [3432] chr12 complement(172267..174981)
           Transcription factor regulating pyrimidine pathway,
           contains a Zn[2]-Cys[6] fungal-type binuclear cluster
           domain in the N-terminal region [2715 bp, 904 aa]
          Length = 904

 Score = 29.6 bits (65), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 3/69 (4%)

Query: 205 YQLRPQLRTLRNVNFPILANKDPAVLTLNIFLNIAYNRKVFLQDLSLDSMLVMTGRVLVK 264
           Y L P+  TL +  F I+   D    T+++F N+  N+K+    +++ +M  MTG   + 
Sbjct: 637 YGLSPKFPTLNDTAFKIVL--DSTKGTIDVFYNLCVNKKIGYTWVAVHNMF-MTGMTYLY 693

Query: 265 NIHYDKSVI 273
              Y K+ I
Sbjct: 694 VNFYSKNNI 702

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.133    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,142,736
Number of extensions: 544699
Number of successful extensions: 1514
Number of sequences better than 10.0: 31
Number of HSP's gapped: 1518
Number of HSP's successfully gapped: 44
Length of query: 348
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 246
Effective length of database: 13,065,073
Effective search space: 3214007958
Effective search space used: 3214007958
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)