Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL082C56955827080.0
Kwal_23.576962753619090.0
Scas_704.4060856718360.0
YIL046W (MET30)64054618310.0
KLLA0F27511g62355518060.0
CAGL0L00781g67359917510.0
YFL009W (CDC4)7793682825e-26
AGL024W7565042809e-26
CAGL0L02629g7954632791e-25
Kwal_23.50357443592655e-24
YCR072C5153112626e-24
Scas_707.227304872568e-23
CAGL0H03729g3033022422e-22
KLLA0D07546g6474892494e-22
ACR137W4252822455e-22
AEL246C8152772479e-22
Scas_720.955152882422e-21
YJL112W (MDV1)7142762442e-21
AEL314W7152712424e-21
YDL145C (COP1)12012742418e-21
KLLA0C08547g5152912361e-20
KLLA0D04840g3032962282e-20
KLLA0E23529g8262852372e-20
Sklu_2173.25153152324e-20
YBR198C (TAF5)7982812344e-20
YGL137W (SEC27)8892762335e-20
CAGL0M05335g8062842336e-20
Scas_695.153273012256e-20
CAGL0J03476g5172922306e-20
AER263C5132912308e-20
Kwal_23.63245142912298e-20
AFR199C3341742249e-20
Sklu_2431.127492832301e-19
Kwal_26.87764331582261e-19
Scas_721.115*3181672212e-19
YNL006W (LST8)3032972202e-19
Scas_592.4*3181672193e-19
Scas_624.1112052662273e-19
CAGL0H08932g9022712256e-19
Scas_721.328222502231e-18
CAGL0I03718g12012682221e-18
CAGL0M02277g4272542162e-18
KLLA0F04884g12122742202e-18
ADR077C12042682202e-18
YPL151C (PRP46)4511512163e-18
Sklu_2420.24412572163e-18
Sklu_2442.23033012104e-18
Kwal_0.2123033002086e-18
Kwal_27.120537552772158e-18
YMR116C (ASC1)3191682088e-18
AFL118W8322702159e-18
KLLA0F11231g4342842111e-17
Scas_630.66213162131e-17
Kwal_56.2452612102742141e-17
Scas_711.116952962112e-17
CAGL0G04345g7112652094e-17
AAL009C3032971981e-16
Kwal_27.126677212832051e-16
KLLA0E12287g3261821982e-16
KLLA0F21406g7052421996e-16
CAGL0C03608g6433131979e-16
Kwal_26.75702181251852e-15
Kwal_23.64297502671952e-15
AGL234W6292591942e-15
KLLA0F10263g6822611952e-15
KLLA0B01958g8902421943e-15
YKR036C (CAF4)659941925e-15
Scas_603.55892471907e-15
Scas_629.126713191899e-15
CAGL0C02937g4671861843e-14
CAGL0E00561g8363201836e-14
YCR084C (TUP1)7131781827e-14
CAGL0D02090g2771481741e-13
Kwal_23.62409132011802e-13
YLR129W (DIP2)9431711774e-13
YCR057C (PWP2)9232011765e-13
AGL196C9352751721e-12
CAGL0L03201g5791941711e-12
CAGL0K09284g9112011722e-12
CAGL0C00737g8161811712e-12
Kwal_27.115858231451693e-12
AAR057W9222021694e-12
KLLA0C08976g9111701684e-12
Kwal_56.239209372741676e-12
Scas_713.509831711667e-12
CAGL0M04279g9402751668e-12
Scas_720.83d9152011659e-12
ADR176W4613121612e-11
KLLA0E24508g3271571582e-11
Kwal_23.53514742521575e-11
AER448W7141811586e-11
AEL269C4552311541e-10
KLLA0E07942g3901311531e-10
YLR222C (UTP13)8172621561e-10
YOR269W (PAC1)4941911541e-10
KLLA0D16390g9361331542e-10
Scas_679.288151101532e-10
CAGL0G09845g5002681513e-10
Scas_558.37251471523e-10
Sklu_2160.37601591524e-10
Sklu_2172.62631371465e-10
AER337W4453421486e-10
YKL021C (MAK11)4681361487e-10
Scas_631.174742331487e-10
CAGL0L10890g4573501488e-10
Kwal_26.89534583011479e-10
YKL213C (DOA1)7152311471e-09
KLLA0C07425g4443191452e-09
Scas_692.294563131442e-09
Scas_685.113841321432e-09
KLLA0F13244g8141571452e-09
AGR180W8061321452e-09
CAGL0F06853g3881311423e-09
Scas_721.73251641413e-09
Kwal_26.89754453111433e-09
Kwal_33.155917141541443e-09
YBR175W (SWD3)3151581395e-09
AGR207C3201631395e-09
Kwal_55.220674511431415e-09
CAGL0A02772g4411841407e-09
Kwal_56.241637291221417e-09
ADL184W4491431371e-08
Scas_717.689081111382e-08
YPR178W (PRP4)4652441372e-08
CAGL0M06193g3161401342e-08
AER255C4672671353e-08
Scas_720.457551261353e-08
Sklu_1880.34712701344e-08
YDR364C (CDC40)4551801344e-08
KLLA0E07073g4521401334e-08
KLLA0E21879g3331561324e-08
Sklu_2318.17111891345e-08
Sklu_1963.23141571316e-08
Scas_658.14421541326e-08
CAGL0K00275g7151581327e-08
CAGL0M08646g3371541307e-08
YOR272W (YTM1)4603161318e-08
Scas_692.254881871319e-08
KLLA0E21263g4291881309e-08
ACR091W3282381291e-07
CAGL0G03399g3691031282e-07
Sklu_2430.9966761282e-07
Kwal_34.158183492481262e-07
Kwal_14.8843951401263e-07
Scas_585.84601511263e-07
ACR166W3881311253e-07
Kwal_55.215593511561245e-07
Kwal_27.122393161571235e-07
Sklu_2291.4997581256e-07
YDR267C3301521227e-07
Scas_397.24101601237e-07
Kwal_26.76557431591231e-06
KLLA0F16038g862971221e-06
YNL317W (PFS2)4651511202e-06
Scas_700.27*4331601202e-06
AGL301C361961192e-06
Scas_465.41002581212e-06
YER066W1851471133e-06
Kwal_27.10785367961164e-06
ABL024W734821184e-06
Sklu_2416.5459721174e-06
Scas_721.128851871175e-06
CAGL0J06512g545801175e-06
CAGL0K03377g978781185e-06
KLLA0E18986g990531175e-06
Kwal_27.11126996551176e-06
KLLA0B14410g7061551166e-06
Scas_718.6*5461621166e-06
YMR102C834751166e-06
YGL004C (RPN14)417721157e-06
AFL056C976961168e-06
KLLA0C07513g4391841141e-05
YMR146C (TIF34)347651121e-05
KLLA0E04741g4591581131e-05
CAGL0L02761g4192511131e-05
Scas_660.7*6031431131e-05
CAGL0M04081g4552291112e-05
Kwal_55.214505031521122e-05
Sklu_2423.1944611122e-05
Scas_510.53621011102e-05
CAGL0L06952g347651102e-05
KLLA0E11297g512951103e-05
KLLA0A08866g423861103e-05
CAGL0A00605g6401481103e-05
Scas_680.11347651093e-05
CAGL0M09845g936571094e-05
ACR097W4671441085e-05
Kwal_27.103855361181085e-05
Sklu_2406.114261301085e-05
Sklu_1659.2613901086e-05
Sklu_2332.7367961076e-05
YLR429W (CRN1)6511681077e-05
KLLA0B12804g852761077e-05
YER107C (GLE2)3651031059e-05
AER114W6331411051e-04
CAGL0A00561g4121901041e-04
Scas_660.85102381051e-04
Sklu_2364.45551471051e-04
CAGL0J10340g3381631031e-04
Scas_719.30940571051e-04
KLLA0D06787g4361421042e-04
Scas_571.46011651042e-04
Kwal_26.86284221361032e-04
KLLA0F22000g7932031042e-04
Scas_615.113491651032e-04
Kwal_33.154757831541042e-04
CAGL0K12188g535851032e-04
AER081C1023611032e-04
KLLA0B02827g942571032e-04
Sklu_1645.25871521033e-04
ADL322C5011351023e-04
Scas_719.526281691023e-04
Kwal_47.17555417971013e-04
YOR212W (STE4)4232571013e-04
Scas_702.168161111024e-04
Scas_512.3534601014e-04
Sklu_675.13082481004e-04
Kwal_33.1351539890995e-04
Sklu_1926.550998996e-04
Kwal_23.4118939611006e-04
YBR103W (SIF2)53590997e-04
Scas_605.18424259988e-04
Kwal_47.17567590142988e-04
YGL116W (CDC20)610159988e-04
CAGL0F07337g621151988e-04
YGR200C (ELP2)78893970.001
AFL009C41384960.001
CAGL0C01441g1005157970.001
Kwal_27.12586509156960.001
ACR017W423152960.001
Sklu_1870.256976960.002
YPL183C101358960.002
KLLA0D02530g707161950.002
AFL014C557188950.002
YMR092C (AIP1)615141940.003
YLR409C (UTP21)939153940.003
CAGL0K00957g793150930.004
ADR264C34676920.004
CAGL0J04818g654165930.004
Scas_659.947592920.004
Sklu_2435.13575223920.005
CAGL0K05599g71074920.005
AFL007C551143910.005
YGL003C (CDH1)566143910.007
YKL018W (SWD2)329115900.007
KLLA0F15598g478156900.007
Kwal_14.1710574152900.007
CAGL0D05588g47785900.007
AGR168W825110900.008
KLLA0E20779g371102890.009
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL082C
         (558 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH] (538948..5...  1047   0.0  
Kwal_23.5769                                                          739   0.0  
Scas_704.40                                                           711   0.0  
YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that ...   709   0.0  
KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces...   700   0.0  
CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces cer...   679   0.0  
YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and co...   113   5e-26
AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -...   112   9e-26
CAGL0L02629g complement(307323..309710) similar to sp|P07834 Sac...   112   1e-25
Kwal_23.5035                                                          106   5e-24
YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein ...   105   6e-24
Scas_707.22                                                           103   8e-23
CAGL0H03729g 342948..343859 highly similar to sp|P41318 Saccharo...    98   2e-22
KLLA0D07546g complement(647984..649927) some similarities with s...   100   4e-22
ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH] complement...    99   5e-22
AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH] (172849..1...   100   9e-22
Scas_720.95                                                            98   2e-21
YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in...    99   2e-21
AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C (...    98   4e-21
YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer (C...    97   8e-21
KLLA0C08547g 749737..751284 highly similar to sp|P25382 Saccharo...    96   1e-20
KLLA0D04840g 413362..414273 highly similar to sp|P41318 Saccharo...    92   2e-20
KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces...    96   2e-20
Sklu_2173.2 YCR072C, Contig c2173 2732-4279                            94   4e-20
YBR198C (TAF5) [381] chr2 complement(616084..618480) Component o...    95   4e-20
YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741) Coat...    94   5e-20
CAGL0M05335g complement(569132..571552) similar to sp|P38129 Sac...    94   6e-20
Scas_695.15                                                            91   6e-20
CAGL0J03476g 331933..333486 highly similar to sp|P25382 Saccharo...    93   6e-20
AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)...    93   8e-20
Kwal_23.6324                                                           93   8e-20
AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH] (799876..80...    91   9e-20
Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement      93   1e-19
Kwal_26.8776                                                           92   1e-19
Scas_721.115*                                                          90   2e-19
YNL006W (LST8) [4579] chr14 (620066..620977) Protein required fo...    89   2e-19
Scas_592.4*                                                            89   3e-19
Scas_624.11                                                            92   3e-19
CAGL0H08932g join(871668..871685,872089..874779) highly similar ...    91   6e-19
Scas_721.32                                                            91   1e-18
CAGL0I03718g complement(317565..321170) highly similar to sp|P53...    90   1e-18
CAGL0M02277g complement(271836..273119) highly similar to sp|Q12...    88   2e-18
KLLA0F04884g complement(478044..481682) similar to sp|P53622 Sac...    89   2e-18
ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH] (843171..84...    89   2e-18
YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative...    88   3e-18
Sklu_2420.2 YPL151C, Contig c2420 3924-5249                            88   3e-18
Sklu_2442.2 YNL006W, Contig c2442 3831-4742                            86   4e-18
Kwal_0.212                                                             85   6e-18
Kwal_27.12053                                                          87   8e-18
YMR116C (ASC1) [4073] chr13 complement(499455..499877,500151..50...    85   8e-18
AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH] complement...    87   9e-18
KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417 S...    86   1e-17
Scas_630.6                                                             87   1e-17
Kwal_56.24526                                                          87   1e-17
Scas_711.11                                                            86   2e-17
CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces c...    85   4e-17
AAL009C [178] [Homologous to ScYNL006W (LST8) - SH] (325785..326...    81   1e-16
Kwal_27.12667                                                          84   1e-16
KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to ...    81   2e-16
KLLA0F21406g complement(1996260..1998377) similar to sp|P47025 S...    81   6e-16
CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces c...    80   9e-16
Kwal_26.7570                                                           76   2e-15
Kwal_23.6429                                                           80   2e-15
AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH] complement(...    79   2e-15
KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA Kluy...    80   2e-15
KLLA0B01958g join(170646..170663,170896..173550) similar to sp|P...    79   3e-15
YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein t...    79   5e-15
Scas_603.5                                                             78   7e-15
Scas_629.12                                                            77   9e-15
CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces c...    75   3e-14
CAGL0E00561g 49750..52260 some similarities with sp|P16649 Sacch...    75   6e-14
YCR084C (TUP1) [608] chr3 complement(260307..262448) General rep...    75   7e-14
CAGL0D02090g join(214357..214893,215564..215860) highly similar ...    72   1e-13
Kwal_23.6240                                                           74   2e-13
YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 sno...    73   4e-13
YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential p...    72   5e-13
AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH] (328838..33...    71   1e-12
CAGL0L03201g complement(366795..368534) some similarities with s...    70   1e-12
CAGL0K09284g 914937..917672 highly similar to sp|P25635 Saccharo...    71   2e-12
CAGL0C00737g complement(75028..77478) similar to tr|Q05946 Sacch...    70   2e-12
Kwal_27.11585                                                          70   3e-12
AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH] complement(4...    70   4e-12
KLLA0C08976g 784536..787271 highly similar to sgd|S0000653 Sacch...    69   4e-12
Kwal_56.23920                                                          69   6e-12
Scas_713.50                                                            69   7e-12
CAGL0M04279g 469040..471862 highly similar to sp|Q12220 Saccharo...    69   8e-12
Scas_720.83d                                                           68   9e-12
ADR176W [1917] [Homologous to ScYOR269W (PAC1) - SH] complement(...    67   2e-11
KLLA0E24508g complement(2175775..2176758) similar to sp|P38123 S...    65   2e-11
Kwal_23.5351                                                           65   5e-11
AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH] complement(...    65   6e-11
AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH] (134760..13...    64   1e-10
KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces c...    64   1e-10
YLR222C (UTP13) [3622] chr12 complement(579320..581773) Componen...    65   1e-10
YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in...    64   1e-10
KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces...    64   2e-10
Scas_679.28                                                            64   2e-10
CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces c...    63   3e-10
Scas_558.3                                                             63   3e-10
Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement         63   4e-10
Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement       61   5e-10
AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH] complement(...    62   6e-10
YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein ...    62   7e-10
Scas_631.17                                                            62   7e-10
CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024 Saccha...    62   8e-10
Kwal_26.8953                                                           61   9e-10
YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein req...    61   1e-09
KLLA0C07425g complement(647673..649007) highly similar to sp|Q12...    60   2e-09
Scas_692.29                                                            60   2e-09
Scas_685.11                                                            60   2e-09
KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomy...    60   2e-09
AGR180W [4491] [Homologous to ScYLR222C - SH] complement(1090647...    60   2e-09
CAGL0F06853g 671942..673108 highly similar to sp|P20484 Saccharo...    59   3e-09
Scas_721.7                                                             59   3e-09
Kwal_26.8975                                                           60   3e-09
Kwal_33.15591                                                          60   3e-09
YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and...    58   5e-09
AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH] (1146710..1...    58   5e-09
Kwal_55.22067                                                          59   5e-09
CAGL0A02772g complement(289274..290599) similar to sp|P40968 Sac...    59   7e-09
Kwal_56.24163                                                          59   7e-09
ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH] complement(...    57   1e-08
Scas_717.68                                                            58   2e-08
YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associa...    57   2e-08
CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces c...    56   2e-08
AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH] (1107932.....    57   3e-08
Scas_720.45                                                            57   3e-08
Sklu_1880.3 YDR364C, Contig c1880 4293-5708                            56   4e-08
YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein...    56   4e-08
KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces c...    56   4e-08
KLLA0E21879g complement(1944865..1945866) similar to sgd|S000267...    55   4e-08
Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement          56   5e-08
Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement         55   6e-08
Scas_658.1                                                             55   6e-08
CAGL0K00275g complement(25300..27447) similar to sp|P36037 Sacch...    55   7e-08
CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces c...    55   7e-08
YOR272W (YTM1) [5058] chr15 (832810..834192) Microtubule-associa...    55   8e-08
Scas_692.25                                                            55   9e-08
KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces...    55   9e-08
ACR091W [1138] [Homologous to ScYDR267C - SH] complement(520609....    54   1e-07
CAGL0G03399g complement(325879..326988) highly similar to sp|P40...    54   2e-07
Sklu_2430.9 YMR102C, Contig c2430 15497-18397                          54   2e-07
Kwal_34.15818                                                          53   2e-07
Kwal_14.884                                                            53   3e-07
Scas_585.8                                                             53   3e-07
ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH] complement...    53   3e-07
Kwal_55.21559                                                          52   5e-07
Kwal_27.12239                                                          52   5e-07
Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement         53   6e-07
YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Prote...    52   7e-07
Scas_397.2                                                             52   7e-07
Kwal_26.7655                                                           52   1e-06
KLLA0F16038g complement(1487475..1490063) weakly similar to ca|C...    52   1e-06
YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation facto...    51   2e-06
Scas_700.27*                                                           51   2e-06
AGL301C [4011] [Homologous to ScYER107C (GLE2) - SH] (137221..13...    50   2e-06
Scas_465.4                                                             51   2e-06
YER066W (YER066W) [1497] chr5 (290240..290797) Protein containin...    48   3e-06
Kwal_27.10785                                                          49   4e-06
ABL024W [568] [Homologous to ScYMR102C - SH; ScYKL121W - SH] com...    50   4e-06
Sklu_2416.5 YNL317W, Contig c2416 8692-10071                           50   4e-06
Scas_721.128                                                           50   5e-06
CAGL0J06512g complement(620516..622153) similar to sp|Q04199 Sac...    50   5e-06
CAGL0K03377g complement(306529..309465) similar to sp|Q03177 Sac...    50   5e-06
KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomy...    50   5e-06
Kwal_27.11126                                                          50   6e-06
KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces...    49   6e-06
Scas_718.6*                                                            49   6e-06
YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protei...    49   6e-06
YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein c...    49   7e-06
AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146) [...    49   8e-06
KLLA0C07513g complement(656060..657379) similar to sp|P39946 Sac...    49   1e-05
YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translat...    48   1e-05
KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces c...    48   1e-05
CAGL0L02761g complement(320826..322085) similar to sp|P18851 Sac...    48   1e-05
Scas_660.7*                                                            48   1e-05
CAGL0M04081g complement(450572..451939) highly similar to sp|P42...    47   2e-05
Kwal_55.21450                                                          48   2e-05
Sklu_2423.1 YLR409C, Contig c2423 869-3703                             48   2e-05
Scas_510.5                                                             47   2e-05
CAGL0L06952g complement(780793..781836) highly similar to sp|P40...    47   2e-05
KLLA0E11297g complement(994770..996308) similar to sp|P38262 Sac...    47   3e-05
KLLA0A08866g 776960..778231 weakly similar to sp|P53196 Saccharo...    47   3e-05
CAGL0A00605g complement(67281..69203) similar to sp|P53197 Sacch...    47   3e-05
Scas_680.11                                                            47   3e-05
CAGL0M09845g 975007..977817 highly similar to sp|Q06078 Saccharo...    47   4e-05
ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH] complement(...    46   5e-05
Kwal_27.10385                                                          46   5e-05
Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement      46   5e-05
Sklu_1659.2 YMR092C, Contig c1659 410-2251                             46   6e-05
Sklu_2332.7 YER107C, Contig c2332 14211-15314 reverse complement       46   6e-05
YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-bind...    46   7e-05
KLLA0B12804g 1117475..1120033 weakly similar to sp|Q03177 Saccha...    46   7e-05
YER107C (GLE2) [1539] chr5 complement(373444..374541) Nuclear po...    45   9e-05
AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH] complement(...    45   1e-04
CAGL0A00561g complement(63710..64948) similar to sp|P53196 Sacch...    45   1e-04
Scas_660.8                                                             45   1e-04
Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement         45   1e-04
CAGL0J10340g complement(1008637..1009653) highly similar to sp|P...    44   1e-04
Scas_719.30                                                            45   1e-04
KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1 ...    45   2e-04
Scas_571.4                                                             45   2e-04
Kwal_26.8628                                                           44   2e-04
KLLA0F22000g complement(2044973..2047354) similar to sp|P42935 S...    45   2e-04
Scas_615.11                                                            44   2e-04
Kwal_33.15475                                                          45   2e-04
CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces...    44   2e-04
AER081C [2586] [Homologous to ScYLR409C - SH] (785301..788372) [...    44   2e-04
KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces c...    44   2e-04
Sklu_1645.2 YGL116W, Contig c1645 887-2650 reverse complement          44   3e-04
ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH] (128830..13...    44   3e-04
Scas_719.52                                                            44   3e-04
Kwal_47.17555                                                          44   3e-04
YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the...    44   3e-04
Scas_702.16                                                            44   4e-04
Scas_512.3                                                             44   4e-04
Sklu_675.1 YMR146C, Contig c675 761-1687                               43   4e-04
Kwal_33.13515                                                          43   5e-04
Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement         43   6e-04
Kwal_23.4118                                                           43   6e-04
YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in t...    43   7e-04
Scas_605.18                                                            42   8e-04
Kwal_47.17567                                                          42   8e-04
YGL116W (CDC20) [1869] chr7 (289810..291642) Activator of anapha...    42   8e-04
CAGL0F07337g complement(714870..716735) similar to sp|P26309 Sac...    42   8e-04
YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa sub...    42   0.001
AFL009C [3184] [Homologous to ScYGL004C - SH] (420007..421248) [...    42   0.001
CAGL0C01441g complement(156930..159947) similar to tr|Q08924 Sac...    42   0.001
Kwal_27.12586                                                          42   0.001
ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH] complement(...    42   0.001
Sklu_1870.2 YLR055C, Contig c1870 1126-2835 reverse complement         42   0.002
YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protei...    42   0.002
KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777....    41   0.002
AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH] (409496..4...    41   0.002
YMR092C (AIP1) [4050] chr13 complement(451631..453478) Actin int...    41   0.003
YLR409C (UTP21) [3786] chr12 complement(934411..937230) Member o...    41   0.003
CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces cer...    40   0.004
ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH] (1158218.....    40   0.004
CAGL0J04818g 455846..457810 highly similar to sp|Q06440 Saccharo...    40   0.004
Scas_659.9                                                             40   0.004
Sklu_2435.13 YPR137W, Contig c2435 18346-20073                         40   0.005
CAGL0K05599g 544932..547064 similar to tr|Q08496 Saccharomyces c...    40   0.005
AFL007C [3186] [Homologous to ScYGL003C (CDH1) - SH] (424004..42...    40   0.005
YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of...    40   0.007
YKL018W (SWD2) [3238] chr11 (403745..404734) Component of SET1 a...    39   0.007
KLLA0F15598g 1439610..1441046 highly similar to sp|P33750 Saccha...    39   0.007
Kwal_14.1710                                                           39   0.007
CAGL0D05588g 533235..534668 highly similar to sp|P33750 Saccharo...    39   0.007
AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH] complement(...    39   0.008
KLLA0E20779g complement(1841092..1842207) similar to sp|P40066 S...    39   0.009
CAGL0E02805g complement(265137..267659) similar to sp|P32479 Sac...    39   0.009
Sklu_2233.2 YMR049C, Contig c2233 5630-8059 reverse complement         39   0.011
YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component o...    39   0.011
YCL039W (GID7) [504] chr3 (52645..54882) Protein of unknown func...    39   0.012
AFR634W [3826] [Homologous to ScYNL253W - SH] complement(1593772...    39   0.012
Kwal_14.1235                                                           39   0.014
KLLA0F06754g complement(650475..651509) similar to sp|P53011 Sac...    38   0.014
Scas_652.16                                                            38   0.017
ABL043W [549] [Homologous to ScYMR092C (AIP1) - SH] complement(3...    38   0.018
YPR137W (RRP9) [5555] chr16 (802353..804074) Protein component o...    38   0.019
KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces c...    38   0.020
AER280C [2782] [Homologous to ScYML102W (CAC2) - SH] (1148956..1...    38   0.021
Sklu_2384.3 YKL018W, Contig c2384 6547-7533                            38   0.021
YHR186C (KOG1) [2471] chr8 complement(475997..480670) Component ...    38   0.023
YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription...    38   0.024
Scas_542.5                                                             37   0.027
AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516...    37   0.027
CAGL0B03575g complement(357525..358784) similar to sp|P39984 Sac...    37   0.027
KLLA0F08811g complement(819834..821744) some similarities with s...    37   0.028
Kwal_56.24399                                                          37   0.030
CAGL0D04884g 475678..477369 highly similar to tr|Q06506 Saccharo...    37   0.031
CAGL0J01287g 120215..122047 similar to sp|P46680 Saccharomyces c...    37   0.034
CAGL0L09757g complement(1046898..1047878) highly similar to sp|P...    37   0.035
Sklu_1710.1 YDR267C, Contig c1710 17-739                               36   0.039
ADR090W [1831] [Homologous to ScYDL195W (SEC31) - SH] complement...    37   0.041
Scas_705.2                                                             37   0.044
AGR067W [4377] [Homologous to ScYDR128W - SH] complement(842182....    37   0.044
Kwal_14.906                                                            37   0.049
CAGL0L04950g complement(562491..564908) highly similar to sp|Q04...    37   0.051
AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH] (526057..527...    37   0.058
Scas_699.5                                                             37   0.059
Kwal_33.15136                                                          36   0.059
Kwal_56.23685                                                          37   0.064
Scas_721.29                                                            36   0.066
YMR049C (ERB1) [4011] chr13 complement(368093..370516) Protein w...    37   0.067
Scas_469.3                                                             36   0.067
YGL100W (SEH1) [1883] chr7 (313235..314284) Protein found in com...    36   0.070
Scas_649.10                                                            36   0.070
Kwal_33.14248                                                          36   0.072
ABR101C [693] [Homologous to ScYMR049C (ERB1) - SH] (567357..569...    36   0.073
KLLA0E18139g 1608371..1609351 highly similar to sp|P36104 Saccha...    36   0.076
KLLA0B11077g complement(970761..972464) similar to sgd|S0006341 ...    36   0.079
Kwal_33.14971                                                          36   0.079
ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH] complement(1...    36   0.082
Kwal_47.17465                                                          36   0.090
Kwal_26.7736                                                           36   0.092
KLLA0A08822g 772565..774313 similar to sp|P53197 Saccharomyces c...    36   0.098
AFL038C [3155] [Homologous to ScYGL100W (SEH1) - SH] (367581..36...    35   0.10 
Sklu_2371.4 YDR030C, Contig c2371 8070-9506 reverse complement         35   0.10 
Scas_670.21                                                            36   0.10 
KLLA0F26653g 2461876..2464251 similar to sp|Q04660 Saccharomyces...    36   0.11 
ADR230W [1971] [Homologous to ScYOR080W (DIA2) - SH] complement(...    35   0.12 
YDL195W (SEC31) [678] chr4 (107209..111030) Component (p150) of ...    35   0.13 
Kwal_26.7738                                                           35   0.14 
Kwal_55.21144                                                          35   0.15 
Scas_656.15                                                            35   0.16 
CAGL0J07854g complement(765463..766761) similar to sp|P53851 Sac...    35   0.18 
CAGL0H04103g 388457..390460 similar to sp|Q04511 Saccharomyces c...    35   0.18 
Scas_642.1                                                             35   0.26 
KLLA0F13772g 1276532..1278094 highly similar to sp|Q04305 Saccha...    34   0.27 
Scas_693.22                                                            35   0.28 
Sklu_2114.2 YDR128W, Contig c2114 598-4020 reverse complement          34   0.31 
ACL034W [1015] [Homologous to ScYER082C (KRE31) - SH] complement...    34   0.32 
ACL099W [950] [Homologous to ScYKL018W (SWD2) - SH] complement(1...    34   0.32 
KLLA0F07403g 697593..698636 similar to sp|P40217 Saccharomyces c...    34   0.34 
Scas_442.2*                                                            34   0.35 
ADL186C [1555] [Homologous to ScYOL138C - SH] (369322..373407) [...    34   0.42 
Scas_701.22                                                            33   0.44 
YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing...    34   0.46 
Kwal_56.24596                                                          33   0.47 
KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces c...    33   0.48 
KLLA0F21076g 1966373..1969036 highly similar to sp|Q9P4C0 Kluyve...    33   0.49 
AFR153W [3345] [Homologous to ScYLR055C (SPT8) - SH] complement(...    33   0.53 
CAGL0M13409g complement(1316268..1320851) similar to sp|P38873 S...    33   0.54 
YER082C (UTP7) [1514] chr5 complement(324268..325932) Component ...    33   0.55 
Sklu_2364.2 YGL004C, Contig c2364 1650-2885 reverse complement         33   0.57 
Kwal_47.17310                                                          33   0.59 
CAGL0J08778g 866175..867071 highly similar to sp|Q04491 Saccharo...    33   0.59 
Sklu_1912.2 YNL251C, Contig c1912 2610-3129                            32   0.67 
Scas_684.14                                                            33   0.70 
AFR438W [3630] [Homologous to ScYML088W (UFO1) - SH] complement(...    33   0.72 
KLLA0C09262g 805512..807188 similar to sp|P40055 Saccharomyces c...    33   0.77 
Kwal_33.13148                                                          33   0.78 
Scas_706.24                                                            33   0.83 
YLR208W (SEC13) [3609] chr12 (559553..560446) Component of the C...    32   0.90 
CAGL0H00781g complement(77292..78833) similar to tr|Q12523 Sacch...    32   1.0  
KLLA0F10791g complement(991642..993279) similar to sp|P26309 Sac...    32   1.1  
Sklu_2359.2 YER124C, Contig c2359 3062-4807                            32   1.1  
KLLA0E18964g complement(1676876..1680310) similar to sp|P53010 S...    32   1.2  
Kwal_56.22345                                                          32   1.2  
CAGL0J03344g complement(322226..323857) highly similar to sp|P40...    32   1.3  
Scas_674.20                                                            32   1.3  
Scas_595.3*                                                            32   1.3  
Scas_715.22                                                            32   1.4  
Kwal_56.23207                                                          32   1.6  
YML102W (CAC2) [3869] chr13 (68294..69700) Chromatin assembly co...    32   1.6  
CAGL0B00748g 65727..68165 similar to sp|P25569 Saccharomyces cer...    32   1.7  
KLLA0C16643g complement(1457590..1458498) highly similar to sp|Q...    31   1.8  
Scas_646.14                                                            32   2.0  
KLLA0E19613g complement(1733708..1735426) similar to sp|P21304 S...    32   2.0  
CAGL0A04037g complement(399371..401122) highly similar to sp|P21...    32   2.1  
CAGL0M05291g complement(566250..567509) similar to sp|P13712 Sac...    31   2.1  
ACR116W [1163] [Homologous to ScYPL139C (UME1) - SH] complement(...    31   2.2  
YKL121W (YKL121W) [3144] chr11 (213788..216346) Protein containi...    31   2.4  
Kwal_56.24661                                                          31   2.6  
YDR324C (UTP4) [1154] chr4 complement(1114426..1116756) Protein ...    31   2.7  
YDL156W (YDL156W) [714] chr4 (174919..176487) Protein containing...    31   2.8  
KLLA0C16940g complement(1479541..1481469) weakly similar to sp|Q...    31   2.9  
ACR085C [1132] [Homologous to NOHBY] (508364..511228) [2865 bp, ...    31   3.1  
Sklu_2113.2 YCL039W, Contig c2113 2538-4865                            31   3.3  
Sklu_2382.2 YDL195W, Contig c2382 2146-5931 reverse complement         31   3.4  
KLLA0F13750g complement(1274110..1275972) similar to sp|P46680 S...    31   3.4  
ABL044C [548] [Homologous to ScYMR093W - SH] (312378..313934) [1...    31   3.4  
YLR055C (SPT8) [3472] chr12 complement(251273..253081) Component...    31   3.8  
YBR195C (MSI1) [378] chr2 complement(610571..611839) Chromatin a...    30   3.9  
AFR715C [3908] [Homologous to ScYCL039W - SH] (1752847..1754997)...    31   4.0  
YLR196W (PWP1) [3599] chr12 (543970..545700) Protein containing ...    30   4.1  
AER145W [2649] [Homologous to NOHBY] complement(907744..911082) ...    30   4.6  
CAGL0I03454g 292823..293734 similar to sp|Q04491 Saccharomyces c...    30   5.5  
KLLA0D12760g complement(1090428..1091909) weakly similar to sgd|...    30   5.8  
Kwal_56.24332                                                          30   6.1  
KLLA0A09471g complement(827264..831784) similar to sp|P38873 Sac...    30   6.8  
KLLA0D00814g complement(76687..77913) similar to sp|P39984 Sacch...    30   7.9  
Sklu_1985.3 YLR196W, Contig c1985 4838-6544 reverse complement         30   7.9  
KLLA0B04774g complement(433472..436759) some similarities with c...    30   8.1  
CAGL0B02013g 184252..187614 highly similar to tr|Q03897 Saccharo...    30   8.5  
AGL190W [4122] [Homologous to ScYDR142C (PEX7) - SH] complement(...    29   9.0  
CAGL0I07821g complement(751484..754873) similar to tr|Q99247 Sac...    29   9.8  

>ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH]
           (538948..540657) [1710 bp, 569 aa]
          Length = 569

 Score = 1047 bits (2708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/558 (91%), Positives = 510/558 (91%)

Query: 1   MSNSTAGHLQQDGGHMSQLARGGIRWMPEMQPATKQLRAPQYNFVRYCYRHNPDIQAAPT 60
           MSNSTAGHLQQDGGHMSQLARGGIRWMPEMQPATKQLRAPQYNFVRYCYRHNPDIQAAPT
Sbjct: 1   MSNSTAGHLQQDGGHMSQLARGGIRWMPEMQPATKQLRAPQYNFVRYCYRHNPDIQAAPT 60

Query: 61  XXXXXXXXXXXXXXXXXXXGELSSEGERQVVQEAVRLFDSSNDKLRKLMLEGMLLKSCFP 120
                              GELSSEGERQVVQEAVRLFDSSNDKLRKLMLEGMLLKSCFP
Sbjct: 61  QVRCVRQEQQRREEWQARVGELSSEGERQVVQEAVRLFDSSNDKLRKLMLEGMLLKSCFP 120

Query: 121 QLSFISTQLQKLIKIDFISALPEEVALKILGYLDCQSLCSAAAVCRRWQELADDDTVWYH 180
           QLSFISTQLQKLIKIDFISALPEEVALKILGYLDCQSLCSAAAVCRRWQELADDDTVWYH
Sbjct: 121 QLSFISTQLQKLIKIDFISALPEEVALKILGYLDCQSLCSAAAVCRRWQELADDDTVWYH 180

Query: 181 MCEQHIDRKCPKCGWGLPLLHMKRARYIKSDKASASKGEGEDAPQSRMRPWKVVYRERFK 240
           MCEQHIDRKCPKCGWGLPLLHMKRARYIKSDKASASKGEGEDAPQSRMRPWKVVYRERFK
Sbjct: 181 MCEQHIDRKCPKCGWGLPLLHMKRARYIKSDKASASKGEGEDAPQSRMRPWKVVYRERFK 240

Query: 241 VESNWRKGIYRIQEFKGHMDGVXXXXXXXXXXXTGSYDSTVAIWDLATGKLIRRLSGHTD 300
           VESNWRKGIYRIQEFKGHMDGV           TGSYDSTVAIWDLATGKLIRRLSGHTD
Sbjct: 241 VESNWRKGIYRIQEFKGHMDGVLSLQLTNKLLLTGSYDSTVAIWDLATGKLIRRLSGHTD 300

Query: 301 GVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKLIVSGSADKT 360
           GVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKLIVSGSADKT
Sbjct: 301 GVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKLIVSGSADKT 360

Query: 361 VKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHV 420
           VKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHV
Sbjct: 361 VKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHV 420

Query: 421 GQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNT 480
           GQVQKVIPLTLGSDLIE                  SVQAANFDHSLPYPTHLLSCSLDNT
Sbjct: 421 GQVQKVIPLTLGSDLIEDPKDAVVPPDATAPAHDPSVQAANFDHSLPYPTHLLSCSLDNT 480

Query: 481 IKLWNVKTGACIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHA 540
           IKLWNVKTGACIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHA
Sbjct: 481 IKLWNVKTGACIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHA 540

Query: 541 PVACVGIGDSEFVSGDEL 558
           PVACVGIGDSEFVSGDEL
Sbjct: 541 PVACVGIGDSEFVSGDEL 558

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 53/93 (56%)

Query: 276 SYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTY 335
           S D+T+ +W++ TG  IR   GH +GV  +  D+ ++++GS D++ +VW+  TG C+ T+
Sbjct: 476 SLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTF 535

Query: 336 RGHQDSVLSVDSFRKLIVSGSADKTVKVWHVES 368
            G    V  V       VSG     VK+++ ++
Sbjct: 536 VGIHAPVACVGIGDSEFVSGDELGCVKLYNFDT 568

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 35/72 (48%)

Query: 257 GHMDGVXXXXXXXXXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGS 316
           GH++GV           +GS+D +  +WDL TGK +    G    V  +   D + ++G 
Sbjct: 497 GHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGIGDSEFVSGD 556

Query: 317 LDKTIRVWNYVT 328
               ++++N+ T
Sbjct: 557 ELGCVKLYNFDT 568

>Kwal_23.5769
          Length = 627

 Score =  739 bits (1909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/536 (65%), Positives = 406/536 (75%), Gaps = 11/536 (2%)

Query: 33  ATKQLRA-PQYNFVRYCYRHNPDIQAAPTXXXXXXXXXXXXXXXXXXXGELSSEGERQVV 91
             K++R  PQYNF+R+CYRHNPD Q + T                    +L  E +RQV 
Sbjct: 84  TNKRVRGLPQYNFLRFCYRHNPDFQHSQTHTACYMQDQQRHQKLNKKIEQLEPEEQRQV- 142

Query: 92  QEAVRLFDSSNDKLRKLMLEGMLLKSCFPQLSFISTQLQKLIKIDFISALPEEVALKILG 151
           Q  +  F   ND++RKL+LEG+L   CFPQLSF+++++QK+IKIDFIS LPEEVALKILG
Sbjct: 143 QNVLTTFAGCNDRIRKLLLEGLLANCCFPQLSFVASEVQKMIKIDFISTLPEEVALKILG 202

Query: 152 YLDCQSLCSAAAVCRRWQELADDDTVWYHMCEQHIDRKCPKCGWGLPLLHMKRARYIKSD 211
           YLDC+SLC+AA VCRRWQ++ADDD VWYHMC+QHIDRKCP CGWGLPLLHMKRAR+I+  
Sbjct: 203 YLDCESLCNAARVCRRWQQMADDDKVWYHMCQQHIDRKCPNCGWGLPLLHMKRARFIEPP 262

Query: 212 KASASKGEGEDAP-------QSRMRPWKVVYRERFKVESNWRKGIYRIQEFKGHMDGVXX 264
             S    +G   P         + RPWKV+YRERFKVESNWRKG   IQEFKGHMDGV  
Sbjct: 263 AESKPGQKGAGNPPVASETTTRKTRPWKVIYRERFKVESNWRKGTAHIQEFKGHMDGVLS 322

Query: 265 XXXXXXXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVW 324
                    TGSYDSTVAIWDLATGKL+RRL+GH DGVKA+ FD QKLITGSLD+ IRVW
Sbjct: 323 LQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKLITGSLDRMIRVW 382

Query: 325 NYVTGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCV 384
           NYVTGACV+ Y GH DSVLSVDS++K+IVSGSADKTVKVWHVESRTCYTLRGHT WV  V
Sbjct: 383 NYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTV 442

Query: 385 KLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTL--GSDLIEXXXXX 442
           KLHPKSFTCFSGSDD TIRMWDIR+NTCV+VF GHVGQVQKV+PLT+    +L+      
Sbjct: 443 KLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSD 502

Query: 443 XXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGV 502
                          Q +  D SLPYP+HLLSCSLDNTIKLW V+TG C+RT FGHVEG+
Sbjct: 503 PPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHFGHVEGI 562

Query: 503 WDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGIGDSEFVSGDEL 558
           WDIAADNFRIVSG+HD++ KVWDLQ+GKC+HTF    AP+ CVGIGDSEFVSGDEL
Sbjct: 563 WDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIGDSEFVSGDEL 618

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 52/88 (59%)

Query: 276 SYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTY 335
           S D+T+ +W++ TGK +R   GH +G+  +  D+ ++++G+ DKT++VW+  +G C+ T+
Sbjct: 536 SLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTF 595

Query: 336 RGHQDSVLSVDSFRKLIVSGSADKTVKV 363
             HQ  +  V       VSG     VKV
Sbjct: 596 DSHQAPITCVGIGDSEFVSGDELGCVKV 623

>Scas_704.40
          Length = 608

 Score =  711 bits (1836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/567 (61%), Positives = 405/567 (71%), Gaps = 49/567 (8%)

Query: 40  PQYNFVRYCYRHNPDIQAAPTXXXXXXXXXXXXXXXXXXXGELSSEGERQVVQEAVRLFD 99
           PQ+NF ++CYRHNP+I ++PT                    +L ++ E+  +   +  F+
Sbjct: 34  PQFNFTKFCYRHNPEILSSPTHTACYNQDLKRFKDLNDNITKLPAQ-EQAEIHHIISKFN 92

Query: 100 SSNDKLRKLMLEGMLLKSCFPQLSFISTQLQKLIKIDFISALPEEVALKILGYLDCQSLC 159
            SNDKLRKL+L+G+L  SCFPQLS+IS+Q+  +I+IDFIS LP+E++LKIL YLDCQSLC
Sbjct: 93  KSNDKLRKLILDGILASSCFPQLSYISSQVSNMIRIDFISILPQELSLKILSYLDCQSLC 152

Query: 160 SAAAVCRRWQELADDDTVWYHMCEQHIDRKCPKCGWGLPLLHMKRARYIKSDKASASKGE 219
           +A  VCR+WQ LADDD VWYHMCEQHIDRKCP CGWGLPLLHMKRAR++K+    A+   
Sbjct: 153 NATKVCRKWQILADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARFVKNASICATNNT 212

Query: 220 -GEDAPQSRMRPWKVVYRERFKVESNWRKGIYRIQEFKGHMDGVXXXXXXXXXXXTGSYD 278
             +D+    MRPWKV+YRERFKVESNWRKG  ++QEFKGHMDGV           TGSYD
Sbjct: 213 CTKDSNGKLMRPWKVIYRERFKVESNWRKGNCQVQEFKGHMDGVLTLQFNYRLLFTGSYD 272

Query: 279 STVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGH 338
           STVAIWDL + KLIRRLSGHTDGVK L FD+ KL+TGSLDKTIRVWNY TG C+STYRGH
Sbjct: 273 STVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGH 332

Query: 339 QDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSD 398
            DSV+SVD+F+K+IVSGSADKTVK+WHVESRTCYTLRGHT WVNCVKLHPKSFTCFSGSD
Sbjct: 333 TDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSD 392

Query: 399 DMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTL--GSDLI------------EXXXXXXX 444
           D TIRMWDIRTN+C++VF GHVGQVQKVIPLT+    +L+            E       
Sbjct: 393 DTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPASTTTP 452

Query: 445 XXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWD 504
                        +    D S+PYPTHLLSCSLDNTIKLW+V+TG CIRTQFGHVEGVWD
Sbjct: 453 TAAIAAEAATNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWD 512

Query: 505 IAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIH------------------------- 539
           IAADNFRI+SGSHD S K+WDLQ+GKCMHTF G                           
Sbjct: 513 IAADNFRIISGSHDGSIKIWDLQSGKCMHTFHGKRLQPQDEEGSTHLASTSNATGTSTST 572

Query: 540 --------APVACVGIGDSEFVSGDEL 558
                   +P+ACV IGDSEF SGDEL
Sbjct: 573 ANPVQNKVSPIACVSIGDSEFFSGDEL 599

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 66/130 (50%), Gaps = 8/130 (6%)

Query: 276 SYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTY 335
           S D+T+ +WD+ TG+ IR   GH +GV  +  D+ ++I+GS D +I++W+  +G C+ T+
Sbjct: 484 SLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTF 543

Query: 336 RGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFS 395
            G +      +    L  + +A  T       + T   ++     + CV +    F  FS
Sbjct: 544 HGKRLQPQDEEGSTHLASTSNATGT------STSTANPVQNKVSPIACVSIGDSEF--FS 595

Query: 396 GSDDMTIRMW 405
           G +   ++M+
Sbjct: 596 GDELGCVKMY 605

>YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that
           targets proteins for ubiquitination by interacting with
           the SCF complex (Skp1p-Cdc53p-Cdc34p), regulates sulfur
           assimilation genes in response to S-adenosylmethionine
           levels, contains five WD (WD-40) repeats [1923 bp, 640
           aa]
          Length = 640

 Score =  709 bits (1831), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/546 (63%), Positives = 397/546 (72%), Gaps = 31/546 (5%)

Query: 40  PQYNFVRYCYRHNPDIQAAPTXXXXXXXXXXXXXXXXXXXGELSSEGERQVVQEAVRLFD 99
           P+YNF ++CYRHNPDIQ +PT                    +L  + E+  +   +  + 
Sbjct: 87  PEYNFTKFCYRHNPDIQFSPTHTACYKQDLKRTQEINANIAKLPLQ-EQSDIHHIISKYS 145

Query: 100 SSNDKLRKLMLEGMLLKSCFPQLSFISTQLQKLIKIDFISALPEEVALKILGYLDCQSLC 159
           +SNDK+RKL+L+G+L  SCFPQLS+IS+ +  +IKIDFIS LP+E++LKIL YLDCQSLC
Sbjct: 146 NSNDKIRKLILDGILSTSCFPQLSYISSLVTHMIKIDFISILPQELSLKILSYLDCQSLC 205

Query: 160 SAAAVCRRWQELADDDTVWYHMCEQHIDRKCPKCGWGLPLLHMKRARYIKSDKASASKGE 219
           +A  VCR+WQ+LADDD VWYHMCEQHIDRKCP CGWGLPLLHMKRAR  ++   S+S   
Sbjct: 206 NATRVCRKWQKLADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARIQQNSTGSSSNA- 264

Query: 220 GEDAPQSRMRPWKVVYRERFKVESNWRKGIYRIQEFKGHMDGVXXXXXXXXXXXTGSYDS 279
             D      RPWKV+YRERFKVESNWRKG  RIQEFKGHMDGV           TGSYDS
Sbjct: 265 --DIQTQTTRPWKVIYRERFKVESNWRKGHCRIQEFKGHMDGVLTLQFNYRLLFTGSYDS 322

Query: 280 TVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQ 339
           T+ IWDL TGKLIRRLSGH+DGVK L FDD+KLITGSLDKTIRVWNY+TG C+STYRGH 
Sbjct: 323 TIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGECISTYRGHS 382

Query: 340 DSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDD 399
           DSVLSVDS++K+IVSGSADKTVKVWHVESRTCYTLRGHT WVNCVKLHPKSF+CFS SDD
Sbjct: 383 DSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDD 442

Query: 400 MTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLG----------SDLIEXXXXXXXXXXXX 449
            TIRMWDIRTN+C++VF GHVGQVQK+IPLT+           SD               
Sbjct: 443 TTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGAD 502

Query: 450 XXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADN 509
                 + Q    D ++PYPTHLLSC LDNTIKLW+VKTG CIRTQFGHVEGVWDIAADN
Sbjct: 503 ESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADN 562

Query: 510 FRIVSGSHDRSCKVWDLQTGKCMHTFVGIH-----------------APVACVGIGDSEF 552
           FRI+SGSHD S KVWDLQ+GKCMHTF G                   AP+ACV IGDSE 
Sbjct: 563 FRIISGSHDGSIKVWDLQSGKCMHTFNGRRLQRETQHTQTQSLGDKVAPIACVCIGDSEC 622

Query: 553 VSGDEL 558
            SGDE 
Sbjct: 623 FSGDEF 628

>KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30 involved in regulation of
           sulfur assimilation genes and cell cycle progression,
           start by similarity
          Length = 623

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/555 (61%), Positives = 394/555 (70%), Gaps = 38/555 (6%)

Query: 40  PQYNFVRYCYRHNPDIQAAPTXXXXXXXXXXXXXXXXXXXGELSSEGERQVVQEAVRLFD 99
           PQ+NF ++CYRHNPDIQ                         L  E +R ++++ +  F 
Sbjct: 60  PQFNFFKFCYRHNPDIQHTCKDSMVFQDQVRSEKWMEKMKA-LDKESDRAIIKQTLDNFQ 118

Query: 100 SSNDKLRKLMLEGMLLKSCFPQLSFISTQLQKLIKIDFISALPEEVALKILGYLDCQSLC 159
            SNDK+R+LMLEG+L   CFPQLS+I+ ++++LIKIDFIS LPEE++LKILGYLDCQSLC
Sbjct: 119 HSNDKIRRLMLEGILQLCCFPQLSYIADEVKQLIKIDFISTLPEELSLKILGYLDCQSLC 178

Query: 160 SAAAVCRRWQELADDDTVWYHMCEQHIDRKCPKCGWGLPLLHMKRARYIKSDKASASKGE 219
            A+  C+RW+ LADDD VWYHMCEQHIDRKCP CGWGLPLLHMKRARY+  ++A      
Sbjct: 179 IASLTCKRWKTLADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARYLPVNEAHVHNQN 238

Query: 220 GED--------------------------------APQSR--MRPWKVVYRERFKVESNW 245
           G                                  A  SR   RPWKV+YRERF+VESNW
Sbjct: 239 GNQFQNVANGNGNEIGGGKSLINPGNSPNQTVAARARNSRYYTRPWKVIYRERFQVESNW 298

Query: 246 RKGIYRIQEFKGHMDGVXXXXXXXXXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGVKAL 305
           R G  RIQ FKGHMDGV           TGSYDSTVAIWD  +G LIRRL+GHTDGVK +
Sbjct: 299 RNGRCRIQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGI 358

Query: 306 RFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWH 365
            FDDQK+IT SLDKTIRVWNY+TG+C+STYRGHQDSVLSVDS++K+IVS SADKTVKVWH
Sbjct: 359 YFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWH 418

Query: 366 VESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQK 425
           VESRTCYTLRGHT WVNCVKLHPKSFTC+S SDD T+RMWDIRTN+C++VF GHVGQVQK
Sbjct: 419 VESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQK 478

Query: 426 VIPLTLG--SDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKL 483
           VIPLT+    +L+                         FD +L YPTHLLSCSLDNTIKL
Sbjct: 479 VIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGI-FDPNLKYPTHLLSCSLDNTIKL 537

Query: 484 WNVKTGACIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVA 543
           W V +G CIRTQFGHVEGVWDIAADNFRIVSGSHD+S KVWDLQ GKC+ TF G  AP+ 
Sbjct: 538 WEVSSGRCIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIV 597

Query: 544 CVGIGDSEFVSGDEL 558
           CVGIGDS FVSGDEL
Sbjct: 598 CVGIGDSSFVSGDEL 612

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 57/92 (61%)

Query: 276 SYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTY 335
           S D+T+ +W++++G+ IR   GH +GV  +  D+ ++++GS DK+I+VW+   G C+ T+
Sbjct: 530 SLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTF 589

Query: 336 RGHQDSVLSVDSFRKLIVSGSADKTVKVWHVE 367
            GH+  ++ V       VSG     VK+WH +
Sbjct: 590 TGHKAPIVCVGIGDSSFVSGDELGEVKMWHFD 621

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 58/97 (59%), Gaps = 7/97 (7%)

Query: 312 LITGSLDKTIRVWNYVTGACVSTYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWHVESR 369
           L++ SLD TI++W   +G C+ T  GH + V  ++ D+FR  IVSGS DK++KVW +++ 
Sbjct: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFR--IVSGSHDKSIKVWDLQNG 583

Query: 370 TCY-TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMW 405
            C  T  GH   + CV +   SF   SG +   ++MW
Sbjct: 584 KCIQTFTGHKAPIVCVGIGDSSFV--SGDELGEVKMW 618

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 36/70 (51%)

Query: 257 GHMDGVXXXXXXXXXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGS 316
           GH++GV           +GS+D ++ +WDL  GK I+  +GH   +  +   D   ++G 
Sbjct: 551 GHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIGDSSFVSGD 610

Query: 317 LDKTIRVWNY 326
               +++W++
Sbjct: 611 ELGEVKMWHF 620

>CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30, hypothetical start
          Length = 673

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/599 (57%), Positives = 400/599 (66%), Gaps = 80/599 (13%)

Query: 40  PQYNFVRYCYRHNPDIQAAPTXXXXXXXXXXXXXXXXXXXGELSSEGERQVVQEAVRLFD 99
           P+ NF RYCYRHNP+IQ + T                    +L+   E+  +   +  + 
Sbjct: 63  PRDNFQRYCYRHNPEIQTSNTHELCYKQDMQRIKMINNKISQLACPKEQADIHHIISKYT 122

Query: 100 SSNDKLRKLMLEGMLLKSCFPQLSFISTQLQKLIKIDFISALPEEVALKILGYLDCQSLC 159
           +SNDK+RKL+L+G+L  SCFPQLS+I+  +  +IKIDFIS LP+E++LKILGYLDCQSLC
Sbjct: 123 NSNDKVRKLILDGILTSSCFPQLSYIAQHINTMIKIDFISVLPQELSLKILGYLDCQSLC 182

Query: 160 SAAAVCRRWQELADDDTVWYHMCEQHIDRKCPKCGWGLPLLHMKRAR--YIKSDKASAS- 216
           +A+ VC+ W  LADDD VWYHMCEQHIDRKCP CGWGLPLLHMKRAR  YIK+   + + 
Sbjct: 183 NASMVCKNWHLLADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARVCYIKAKNPNTTV 242

Query: 217 ------------------KGEGEDAP-------------------------------QSR 227
                             + +G ++P                               + R
Sbjct: 243 NDRKMIQDNDNRISPLTDRTQGNESPGATFSTNVCTTASNNTVSGSKSSGQGQQENGRCR 302

Query: 228 MRPWKVVYRERFKVESNWRKGIYRIQEFKGHMDGVXXXXXXXXXXXTGSYDSTVAIWDLA 287
            + WK+VYRERFKVESNWRKG+  IQEFKGHMDGV           TGSYD+TVAIWDL 
Sbjct: 303 QKSWKMVYRERFKVESNWRKGLCTIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLF 362

Query: 288 TGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDS 347
           TGKLIRRL+GH+DGVK L FDDQKLITGSLDKTIRVWNY+TG C+STYRGH DSV+SVDS
Sbjct: 363 TGKLIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDS 422

Query: 348 FRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDI 407
            +K+IVSGSADKTVKVWHVESRTCYTL+GHT WVNCVKLHPKSF+C+S SDD TIRMWDI
Sbjct: 423 HKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDI 482

Query: 408 RTNTCVRVFHGHVGQVQKVIPLTL--GSDLI--EXXXXXXXXXXXXXXXXXXSVQAAN-- 461
           RTNTC+RVF GHVGQVQKVIPLT+    +L+  E                       N  
Sbjct: 483 RTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQ 542

Query: 462 --FDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFRIVSGSHDR 519
              D  +PYPTHLLSC+LDNTIKLW V++G CIRTQFGHVEGVWDIAADNFRI+SGSHD 
Sbjct: 543 RELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDG 602

Query: 520 SCKVWDLQTGKCMHTFVG--------------------IHAPVACVGIGDSEFVSGDEL 558
           S K+WDLQ+GKCMHTF G                      APVACV IGDSE  SGDE 
Sbjct: 603 SIKIWDLQSGKCMHTFHGRKLKGSDVNTSSNPDHDERTKSAPVACVCIGDSECFSGDEF 661

>YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and
           component of the SCF-Cdc4p complex
           (Skp1p-Cdc53p-Cdc34p-Cdc4p) which targets Sic1p, Far1p,
           Cdc6p, Ctf13p and Gcn4p for ubiquitin-dependent
           degradation, has WD (WD-40) repeats [2340 bp, 779 aa]
          Length = 779

 Score =  113 bits (282), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 96/368 (26%), Positives = 156/368 (42%), Gaps = 55/368 (14%)

Query: 96  RLFDSSNDKLRKLMLEGMLLKSCF----PQLSFISTQLQKLIKIDFISALPEEVALKILG 151
            +F + N+ L     + +L +        +LS + T ++  +K D I++LP E++LKI  
Sbjct: 229 EIFSAINNNLPHAYFKNLLFRLVANMDRSELSDLGTLIKDNLKRDLITSLPFEISLKIFN 288

Query: 152 YLDCQSLCSAAAVCRRWQELADDDTVWYHMCEQHIDRKCPKCGWGLPLLHMKRARYIKSD 211
           YL  + + ++  V + W ++    T  +       +   PK   G   L++K ++  K  
Sbjct: 289 YLQFEDIINSLGVSQNWNKIIRKSTSLWKKLLISENFVSPK---GFNSLNLKLSQ--KYP 343

Query: 212 KASASKGEGEDAPQSRMRPWKVVYRERFKVESNWRKGIYRIQE--FKGHMDGVXX-XXXX 268
           K S          Q R+R   + + E   +  NW    +  Q    +GHM  V       
Sbjct: 344 KLSQ---------QDRLR---LSFLENIFILKNWYNPKFVPQRTTLRGHMTSVITCLQFE 391

Query: 269 XXXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK-LITGSLDKTIRVWNYV 327
                TG+ D  + ++D    K + +LSGH  GV AL++     L++GS D+T+RVW+  
Sbjct: 392 DNYVITGADDKMIRVYDSINKKFLLQLSGHDGGVWALKYAHGGILVSGSTDRTVRVWDIK 451

Query: 328 TGACVSTYRGHQDSVLSVDSFR----KLIVSGSADKTVKVW------------------- 364
            G C   ++GH  +V  +D       K IV+GS D T+ VW                   
Sbjct: 452 KGCCTHVFKGHNSTVRCLDIVEYKNIKYIVTGSRDNTLHVWKLPKESSVPDHGEEHDYPL 511

Query: 365 --HVESRTCY---TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGH 419
             H      Y    LRGH   V  V  H       SGS D T+ +WD+    C+ +  GH
Sbjct: 512 VFHTPEENPYFVGVLRGHMASVRTVSGHGN--IVVSGSYDNTLIVWDVAQMKCLYILSGH 569

Query: 420 VGQVQKVI 427
             ++   I
Sbjct: 570 TDRIYSTI 577

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 85/193 (44%), Gaps = 33/193 (17%)

Query: 250 YRIQEFKGHMDGVXXXXXXXXXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDD 309
           Y +   +GHM  V           +GSYD+T+ +WD+A  K +  LSGHTD + +  +D 
Sbjct: 521 YFVGVLRGHMASVRTVSGHGNIVVSGSYDNTLIVWDVAQMKCLYILSGHTDRIYSTIYDH 580

Query: 310 Q--KLITGSLDKTIRVWN----YVTGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKV 363
           +  + I+ S+D TIR+W+    +  G C  +Y                  + SA    K+
Sbjct: 581 ERKRCISASMDTTIRIWDLENIWNNGEC--SY-----------------ATNSASPCAKI 621

Query: 364 WHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQV 423
                   YTL+GHT  V  ++L  K     S + D +IR WD   N   R F  H   +
Sbjct: 622 LGA----MYTLQGHTALVGLLRLSDKFLV--SAAADGSIRGWD--ANDYSRKFSYHHTNL 673

Query: 424 QKVIPLTLGSDLI 436
             +    +  +++
Sbjct: 674 SAITTFYVSDNIL 686

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 67/282 (23%), Positives = 108/282 (38%), Gaps = 67/282 (23%)

Query: 333 STYRGHQDSVLSVDSFR-KLIVSGSADKTVKVW-HVESRTCYTLRGHTGWVNCVKLHPKS 390
           +T RGH  SV++   F    +++G+ DK ++V+  +  +    L GH G V  +K +   
Sbjct: 375 TTLRGHMTSVITCLQFEDNYVITGADDKMIRVYDSINKKFLLQLSGHDGGVWALK-YAHG 433

Query: 391 FTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXX 450
               SGS D T+R+WDI+   C  VF GH   V+ +       D++E             
Sbjct: 434 GILVSGSTDRTVRVWDIKKGCCTHVFKGHNSTVRCL-------DIVEYKNIKYIVTGSRD 486

Query: 451 XX-------XXXSVQAANFDHSLPYPTH----------------------------LLSC 475
                       SV     +H  P   H                            ++S 
Sbjct: 487 NTLHVWKLPKESSVPDHGEEHDYPLVFHTPEENPYFVGVLRGHMASVRTVSGHGNIVVSG 546

Query: 476 SLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNF--RIVSGSHDRSCKVWDLQ----TG 529
           S DNT+ +W+V    C+    GH + ++    D+   R +S S D + ++WDL+     G
Sbjct: 547 SYDNTLIVWDVAQMKCLYILSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLENIWNNG 606

Query: 530 KC----------------MHTFVGIHAPVACVGIGDSEFVSG 555
           +C                M+T  G  A V  + + D   VS 
Sbjct: 607 ECSYATNSASPCAKILGAMYTLQGHTALVGLLRLSDKFLVSA 648

>AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -
           NSH] complement(667539..669809) [2271 bp, 756 aa]
          Length = 756

 Score =  112 bits (280), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 124/504 (24%), Positives = 192/504 (38%), Gaps = 113/504 (22%)

Query: 107 KLMLEGMLLKSCFPQLSFISTQLQKLIKIDFISALPEEVALKILGYLDCQSLCSAAAVCR 166
           K ++  +L K    +LS +ST L+  +K DF+  LP EV++ IL  LD + +CS   V R
Sbjct: 228 KNLVFQLLSKLNRSELSDLSTYLKDHLKRDFLQYLPMEVSMNILNNLDFEDICSCLLVNR 287

Query: 167 RWQELADDDT-VWYHM--CEQHIDRKC--PKCGWGLPLLHMKRARYIKSDKASASKGEGE 221
            W  L  +   +W HM   E  +   C    C   +P  H    R++ +           
Sbjct: 288 TWNNLIRNSPYLWKHMMLSEGFVTEDCFSSYCD-SIPEKH----RHLPN----------- 331

Query: 222 DAPQSRMRPWKVVYRERFKVESNWRKGIYRIQE--FKGHMDGVXX-XXXXXXXXXTGSYD 278
             P  R R   + + E   +  NW    YR       GH   V            TG+ D
Sbjct: 332 --PSDRFR---LDFLENRWLLENWCNPCYRPGRTCLDGHRTKVVTCFQFEGNYIITGADD 386

Query: 279 STVAIWDLATGKLIRRLSGHTDGVKALRF-DDQKLITGSLDKTIRVWNYVTGACVSTYRG 337
             + ++D    +    L GH  GV AL++  D+ L++GS D+T+R+WN   G C   +RG
Sbjct: 387 KRINVYDADREQFKLELVGHEGGVWALKYAGDEILVSGSTDRTVRIWNVKAGKCTHVFRG 446

Query: 338 HQDSVLSVDSFR----KLIVSGSADKTVKVWH-------------------VESRTCY-- 372
           H  +V  +D       K +V+GS D T+ VW                    +E    +  
Sbjct: 447 HTSTVRCLDVVEHGGIKYVVTGSRDNTLHVWKLPDPNSPDYNPNAMRQFNSIEDNPFFVG 506

Query: 373 TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLG 432
            LRGH   V  V  H       SGS D  + +WDI     + V  GH  ++   +     
Sbjct: 507 VLRGHMASVRTVSGHGN--IVVSGSYDHNLMVWDIAKMKLLYVLTGHTDRIYSTL----- 559

Query: 433 SDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWN------- 485
                                        +DH        +S S+D T+K+W+       
Sbjct: 560 -----------------------------YDHKR---KRCISASMDTTVKVWDLSDINNN 587

Query: 486 -----------VKTGACIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHT 534
                      +K    +RT  GH   V  +   +  +VS + D S + WD        +
Sbjct: 588 GPVSQINSTSALKVSGSVRTLCGHTALVGLLGLSDKYLVSAAADGSLRGWDASDYSKRFS 647

Query: 535 FVGIH-APVACVGIGDSEFVSGDE 557
           F   + + +    + D+  VSG E
Sbjct: 648 FHHTNQSAITTFFVSDNILVSGSE 671

>CAGL0L02629g complement(307323..309710) similar to sp|P07834
           Saccharomyces cerevisiae YFL009w CDC4 cell division
           control, hypothetical start
          Length = 795

 Score =  112 bits (279), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 113/463 (24%), Positives = 175/463 (37%), Gaps = 114/463 (24%)

Query: 121 QLSFISTQLQKLIKIDFISALPEEVALKILGYLDCQSLCSAAAVCRRWQELAD-DDTVWY 179
           +LS IST L+  +K DF+++LP E+ LKIL  L  +S+ +   V + W  L +    +W 
Sbjct: 244 ELSDISTLLRDNLKRDFVTSLPLEITLKILNKLPFESISNCLQVSKSWNRLINGTPALWK 303

Query: 180 HMCEQHIDRKCPKCGWGLPLLHMKRARYIKSDKASASKGEGEDAPQSRMRPWKVVYRERF 239
           H+                 LL          DK    +    D P      ++  +    
Sbjct: 304 HL-----------------LLSESFVSKDSFDKKYPVENNKLDPPFDNDSRYRQDFLMNC 346

Query: 240 KVESNWRKGIYRIQE--FKGHMDGVXX-XXXXXXXXXTGSYDSTVAIWDLATGKLIRRLS 296
            +  NW    +  Q    KGHM  V            TG+ D  + I+D  T K +  LS
Sbjct: 347 SILQNWYNPDFIPQRTTLKGHMTSVVTCLQFEDNYVITGADDKMIRIYDSITKKFLIELS 406

Query: 297 GHTDGVKALRF-DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFR----KL 351
           GH  GV AL++  +  L++GS D+++R+WN   G C   ++GH  +V  +D       K 
Sbjct: 407 GHDGGVWALKYAGNGILVSGSTDRSVRIWNIHLGKCTHVFKGHTSTVRCLDIVEHEGVKY 466

Query: 352 IVSGSADKTVKVW--------------------------HVESRTCY---TLRGHTGWVN 382
           IV+GS D T+ +W                          H      Y    LRGH   V 
Sbjct: 467 IVTGSRDNTLHIWKLPQMSDSNIDEGMPNVYSNNGPLFFHSPEENPYFVGVLRGHIASVR 526

Query: 383 CVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXX 442
            V  H +     SGS D  + +WDI    C+ +  GH  ++   I               
Sbjct: 527 TVSGHGR--IVISGSYDNNLIVWDIIQMKCLYILMGHTDRIYSTI--------------- 569

Query: 443 XXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVK----TGACIR----- 493
                              +D+        +S S+D+TIK+W+++     G C+      
Sbjct: 570 -------------------YDYKR---NRCISASMDSTIKIWDLQNIWNNGECVNVTNAT 607

Query: 494 -----------TQFGHVEGVWDIAADNFRIVSGSHDRSCKVWD 525
                      T  GH   V  +   +  +VS + D S + WD
Sbjct: 608 VPCTKITGPMMTLQGHTALVGLLKLSDKFLVSAAADGSLRGWD 650

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/235 (21%), Positives = 94/235 (40%), Gaps = 66/235 (28%)

Query: 333 STYRGHQDSVLSVDSFR-KLIVSGSADKTVKVW-HVESRTCYTLRGHTGWVNCVKLHPKS 390
           +T +GH  SV++   F    +++G+ DK ++++  +  +    L GH G V  +K +  +
Sbjct: 362 TTLKGHMTSVVTCLQFEDNYVITGADDKMIRIYDSITKKFLIELSGHDGGVWALK-YAGN 420

Query: 391 FTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXX 450
               SGS D ++R+W+I    C  VF GH   V+ +       D++E             
Sbjct: 421 GILVSGSTDRSVRIWNIHLGKCTHVFKGHTSTVRCL-------DIVEHEGVK-------- 465

Query: 451 XXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLW--------NVKTGA------------ 490
                               ++++ S DNT+ +W        N+  G             
Sbjct: 466 --------------------YIVTGSRDNTLHIWKLPQMSDSNIDEGMPNVYSNNGPLFF 505

Query: 491 --------CIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVG 537
                    +    GH+  V  ++     ++SGS+D +  VWD+   KC++  +G
Sbjct: 506 HSPEENPYFVGVLRGHIASVRTVSGHGRIVISGSYDNNLIVWDIIQMKCLYILMG 560

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 48/84 (57%), Gaps = 1/84 (1%)

Query: 471 HLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA-ADNFRIVSGSHDRSCKVWDLQTG 529
           ++++ + D  I++++  T   +    GH  GVW +  A N  +VSGS DRS ++W++  G
Sbjct: 381 YVITGADDKMIRIYDSITKKFLIELSGHDGGVWALKYAGNGILVSGSTDRSVRIWNIHLG 440

Query: 530 KCMHTFVGIHAPVACVGIGDSEFV 553
           KC H F G  + V C+ I + E V
Sbjct: 441 KCTHVFKGHTSTVRCLDIVEHEGV 464

 Score = 33.5 bits (75), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 49/107 (45%), Gaps = 27/107 (25%)

Query: 274 TGSYDSTVAIWDLA---------------------TGKLIRRLSGHTDGVKALRFDDQKL 312
           + S DST+ IWDL                      TG ++  L GHT  V  L+  D+ L
Sbjct: 579 SASMDSTIKIWDLQNIWNNGECVNVTNATVPCTKITGPMMT-LQGHTALVGLLKLSDKFL 637

Query: 313 ITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSF---RKLIVSGS 356
           ++ + D ++R W+  +      +  H +++ ++ +F     ++VSGS
Sbjct: 638 VSAAADGSLRGWD--SSDYSRKFAYHHNNLSAITTFYMTDNILVSGS 682

>Kwal_23.5035
          Length = 744

 Score =  106 bits (265), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 94/359 (26%), Positives = 155/359 (43%), Gaps = 55/359 (15%)

Query: 101 SNDKLRKLMLEGMLLKSCFPQLSFISTQLQKLIKIDFISALPEEVALKILGYLDCQSLCS 160
           S+   R L+ + ++ K    +LS + T ++  +K DFI++LP EV++ IL  L  + +  
Sbjct: 227 SDSAYRNLVFQ-LISKLSRSELSDLGTLVKDNLKRDFITSLPLEVSMNILTNLGFEDISR 285

Query: 161 AAAVCRRWQELADDDTVWYH---MCEQHIDRKCPKCGWGLPLLHMKRARYIKSDKASASK 217
             +V + W  L  D +  +    + E  I  +             +  +Y +  +   S 
Sbjct: 286 CLSVSKAWNSLIRDTSYLWRTLLVTENFITVE-------------EYHKYSQGPQQLNSG 332

Query: 218 GEGEDAPQSRMRPWKVVYRERFKVESNWRKGIYRIQE--FKGH-MDGVXXXXXXXXXXXT 274
              ED        +++ + E      NW    ++      +GH M  V           T
Sbjct: 333 HLHEDF-------FRLHFMENRAYLKNWYDSKFKPHRTTLRGHTMKIVTCLQFEDDYVIT 385

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFD-DQKLITGSLDKTIRVWNYVTGACVS 333
           G+ D  + ++D  T K I +LSGH  GV AL++  D  L++GS D+++RVWN  +G C  
Sbjct: 386 GADDKMIRVYDAKTEKFITQLSGHDGGVWALKYGHDGILVSGSTDRSVRVWNIKSGKCTH 445

Query: 334 TYRGHQDSVLSVD----SFRKLIVSGSADKTVKVWHVES--------RTCY--------- 372
            ++GH  +V  +D    + +K IV+GS D T+ VW + +          C          
Sbjct: 446 VFKGHTSTVRCLDIVEHNGKKFIVTGSRDHTLHVWKLPNCNAEDYNPEVCEVFNTTDANP 505

Query: 373 ----TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVI 427
                LRGH   V  V  H       SGS D  + +WDI    C+ V  GH  ++   I
Sbjct: 506 YFVGVLRGHMAAVRTVSGHGN--IVVSGSYDFNLMVWDIAQMKCLYVLTGHTDRIYSTI 562

 Score = 71.6 bits (174), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 65/251 (25%), Positives = 113/251 (45%), Gaps = 36/251 (14%)

Query: 295 LSGHT-DGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVD-SFRKLI 352
           L GHT   V  L+F+D  +ITG+ DK IRV++  T   ++   GH   V ++      ++
Sbjct: 365 LRGHTMKIVTCLQFEDDYVITGADDKMIRVYDAKTEKFITQLSGHDGGVWALKYGHDGIL 424

Query: 353 VSGSADKTVKVWHVESRTC-YTLRGHTGWVNCVKL--HPKSFTCFSGSDDMTIRMWDIRT 409
           VSGS D++V+VW+++S  C +  +GHT  V C+ +  H       +GS D T+ +W +  
Sbjct: 425 VSGSTDRSVRVWNIKSGKCTHVFKGHTSTVRCLDIVEHNGKKFIVTGSRDHTLHVWKL-P 483

Query: 410 NTCVRVFHGHVGQVQKVI---PLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSL 466
           N     ++  V +V       P  +G                       +V+  +   ++
Sbjct: 484 NCNAEDYNPEVCEVFNTTDANPYFVG----------------VLRGHMAAVRTVSGHGNI 527

Query: 467 PYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAAD--NFRIVSGSHDRSCKVW 524
                ++S S D  + +W++    C+    GH + ++    D    R +S   D + KVW
Sbjct: 528 -----VVSGSYDFNLMVWDIAQMKCLYVLTGHTDRIYSTIYDYQRNRCISAGMDSTVKVW 582

Query: 525 DL----QTGKC 531
           DL    + G C
Sbjct: 583 DLADVSKNGPC 593

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 97/213 (45%), Gaps = 30/213 (14%)

Query: 333 STYRGHQDSVLSVDSFRK-LIVSGSADKTVKVWHVESRTCYT-LRGHTGWVNCVKLHPKS 390
           +T RGH   +++   F    +++G+ DK ++V+  ++    T L GH G V  +K +   
Sbjct: 363 TTLRGHTMKIVTCLQFEDDYVITGADDKMIRVYDAKTEKFITQLSGHDGGVWALK-YGHD 421

Query: 391 FTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXX 450
               SGS D ++R+W+I++  C  VF GH   V+ +       D++E             
Sbjct: 422 GILVSGSTDRSVRVWNIKSGKCTHVFKGHTSTVRCL-------DIVEHNGKKF------- 467

Query: 451 XXXXXSVQAANFDHSLPYPTHLLSCSLDN----TIKLWNVKTGA--CIRTQFGHVEGVWD 504
                 +   + DH+L +   L +C+ ++      +++N        +    GH+  V  
Sbjct: 468 ------IVTGSRDHTL-HVWKLPNCNAEDYNPEVCEVFNTTDANPYFVGVLRGHMAAVRT 520

Query: 505 IAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVG 537
           ++     +VSGS+D +  VWD+   KC++   G
Sbjct: 521 VSGHGNIVVSGSYDFNLMVWDIAQMKCLYVLTG 553

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 76/174 (43%), Gaps = 31/174 (17%)

Query: 250 YRIQEFKGHMDGVXXXXXXXXXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDD 309
           Y +   +GHM  V           +GSYD  + +WD+A  K +  L+GHTD + +  +D 
Sbjct: 506 YFVGVLRGHMAAVRTVSGHGNIVVSGSYDFNLMVWDIAQMKCLYVLTGHTDRIYSTIYDY 565

Query: 310 Q--KLITGSLDKTIRVWNYV----TGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKV 363
           Q  + I+  +D T++VW+       G C +                   ++ S +   KV
Sbjct: 566 QRNRCISAGMDSTVKVWDLADVSKNGPCTT-------------------ITSSNNPCTKV 606

Query: 364 WHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFH 417
               + +  TL+GHT  V  + L  K F   +G+D + +R WD    T    +H
Sbjct: 607 ----TGSSITLQGHTALVGLLGLSDK-FLVSAGADGI-LRGWDSENYTRQFAYH 654

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 471 HLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFRI-VSGSHDRSCKVWDLQTG 529
           ++++ + D  I++++ KT   I    GH  GVW +   +  I VSGS DRS +VW++++G
Sbjct: 382 YVITGADDKMIRVYDAKTEKFITQLSGHDGGVWALKYGHDGILVSGSTDRSVRVWNIKSG 441

Query: 530 KCMHTFVGIHAPVACVGI 547
           KC H F G  + V C+ I
Sbjct: 442 KCTHVFKGHTSTVRCLDI 459

>YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein of
           unknown function, member of WD (WD-40) repeat family
           [1548 bp, 515 aa]
          Length = 515

 Score =  105 bits (262), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 93/311 (29%), Positives = 139/311 (44%), Gaps = 66/311 (21%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGAC 331
           TG+ D+T  IWD  T   +  L GH + V  + +  D + + TGS+D TIR+W+  +G C
Sbjct: 161 TGAGDNTARIWDCDTQTPMHTLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKSGQC 220

Query: 332 VS-TYRGHQDSVLSVD---------SFRKLIVSGSADKTVKVWHVESRTC-YTLRGHTGW 380
           +    RGH   + S+            +  + S S D T+K+W   SR C YT+ GHT  
Sbjct: 221 LGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNS 280

Query: 381 VNCVKLHPKSFTCFSGSDDMTIRMWDIRTN-TCVRVFHGHVGQVQKVIPLTLGSDLIEXX 439
           V+CVK   +    +SGS D T+R+WDI +   C+ +   H   V     L+L +D     
Sbjct: 281 VSCVKWGGQGL-LYSGSHDRTVRVWDINSQGRCINILKSHAHWVNH---LSLSTDY---- 332

Query: 440 XXXXXXXXXXXXXXXXSVQAANFDHSLPYPT-------------------------HLLS 474
                           +++   FDH+   P+                          +++
Sbjct: 333 ----------------ALRIGAFDHTGKKPSTPEEAQKKALENYEKICKKNGNSEEMMVT 376

Query: 475 CSLDNTIKLWN-VKTGACIRTQFGHVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQTGKC 531
            S D T+ LWN +K+   I    GH + V  +A   D   IVS S D S K+WD + GK 
Sbjct: 377 ASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKF 436

Query: 532 MHTFVGIHAPV 542
           + TF G  A V
Sbjct: 437 ISTFRGHVASV 447

 Score = 87.4 bits (215), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 79/278 (28%), Positives = 126/278 (45%), Gaps = 24/278 (8%)

Query: 274 TGSYDSTVAIWDLATGK-LIRRLSGHTDGVKALRFD---------DQKLITGSLDKTIRV 323
           TGS D+T+ +WD  +G+ L   L GH+  + +L ++           +L + S D TI++
Sbjct: 203 TGSMDNTIRLWDPKSGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKI 262

Query: 324 WNYVTGACVSTYRGHQDSVLSVD-SFRKLIVSGSADKTVKVWHVES--RTCYTLRGHTGW 380
           W+ V+  C  T  GH +SV  V    + L+ SGS D+TV+VW + S  R    L+ H  W
Sbjct: 263 WDTVSRVCQYTMSGHTNSVSCVKWGGQGLLYSGSHDRTVRVWDINSQGRCINILKSHAHW 322

Query: 381 VNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHV------GQVQKVIPLTLGSD 434
           VN + L    +    G+ D T +          +    +       G  +++  +   SD
Sbjct: 323 VNHLSLS-TDYALRIGAFDHTGKKPSTPEEAQKKALENYEKICKKNGNSEEM--MVTASD 379

Query: 435 LIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRT 494
                                  +  N     P   +++S S DN+IKLW+ + G  I T
Sbjct: 380 DYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFIST 439

Query: 495 QFGHVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQTGK 530
             GHV  V+ +A  +D   +VS S D + KVWD++T K
Sbjct: 440 FRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRK 477

 Score = 77.4 bits (189), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 73/298 (24%), Positives = 120/298 (40%), Gaps = 84/298 (28%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLI-TGSLDKTIRVWNYVT-GAC 331
           + S D T+ IWD  +      +SGHT+ V  +++  Q L+ +GS D+T+RVW+  + G C
Sbjct: 253 SSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQGLLYSGSHDRTVRVWDINSQGRC 312

Query: 332 VSTYRGH----------QDSVLSVDSF-------------------------------RK 350
           ++  + H           D  L + +F                                +
Sbjct: 313 INILKSHAHWVNHLSLSTDYALRIGAFDHTGKKPSTPEEAQKKALENYEKICKKNGNSEE 372

Query: 351 LIVSGSADKTVKVWHV--ESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIR 408
           ++V+ S D T+ +W+    ++    + GH   VN V   P      S S D +I++WD R
Sbjct: 373 MMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGR 432

Query: 409 TNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPY 468
               +  F GHV  V +V                                A + D  L  
Sbjct: 433 DGKFISTFRGHVASVYQV--------------------------------AWSSDCRL-- 458

Query: 469 PTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVW--DIAADNFRIVSGSHDRSCKVW 524
              L+SCS D T+K+W+V+T        GH + V+  D + D  R+ SG  D+  ++W
Sbjct: 459 ---LVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 52/188 (27%), Positives = 83/188 (44%), Gaps = 34/188 (18%)

Query: 352 IVSGSADKTVKVWHVESRT-CYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTN 410
           +V+G+ D T ++W  +++T  +TL+GH  WV CV   P      +GS D TIR+WD ++ 
Sbjct: 159 MVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKSG 218

Query: 411 TCV-RVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYP 469
            C+     GH   +  +                             S +  +       P
Sbjct: 219 QCLGDALRGHSKWITSL-----------------------------SWEPIHLVKPGSKP 249

Query: 470 THLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA-ADNFRIVSGSHDRSCKVWDLQT 528
             L S S D TIK+W+  +  C  T  GH   V  +       + SGSHDR+ +VWD+ +
Sbjct: 250 -RLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQGLLYSGSHDRTVRVWDINS 308

Query: 529 -GKCMHTF 535
            G+C++  
Sbjct: 309 QGRCINIL 316

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 71/192 (36%), Gaps = 48/192 (25%)

Query: 368 SRTCYTLRGHTGWVNCVKLHP-KSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKV 426
           +R+   + GH   + C    P  S    +G+ D T R+WD  T T +    GH   V  V
Sbjct: 133 TRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCV 192

Query: 427 IPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNV 486
                                                   P    + + S+DNTI+LW+ 
Sbjct: 193 -------------------------------------SWSPDGEVIATGSMDNTIRLWDP 215

Query: 487 KTGACIRTQF-GHVEGVWDIAADNF---------RIVSGSHDRSCKVWDLQTGKCMHTFV 536
           K+G C+     GH + +  ++ +           R+ S S D + K+WD  +  C +T  
Sbjct: 216 KSGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMS 275

Query: 537 GIHAPVACVGIG 548
           G    V+CV  G
Sbjct: 276 GHTNSVSCVKWG 287

>Scas_707.22
          Length = 730

 Score =  103 bits (256), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 115/487 (23%), Positives = 190/487 (39%), Gaps = 120/487 (24%)

Query: 122 LSFISTQLQKLIKIDFISALPEEVALKILGYLDCQSLCSAAAVCRRWQELADDDTVWYHM 181
           LS +++ L   +K D +S+LP E+ALKI  +L    + +  +VC  W  + +        
Sbjct: 243 LSDLNSVLNGNLKRDIVSSLPIEIALKIFQHLSYDDIFNCQSVCSNWNAIIN-------- 294

Query: 182 CEQHIDRKCPKCGWGLPLLHMKRARYIKSDKASASKGEGEDAPQSRMRPWKVVYRERFKV 241
                           PLL   +   I     SA +    +   S    +K  + E  ++
Sbjct: 295 --------------TTPLLW--KNLLISESFVSAQEVANNNNKSSF---FKEKFIESLRI 335

Query: 242 ESNWRKGIYRIQE--FKGHMDGVXX-XXXXXXXXXTGSYDSTVAIWDLATGKLIRRLSGH 298
             NW    ++ +     GH   V            TG+ D  + I+D  + K ++ LSGH
Sbjct: 336 LQNWYNPSFKPERTTLTGHATSVVTCLQFEDDYVITGADDRQLRIYDARSKKFLKELSGH 395

Query: 299 TDGVKALRFD-DQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSV--LSVDSFR--KLIV 353
             GV AL++D D  +++GS D+++R+W+   G C   ++GH  +V  L + +++  K IV
Sbjct: 396 EGGVWALKYDADGIIVSGSTDRSVRIWDIKRGCCTHVFKGHTSTVRCLEIVTYKNMKYIV 455

Query: 354 SGSADKTVKVWHV--------ESRTCYT-----------LRGHTGWVNCVKLHPKSFTCF 394
           +GS D T+ VW +        E    Y            LRGH   V  +  H       
Sbjct: 456 TGSRDNTLHVWKLIKEEKFDGELPMVYNTPEENPYFVGVLRGHMASVRTISGHGN--IVI 513

Query: 395 SGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXX 454
           SGS D  + +WDI    C+ V  GH  ++   I                           
Sbjct: 514 SGSYDNNLMVWDIAQMKCLYVLIGHTDRIYSTI--------------------------- 546

Query: 455 XSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVK---------------------TGACIR 493
                  +DH        +S S+D+TIK+W++                      TG+ + 
Sbjct: 547 -------YDHKR---QRCISASMDSTIKVWDLDNIWNNGNCTIITNSATPCTKITGSMLT 596

Query: 494 TQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVG---IGDS 550
            Q GH   V  +   +  +VS + D S + WD  +      F   H  ++ +    + D+
Sbjct: 597 LQ-GHTALVGLLRLSDKYLVSAAADGSLRGWD--SNDYSRKFSYHHNNLSAITTFYMNDN 653

Query: 551 EFVSGDE 557
             VSG E
Sbjct: 654 ILVSGSE 660

>CAGL0H03729g 342948..343859 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8, start by
           similarity
          Length = 303

 Score = 97.8 bits (242), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 84/302 (27%), Positives = 132/302 (43%), Gaps = 32/302 (10%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF-DDQKLITGSLDKTIRVWNYVTGAC- 331
           +  YD T+  W+  TG  +R +      V  L   +D+KL+  +  + IR+++  T    
Sbjct: 7   SAGYDHTIRFWEALTGVCLRTIQHPDSQVNRLEITNDKKLLAAAGHQNIRLYDIKTSNSN 66

Query: 332 -VSTYRGHQDSVLSVDSFR---KLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLH 387
            V+++ GH+ +V SV SF+   K +V+ S D T+KVW + S +      H   VN V +H
Sbjct: 67  PVASFEGHRGNVTSV-SFQQDNKWMVTSSEDGTIKVWDIRSPSVPRNYKHNAPVNEVVIH 125

Query: 388 PKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPL------TLGSDLIEXXXX 441
           P      S   D  IR+WD+  N C      H    +  +PL      + GS L+     
Sbjct: 126 PNQGELISCDRDGNIRIWDLGENQCT-----HQLTPEDDVPLQSLSVASDGSMLVAANNK 180

Query: 442 XXXXXXXXXXXXXXS--VQAANFDHSLPYPT---------HLLSCSLDNTIKLWNVKTGA 490
                         S    A  F     Y T         H+ +CS D+T ++W+V+   
Sbjct: 181 GNCYVWEMPNHTDASNLKPATKFKAHPSYITRVLLSSDVKHMATCSADHTARIWSVEDNF 240

Query: 491 CIRTQF-GHVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGI 547
            + +   GH   VWD A  AD+  +V+ S D   ++WDL T   +  + G H    CV +
Sbjct: 241 NLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRDIIRQYGGHHKGAVCVAL 300

Query: 548 GD 549
            D
Sbjct: 301 ND 302

 Score = 54.7 bits (130), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 94/225 (41%), Gaps = 51/225 (22%)

Query: 312 LITGSLDKTIRVWNYVTGACVSTYRGHQDSV---LSVDSFRKLIVSGSADKTVKVWHVE- 367
           L++   D TIR W  +TG C+ T + H DS    L + + +KL+ + +  + ++++ ++ 
Sbjct: 5   LVSAGYDHTIRFWEALTGVCLRTIQ-HPDSQVNRLEITNDKKLL-AAAGHQNIRLYDIKT 62

Query: 368 --SRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQK 425
             S    +  GH G V  V     +    + S+D TI++WDIR+ +  R +  H   V +
Sbjct: 63  SNSNPVASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDIRSPSVPRNY-KHNAPVNE 121

Query: 426 VIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWN 485
           V+                                       P    L+SC  D  I++W+
Sbjct: 122 VV-------------------------------------IHPNQGELISCDRDGNIRIWD 144

Query: 486 VKTGACIRTQFGHVEGV----WDIAADNFRIVSGSHDRSCKVWDL 526
           +    C   Q    + V      +A+D   +V+ ++  +C VW++
Sbjct: 145 LGENQCTH-QLTPEDDVPLQSLSVASDGSMLVAANNKGNCYVWEM 188

>KLLA0D07546g complement(647984..649927) some similarities with
           sp|P07834 Saccharomyces cerevisiae YFL009w CDC4 cell
           division control protein, hypothetical start
          Length = 647

 Score =  100 bits (249), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 117/489 (23%), Positives = 185/489 (37%), Gaps = 111/489 (22%)

Query: 121 QLSFISTQLQKLIKIDFISALPEEVALKILGYLDCQSLCSAAAVCRRWQELADDDTV--- 177
           QLS + + +   +K D   +LP E+ +KIL  L  + + +   V R W  L ++  V   
Sbjct: 135 QLSDLVSIITDNLKRDLFQSLPNEITVKILLNLSSEDIFACLLVNRNWNRLIEEAPVVWK 194

Query: 178 WYHMCEQHI-DRKCPKCGWGLPLLHMKRARYIKSDKASASKGEGEDAPQSRMRPWKVVYR 236
           W  + E  + + + P     LP                 SK +    P  R R   + + 
Sbjct: 195 WLMLNEGFVTEDQFPSYCNSLP-----------------SKYKHLINPDDRFR---LDFL 234

Query: 237 ERFKVESNWRKGIYRIQE--FKGHMDGVXX-XXXXXXXXXTGSYDSTVAIWDLATGKLIR 293
           E      NW    Y+       GH   V            TG+ D  + ++D      + 
Sbjct: 235 ENNWCLQNWYDPNYKPGRTCLDGHSTNVVTCLQFENNYIITGADDKKINVYDAENDLFLL 294

Query: 294 RLSGHTDGVKALRFDDQK-LITGSLDKTIRVWNYVTGACVSTYRGHQDSV--LSVDSF-- 348
            L+GH  GV AL+F D K L++GS D+++R+WN  TG C   ++GH  +V  L V  +  
Sbjct: 295 ELNGHEGGVWALKFVDGKILVSGSTDRSVRIWNIETGKCTHVFKGHTSTVRCLEVVEYGD 354

Query: 349 RKLIVSGSADKTVKVWHV-------------------ESRTCY--TLRGHTGWVNCVKLH 387
            K IV+GS D T+ VW +                   E    +   LRGH   V  V  H
Sbjct: 355 SKYIVTGSRDNTLHVWKLPPMKELDKGSQEPIFYRTPEENPYFVGVLRGHMSSVRTVSGH 414

Query: 388 PKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXX 447
            +     SGS D  + +WDI +   + +  GH  +V   I                    
Sbjct: 415 GR--IVISGSYDHNLMVWDIISMKLLYILTGHTDRVYSTI-------------------- 452

Query: 448 XXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKT------------GACIRT- 494
                         +D+        +S S+D T+ +W+++             GA I+  
Sbjct: 453 --------------YDYKR---NRCISASMDTTVMIWDLENIENNGTTTTINDGASIKVV 495

Query: 495 -----QFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIH-APVACVGIG 548
                 +GH   V  +   N  +VS + D S + WD        +F   + A +    + 
Sbjct: 496 GSMKCLYGHTALVGLLCLSNKFLVSAAADGSIRGWDPNDYSRKFSFHHTNLAAITSFSMN 555

Query: 549 DSEFVSGDE 557
           D+  VSG E
Sbjct: 556 DNILVSGSE 564

>ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH]
           complement(590077..591354) [1278 bp, 425 aa]
          Length = 425

 Score = 99.0 bits (245), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 84/282 (29%), Positives = 117/282 (41%), Gaps = 51/282 (18%)

Query: 287 ATGKLIRRLSGHTDGVKAL---RFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSV- 342
           A  KL R ++GHT  V+ +     D+    TGS D TIRVW+  TG    T +GH  +V 
Sbjct: 101 APWKLTRVINGHTGWVRCVCVDPVDNAWFATGSNDSTIRVWDLATGKLKVTLQGHIMTVR 160

Query: 343 -LSVDSFRKLIVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHPKSFTCFSGSDDM 400
            + + +    + S S DK VK W +E  T      G    V+ V LHP      S   D 
Sbjct: 161 DICISARHPYMFSASQDKLVKCWDLERNTVVRDFHGTLSGVHSVDLHPSLDLIVSAGRDS 220

Query: 401 TIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAA 460
            +R+WDIR+ +CV    GH G + KV                                  
Sbjct: 221 VVRVWDIRSRSCVLTLAGHRGPINKV---------------------------------- 246

Query: 461 NFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAAD--NFRIVSGSHD 518
                LP    ++SCS D T+KLW++  G  ++T   H   V D+A +   F   S   D
Sbjct: 247 ---RCLPVDPQIVSCSTDATVKLWDLVAGKPMKTLTHHKRNVRDLAFNPTEFSFASACTD 303

Query: 519 RSCKVWDLQTGKCMHTF----VGIHAPVACVGIGDSEFVSGD 556
              + W L  G+ +  F    +GI   +AC   G   F  GD
Sbjct: 304 -DIRSWKLVDGQLLTNFNSEALGIVNTLACNQDG-VLFAGGD 343

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 55/158 (34%), Positives = 79/158 (50%), Gaps = 5/158 (3%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGAC 331
           TGS DST+ +WDLATGKL   L GH   V+ +    +   + + S DK ++ W+      
Sbjct: 131 TGSNDSTIRVWDLATGKLKVTLQGHIMTVRDICISARHPYMFSASQDKLVKCWDLERNTV 190

Query: 332 VSTYRGHQDSVLSVD--SFRKLIVSGSADKTVKVWHVESRTC-YTLRGHTGWVNCVKLHP 388
           V  + G    V SVD      LIVS   D  V+VW + SR+C  TL GH G +N V+  P
Sbjct: 191 VRDFHGTLSGVHSVDLHPSLDLIVSAGRDSVVRVWDIRSRSCVLTLAGHRGPINKVRCLP 250

Query: 389 KSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKV 426
                 S S D T+++WD+     ++    H   V+ +
Sbjct: 251 VDPQIVSCSTDATVKLWDLVAGKPMKTLTHHKRNVRDL 288

 Score = 37.7 bits (86), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 1/61 (1%)

Query: 276 SYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKL-ITGSLDKTIRVWNYVTGACVST 334
           S D+TV +WDL  GK ++ L+ H   V+ L F+  +     +    IR W  V G  ++ 
Sbjct: 259 STDATVKLWDLVAGKPMKTLTHHKRNVRDLAFNPTEFSFASACTDDIRSWKLVDGQLLTN 318

Query: 335 Y 335
           +
Sbjct: 319 F 319

>AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH]
           (172849..175296) [2448 bp, 815 aa]
          Length = 815

 Score = 99.8 bits (247), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 82/277 (29%), Positives = 121/277 (43%), Gaps = 64/277 (23%)

Query: 275 GSYDSTVAIWDLATGKLIRRLS-------------GHTDGVKALRF--DDQKLITGSLDK 319
           G  DS + +W L    L  +L              GH+  V ++ F  D++ L++ S DK
Sbjct: 505 GFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLIGHSGPVYSVSFSPDNRYLVSASEDK 564

Query: 320 TIRVWNYVTGACVSTYRGHQDSVLSVDSFRKL---IVSGSADKTVKVWHVESRTCYTLR- 375
           T+R+W+  T  C+ +Y+GH   V  V  F  L     +GS D+T ++W  +    Y LR 
Sbjct: 565 TVRLWSLDTYTCLVSYKGHNHPVWDV-KFSPLGHYFATGSHDQTARLWSCDH--IYPLRI 621

Query: 376 --GHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGS 433
             GH   V+CV  HP      +GS D T RMWDI+T   VR+F GH   V  V       
Sbjct: 622 FAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSV------- 674

Query: 434 DLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIR 493
                                    A + D        L + S D  I +W++ TG  I+
Sbjct: 675 -------------------------AVSPDGRW-----LTTGSEDGVIIVWDIGTGKRIK 704

Query: 494 TQFGH-VEGVWDIA--ADNFRIVSGSHDRSCKVWDLQ 527
              GH    V+ ++   +   +VSG  D+S +VWDL+
Sbjct: 705 QMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDLK 741

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 72/254 (28%), Positives = 106/254 (41%), Gaps = 59/254 (23%)

Query: 305 LRF-DDQKLIT-GSLDKTIRVWNY-------------VTGACVSTYRGHQDSVLSVDSF- 348
           LRF DD +L+  G  D  I++W+                 +   T  GH   V SV SF 
Sbjct: 493 LRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLIGHSGPVYSV-SFS 551

Query: 349 --RKLIVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMW 405
              + +VS S DKTV++W +++ TC  + +GH   V  VK  P      +GS D T R+W
Sbjct: 552 PDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQTARLW 611

Query: 406 DIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHS 465
                  +R+F GH+  V  V                                   F   
Sbjct: 612 SCDHIYPLRIFAGHLNDVDCVT----------------------------------FH-- 635

Query: 466 LPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA--ADNFRIVSGSHDRSCKV 523
            P  T++L+ S D T ++W+++TG  +R   GH   V  +A   D   + +GS D    V
Sbjct: 636 -PNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIV 694

Query: 524 WDLQTGKCMHTFVG 537
           WD+ TGK +    G
Sbjct: 695 WDIGTGKRIKQMRG 708

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 67/129 (51%), Gaps = 7/129 (5%)

Query: 249 IYRIQEFKGHMDGV--XXXXXXXXXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGV--KA 304
           IY ++ F GH++ V             TGS D T  +WD+ TG  +R   GHT  V   A
Sbjct: 616 IYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVA 675

Query: 305 LRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRK---LIVSGSADKTV 361
           +  D + L TGS D  I VW+  TG  +   RGH  S +   SF K   ++VSG AD++V
Sbjct: 676 VSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSV 735

Query: 362 KVWHVESRT 370
           +VW ++  T
Sbjct: 736 RVWDLKKFT 744

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 51/214 (23%), Positives = 85/214 (39%), Gaps = 53/214 (24%)

Query: 350 KLIVSGSADKTVKVWHVE--------------SRTCYTLRGHTGWVNCVKLHPKSFTCFS 395
           +L+ +G  D  +K+W ++              +    TL GH+G V  V   P +    S
Sbjct: 500 RLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLIGHSGPVYSVSFSPDNRYLVS 559

Query: 396 GSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXX 455
            S+D T+R+W + T TC+  + GH   V  V    LG                       
Sbjct: 560 ASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGH---------------------- 597

Query: 456 SVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGV--WDIAADNFRIV 513
                          +  + S D T +LW+      +R   GH+  V       +   ++
Sbjct: 598 ---------------YFATGSHDQTARLWSCDHIYPLRIFAGHLNDVDCVTFHPNGTYVL 642

Query: 514 SGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGI 547
           +GS D++C++WD+QTG  +  F+G  A V  V +
Sbjct: 643 TGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAV 676

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 72/151 (47%), Gaps = 5/151 (3%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDD--QKLITGSLDKTIRVWNYVTGAC 331
           + S D TV +W L T   +    GH   V  ++F        TGS D+T R+W+      
Sbjct: 559 SASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQTARLWSCDHIYP 618

Query: 332 VSTYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWHVESRTCYTL-RGHTGWVNCVKLHP 388
           +  + GH + V  ++       +++GS+DKT ++W +++     L  GHT  V  V + P
Sbjct: 619 LRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSP 678

Query: 389 KSFTCFSGSDDMTIRMWDIRTNTCVRVFHGH 419
                 +GS+D  I +WDI T   ++   GH
Sbjct: 679 DGRWLTTGSEDGVIIVWDIGTGKRIKQMRGH 709

>Scas_720.95
          Length = 515

 Score = 97.8 bits (242), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 87/288 (30%), Positives = 135/288 (46%), Gaps = 30/288 (10%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGAC 331
           TG+ D+T  IWD  T      L+GH + V  + +  + + + TGS+D TIR+W+   G  
Sbjct: 161 TGAGDNTARIWDCDTQTPKATLTGHFNWVLCVSYCPNGEVIATGSMDNTIRLWDSKDGKP 220

Query: 332 V-STYRGHQDSVLSV-----------DSFRKLIVSGSADKTVKVWHVESRTC-YTLRGHT 378
           +    RGH   + S+           +S R  + S S D T+++W +  R C YT+ GHT
Sbjct: 221 LGDALRGHLKWITSLAWEPIHLVKPGESPR--LASASKDGTIRIWDITRRVCLYTMSGHT 278

Query: 379 GWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTN-TCVRVFHGHVGQVQKVIPLTLGSDLIE 437
             V+C+K   +    +SGS D T+R+WD+  +  C+ +   H   V     L+L +D   
Sbjct: 279 NSVSCIKWSGQGI-IYSGSHDKTVRVWDMNADGKCINILKSHAHWVNH---LSLSTDYAL 334

Query: 438 XXXXXXXXXXXXXXXXXXSVQA-ANFDHSLPYPTHL----LSCSLDNTIKLWN-VKTGAC 491
                               +A AN++  +     L    ++ S D T+ LWN +K+   
Sbjct: 335 RVGAFDHTGAQPASAKDARDKALANYEKVVKKNGKLEELMVTASDDFTMFLWNPLKSNKP 394

Query: 492 IRTQFGHVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQTGKCMHTFVG 537
           I    GH + V  +A   D   IVS S D S K+WD + GK + TF G
Sbjct: 395 IARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRG 442

 Score = 89.0 bits (219), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 82/276 (29%), Positives = 125/276 (45%), Gaps = 20/276 (7%)

Query: 274 TGSYDSTVAIWDLATGK-LIRRLSGHTDGVKALRFD---------DQKLITGSLDKTIRV 323
           TGS D+T+ +WD   GK L   L GH   + +L ++           +L + S D TIR+
Sbjct: 203 TGSMDNTIRLWDSKDGKPLGDALRGHLKWITSLAWEPIHLVKPGESPRLASASKDGTIRI 262

Query: 324 WNYVTGACVSTYRGHQDSVLSVD-SFRKLIVSGSADKTVKVW--HVESRTCYTLRGHTGW 380
           W+     C+ T  GH +SV  +  S + +I SGS DKTV+VW  + + +    L+ H  W
Sbjct: 263 WDITRRVCLYTMSGHTNSVSCIKWSGQGIIYSGSHDKTVRVWDMNADGKCINILKSHAHW 322

Query: 381 VNCVKL---HPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTL-GSDLI 436
           VN + L   +      F  +        D R +  +  +   V +  K+  L +  SD  
Sbjct: 323 VNHLSLSTDYALRVGAFDHTGAQPASAKDAR-DKALANYEKVVKKNGKLEELMVTASDDF 381

Query: 437 EXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQF 496
                                +  N     P   +++S S DN+IKLW+ + G  I T  
Sbjct: 382 TMFLWNPLKSNKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFR 441

Query: 497 GHVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQTGK 530
           GHV  V+ +A  AD   +VS S D + KVWD++T K
Sbjct: 442 GHVASVYQVAWSADCRLLVSCSKDTTLKVWDVRTRK 477

 Score = 83.2 bits (204), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 76/298 (25%), Positives = 120/298 (40%), Gaps = 84/298 (28%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLI-TGSLDKTIRVWNY-VTGAC 331
           + S D T+ IWD+     +  +SGHT+ V  +++  Q +I +GS DKT+RVW+    G C
Sbjct: 253 SASKDGTIRIWDITRRVCLYTMSGHTNSVSCIKWSGQGIIYSGSHDKTVRVWDMNADGKC 312

Query: 332 VSTYRGH----------QDSVLSVDSF-------------------------------RK 350
           ++  + H           D  L V +F                                +
Sbjct: 313 INILKSHAHWVNHLSLSTDYALRVGAFDHTGAQPASAKDARDKALANYEKVVKKNGKLEE 372

Query: 351 LIVSGSADKTVKVWHV--ESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIR 408
           L+V+ S D T+ +W+    ++    + GH   VN V   P      S S D +I++WD R
Sbjct: 373 LMVTASDDFTMFLWNPLKSNKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGR 432

Query: 409 TNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPY 468
               +  F GHV  V +V                                A + D  L  
Sbjct: 433 DGKFISTFRGHVASVYQV--------------------------------AWSADCRL-- 458

Query: 469 PTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVW--DIAADNFRIVSGSHDRSCKVW 524
              L+SCS D T+K+W+V+T        GH + V+  D + D  R+ SG  D+  ++W
Sbjct: 459 ---LVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 68.2 bits (165), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 82/190 (43%), Gaps = 38/190 (20%)

Query: 352 IVSGSADKTVKVWHVESRTC-YTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTN 410
           +V+G+ D T ++W  +++T   TL GH  WV CV   P      +GS D TIR+WD +  
Sbjct: 159 MVTGAGDNTARIWDCDTQTPKATLTGHFNWVLCVSYCPNGEVIATGSMDNTIRLWDSKDG 218

Query: 411 TCV-RVFHGHVGQVQKVI--PLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLP 467
             +     GH+  +  +   P+ L                         V+         
Sbjct: 219 KPLGDALRGHLKWITSLAWEPIHL-------------------------VKPGE------ 247

Query: 468 YPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFRIV-SGSHDRSCKVWDL 526
               L S S D TI++W++    C+ T  GH   V  I      I+ SGSHD++ +VWD+
Sbjct: 248 -SPRLASASKDGTIRIWDITRRVCLYTMSGHTNSVSCIKWSGQGIIYSGSHDKTVRVWDM 306

Query: 527 QT-GKCMHTF 535
              GKC++  
Sbjct: 307 NADGKCINIL 316

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 41/189 (21%), Positives = 71/189 (37%), Gaps = 48/189 (25%)

Query: 368 SRTCYTLRGHTGWVNCVKLHPKSFT-CFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKV 426
           +R+   + GH   + C    P + +   +G+ D T R+WD  T T      GH   V  V
Sbjct: 133 TRSSSAIAGHGSTILCSAFAPNTSSRMVTGAGDNTARIWDCDTQTPKATLTGHFNWVLCV 192

Query: 427 IPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNV 486
                                                   P    + + S+DNTI+LW+ 
Sbjct: 193 -------------------------------------SYCPNGEVIATGSMDNTIRLWDS 215

Query: 487 KTGACIRTQF-GHVEGVWDIA---------ADNFRIVSGSHDRSCKVWDLQTGKCMHTFV 536
           K G  +     GH++ +  +A          ++ R+ S S D + ++WD+    C++T  
Sbjct: 216 KDGKPLGDALRGHLKWITSLAWEPIHLVKPGESPRLASASKDGTIRIWDITRRVCLYTMS 275

Query: 537 GIHAPVACV 545
           G    V+C+
Sbjct: 276 GHTNSVSCI 284

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 40/79 (50%), Gaps = 4/79 (5%)

Query: 252 IQEFKGHMDGVXXXXXXX--XXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF-- 307
           I  F+GH+  V             + S D+T+ +WD+ T KL   L GH D V  + +  
Sbjct: 437 ISTFRGHVASVYQVAWSADCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSV 496

Query: 308 DDQKLITGSLDKTIRVWNY 326
           D +++ +G  DK +R+W +
Sbjct: 497 DGKRVCSGGKDKMVRIWTH 515

>YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in
           mitochondrial division and mitochondrial fission,
           contains WD (WD-40) repeats [2145 bp, 714 aa]
          Length = 714

 Score = 98.6 bits (244), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 74/276 (26%), Positives = 123/276 (44%), Gaps = 42/276 (15%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGACV 332
           G  D TV IWDL+    I  L+GH   +  ++   D   L+TG  D  +++WN       
Sbjct: 417 GYLDHTVKIWDLSKQNKIGELAGHLATINCMQINRDYGTLVTGGRDAALKLWNL------ 470

Query: 333 STYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFT 392
                         +  + +   + + T    H++S   +T   HT  V  + L P SF 
Sbjct: 471 --------------NLAQQLYQETQNLTSPTNHIDSPCVHTFEAHTDEVTALSLDP-SF- 514

Query: 393 CFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXX 452
             SGS D TIR WD+R+  C++        V     LT  +++                 
Sbjct: 515 LVSGSQDRTIRQWDLRSGKCLQTIDLSFANV-----LTTSTNV-----DLSKSTLLTQRN 564

Query: 453 XXXSVQA-ANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFR 511
              S+ A  +FD +L   T       D  ++LW++++G  IRT  GH + +  +  D+  
Sbjct: 565 ERPSIGALQSFDAALATGTK------DGVVRLWDLRSGKVIRTLKGHTDAITSLKFDSAC 618

Query: 512 IVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGI 547
           +V+GS+DR+ ++WDL+TG  ++ F    APV  + +
Sbjct: 619 LVTGSYDRTVRIWDLRTG-LLNKFHAYSAPVLSLDL 653

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/137 (32%), Positives = 79/137 (57%), Gaps = 6/137 (4%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVS 333
           TG+ D  V +WDL +GK+IR L GHTD + +L+FD   L+TGS D+T+R+W+  TG  ++
Sbjct: 581 TGTKDGVVRLWDLRSGKVIRTLKGHTDAITSLKFDSACLVTGSYDRTVRIWDLRTG-LLN 639

Query: 334 TYRGHQDSVLSVDSFRKLIVSGSADK-TVKVWHVESRTCYTL--RGHTGWVNCVKLHPKS 390
            +  +   VLS+D F++      AD+ +V+++  E    ++   +G+   V+ VK   K 
Sbjct: 640 KFHAYSAPVLSLDLFQENAAVVVADEPSVQIYDSEKDESWSCVEQGNETSVSTVKY--KE 697

Query: 391 FTCFSGSDDMTIRMWDI 407
                G ++  + +W +
Sbjct: 698 NYMVEGRENGDVNIWAV 714

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 91/219 (41%), Gaps = 49/219 (22%)

Query: 251 RIQEFKGHMDGVX--XXXXXXXXXXTGSYDSTVAIWDLATGKLIRR-------------- 294
           +I E  GH+  +             TG  D+ + +W+L   + + +              
Sbjct: 433 KIGELAGHLATINCMQINRDYGTLVTGGRDAALKLWNLNLAQQLYQETQNLTSPTNHIDS 492

Query: 295 -----LSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTY-------------- 335
                   HTD V AL  D   L++GS D+TIR W+  +G C+ T               
Sbjct: 493 PCVHTFEAHTDEVTALSLDPSFLVSGSQDRTIRQWDLRSGKCLQTIDLSFANVLTTSTNV 552

Query: 336 ----------RGHQDSVLSVDSFRKLIVSGSADKTVKVWHVES-RTCYTLRGHTGWVNCV 384
                     R  + S+ ++ SF   + +G+ D  V++W + S +   TL+GHT  +  +
Sbjct: 553 DLSKSTLLTQRNERPSIGALQSFDAALATGTKDGVVRLWDLRSGKVIRTLKGHTDAITSL 612

Query: 385 KLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQV 423
           K    S    +GS D T+R+WD+RT   +  FH +   V
Sbjct: 613 KFD--SACLVTGSYDRTVRIWDLRTG-LLNKFHAYSAPV 648

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 58/119 (48%), Gaps = 7/119 (5%)

Query: 252 IQEFKGHMDGVXXXXXXXXXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALR-FDDQ 310
           I+  KGH D +           TGSYD TV IWDL TG L+ +   ++  V +L  F + 
Sbjct: 599 IRTLKGHTDAITSLKFDSACLVTGSYDRTVRIWDLRTG-LLNKFHAYSAPVLSLDLFQEN 657

Query: 311 KLITGSLDKTIRVWNYVTG---ACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHV 366
             +  + + ++++++       +CV   +G++ SV +V      +V G  +  V +W V
Sbjct: 658 AAVVVADEPSVQIYDSEKDESWSCVE--QGNETSVSTVKYKENYMVEGRENGDVNIWAV 714

 Score = 38.1 bits (87), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 47/117 (40%), Gaps = 21/117 (17%)

Query: 462 FDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGV--WDIAADNFRIVSGSHDR 519
            D   P+ T   +  LD+T+K+W++     I    GH+  +    I  D   +V+G  D 
Sbjct: 404 LDFDAPFGTLCTAGYLDHTVKIWDLSKQNKIGELAGHLATINCMQINRDYGTLVTGGRDA 463

Query: 520 SCKVWDLQTGK-------------------CMHTFVGIHAPVACVGIGDSEFVSGDE 557
           + K+W+L   +                   C+HTF      V  + +  S  VSG +
Sbjct: 464 ALKLWNLNLAQQLYQETQNLTSPTNHIDSPCVHTFEAHTDEVTALSLDPSFLVSGSQ 520

>AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C
           (CAF4) - SH] complement(52978..55125) [2148 bp, 715 aa]
          Length = 715

 Score = 97.8 bits (242), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 73/271 (26%), Positives = 114/271 (42%), Gaps = 47/271 (17%)

Query: 296 SGHTDGVKALRFD---DQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSV--LSVDSFRK 350
           S H D V  L F+         G LD TI+VWN      V++  GH  +V  + +D +  
Sbjct: 408 SAHEDNVTCLDFNLPFGTLCSAGKLDPTIKVWNLSKNKHVASITGHLATVSCMQMDQYNT 467

Query: 351 LIVSGSADKTVKVWHVE----------SRTC-YTLRGHTGWVNCVKLHPKSFTCFSGSDD 399
           LI +G  D  +K+W ++             C YT   H   +  +     +    SGS D
Sbjct: 468 LI-TGGRDALLKMWDIQKAIDNDSIPSDEVCIYTFDSHIDEITALSFEANNLV--SGSQD 524

Query: 400 MTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQA 459
            TIR WD+    CV+    +      +    +GS  +                       
Sbjct: 525 RTIRQWDLNNGKCVQTLDINFATGGNLSRSMIGSGFLN---------------------- 562

Query: 460 ANFDHSLP-----YPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFRIVS 514
            N DH +      Y   L + + D  ++LW++++G  +RT  GH + V  +  D+  +V+
Sbjct: 563 TNNDHPIIGAIQCYDAALATGTKDGIVRLWDLRSGRVVRTLEGHSDAVTSLQFDSLNLVT 622

Query: 515 GSHDRSCKVWDLQTGKCMHTFVGIHAPVACV 545
           GS D S ++WDL+TG    TF   H PV C+
Sbjct: 623 GSLDNSIRIWDLRTGTLADTFSYEH-PVTCL 652

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 71/295 (24%), Positives = 127/295 (43%), Gaps = 74/295 (25%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDD-QKLITGSLDKTIRVWNYVTG---- 329
           G  D T+ +W+L+  K +  ++GH   V  ++ D    LITG  D  +++W+        
Sbjct: 430 GKLDPTIKVWNLSKNKHVASITGHLATVSCMQMDQYNTLITGGRDALLKMWDIQKAIDND 489

Query: 330 ------ACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTC-------YTLRG 376
                  C+ T+  H D + ++      +VSGS D+T++ W + +  C       +   G
Sbjct: 490 SIPSDEVCIYTFDSHIDEITALSFEANNLVSGSQDRTIRQWDLNNGKCVQTLDINFATGG 549

Query: 377 H-------TGWVNCVKLHP--KSFTCF-----SGSDDMTIRMWDIRTNTCVRVFHGHVGQ 422
           +       +G++N    HP   +  C+     +G+ D  +R+WD+R+   VR   GH   
Sbjct: 550 NLSRSMIGSGFLNTNNDHPIIGAIQCYDAALATGTKDGIVRLWDLRSGRVVRTLEGH--- 606

Query: 423 VQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIK 482
                     SD                     +V +  FD       +L++ SLDN+I+
Sbjct: 607 ----------SD---------------------AVTSLQFD-----SLNLVTGSLDNSIR 630

Query: 483 LWNVKTGACIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVG 537
           +W+++TG    T F +   V  +  D  +IV  + + + KV++ Q  K  H F G
Sbjct: 631 IWDLRTGTLADT-FSYEHPVTCLQFDLNKIVVANQEGTVKVYNRQEKK--HWFCG 682

 Score = 74.7 bits (182), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 62/97 (63%), Gaps = 3/97 (3%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVS 333
           TG+ D  V +WDL +G+++R L GH+D V +L+FD   L+TGSLD +IR+W+  TG    
Sbjct: 582 TGTKDGIVRLWDLRSGRVVRTLEGHSDAVTSLQFDSLNLVTGSLDNSIRIWDLRTGTLAD 641

Query: 334 TYR-GHQDSVLSVDSFRKLIVSGSADKTVKVWHVESR 369
           T+   H  + L  D   K++V+ + + TVKV++ + +
Sbjct: 642 TFSYEHPVTCLQFD-LNKIVVA-NQEGTVKVYNRQEK 676

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 68/157 (43%), Gaps = 22/157 (14%)

Query: 252 IQEFKGHMDGVXXXXXXXXXXXTGSYDSTVAIWDLATGKLIRRL---------------- 295
           I  F  H+D +           +GS D T+  WDL  GK ++ L                
Sbjct: 498 IYTFDSHIDEITALSFEANNLVSGSQDRTIRQWDLNNGKCVQTLDINFATGGNLSRSMIG 557

Query: 296 SGHTDG------VKALRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFR 349
           SG  +       + A++  D  L TG+ D  +R+W+  +G  V T  GH D+V S+    
Sbjct: 558 SGFLNTNNDHPIIGAIQCYDAALATGTKDGIVRLWDLRSGRVVRTLEGHSDAVTSLQFDS 617

Query: 350 KLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKL 386
             +V+GS D ++++W + + T      +   V C++ 
Sbjct: 618 LNLVTGSLDNSIRIWDLRTGTLADTFSYEHPVTCLQF 654

>YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer
           (COPI) complex alpha chain (alpha-COP) of secretory
           pathway vesicles required for retrograde Golgi to
           endoplasmic reticulum transport, member of WD (WD-40)
           repeat family [3606 bp, 1201 aa]
          Length = 1201

 Score = 97.4 bits (241), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 76/274 (27%), Positives = 122/274 (44%), Gaps = 28/274 (10%)

Query: 277 YDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGACVST 334
           + ST+ +WD   G L+ R   H   V+ L F   +   ++   D TI+VW+  T  C+ T
Sbjct: 31  FSSTIQLWDYRMGTLLHRFEDHEGPVRGLDFHPTQPIFVSAGDDYTIKVWSLDTNKCLYT 90

Query: 335 YRGHQDSVLSVDSFRKL--IVSGSADKTVKVWHVESRTCYT-LRGHTGWVNCVKLHPKSF 391
             GH D V +V   R+L  I+S S D+T+++W+ ++R     L GH  +V C + HP   
Sbjct: 91  LTGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDD 150

Query: 392 TCFSGSDDMTIRMWDI------RTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXX 445
              S S D TIR+WDI       +      F   +   Q ++  +LG  +++        
Sbjct: 151 LIVSASLDETIRIWDISGLRKRHSAPGTSSFEEQMSAQQNLLDGSLGDCVVK-------- 202

Query: 446 XXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGAC--IRTQFGHVEGVW 503
                      V  A+F  +LP    ++S S D  +KLW +       + T  GH   V 
Sbjct: 203 --FILEGHTRGVNWASFHPTLPL---IVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVD 257

Query: 504 DIAADNFR--IVSGSHDRSCKVWDLQTGKCMHTF 535
            +     +  I+S   D++ +VWDL     +  F
Sbjct: 258 SVIFHPHQNLIISVGEDKTLRVWDLDKRTPVKQF 291

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 80/180 (44%), Gaps = 37/180 (20%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVW------- 324
           + S D T+ IW+    K I  L+GH   V   +F   D  +++ SLD+TIR+W       
Sbjct: 112 SASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLIVSASLDETIRIWDISGLRK 171

Query: 325 ------------------NYVTGA---CVSTY--RGHQDSV--LSVDSFRKLIVSGSADK 359
                             N + G+   CV  +   GH   V   S      LIVSGS D+
Sbjct: 172 RHSAPGTSSFEEQMSAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDR 231

Query: 360 TVKVWHVESRTCY---TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVF 416
            VK+W + +   +   T RGHT  V+ V  HP      S  +D T+R+WD+   T V+ F
Sbjct: 232 QVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQNLIISVGEDKTLRVWDLDKRTPVKQF 291

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 69/182 (37%), Gaps = 42/182 (23%)

Query: 360 TVKVWHVESRTC-YTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHG 418
           T+++W     T  +    H G V  +  HP      S  DD TI++W + TN C+    G
Sbjct: 34  TIQLWDYRMGTLLHRFEDHEGPVRGLDFHPTQPIFVSAGDDYTIKVWSLDTNKCLYTLTG 93

Query: 419 HVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLD 478
           H+  V+ V                                   F   LP+   ++S S D
Sbjct: 94  HLDYVRTVF----------------------------------FHRELPW---IISASDD 116

Query: 479 NTIKLWN---VKTGACIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTF 535
            TI++WN    K  AC+ T   H          +  IVS S D + ++WD+   +  H+ 
Sbjct: 117 QTIRIWNWQNRKEIACL-TGHNHFVMCAQFHPTDDLIVSASLDETIRIWDISGLRKRHSA 175

Query: 536 VG 537
            G
Sbjct: 176 PG 177

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 60/165 (36%), Gaps = 43/165 (26%)

Query: 384 VKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXX 443
           +  HP            TI++WD R  T +  F  H G V+       G D         
Sbjct: 17  IAFHPSRPWVLVALFSSTIQLWDYRMGTLLHRFEDHEGPVR-------GLDF-------- 61

Query: 444 XXXXXXXXXXXXSVQAANFDHSLPYPTH--LLSCSLDNTIKLWNVKTGACIRTQFGHVEG 501
                                   +PT    +S   D TIK+W++ T  C+ T  GH++ 
Sbjct: 62  ------------------------HPTQPIFVSAGDDYTIKVWSLDTNKCLYTLTGHLDY 97

Query: 502 VWDIAADNFR--IVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVAC 544
           V  +        I+S S D++ ++W+ Q  K +    G +  V C
Sbjct: 98  VRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMC 142

 Score = 32.7 bits (73), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 56/119 (47%), Gaps = 7/119 (5%)

Query: 274 TGSYDSTVAIWDLATGKL--IRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTG 329
           +GS D  V +W ++  K   +    GHT+ V ++ F   +  +I+   DKT+RVW+    
Sbjct: 226 SGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQNLIISVGEDKTLRVWDLDKR 285

Query: 330 ACVSTYRGHQDSVLSVDSFRKLIVSGSA-DKTVKVWHVE-SRTC-YTLRGHTGWVNCVK 385
             V  ++   D    + +   + + G+A D  + V+ ++  R C +  +    +VN  K
Sbjct: 286 TPVKQFKRENDRFWLIAAHPHINLFGAAHDSGIMVFKLDRERPCSFIHQNQLFFVNAEK 344

>KLLA0C08547g 749737..751284 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 515

 Score = 95.5 bits (236), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 90/291 (30%), Positives = 129/291 (44%), Gaps = 26/291 (8%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGAC 331
           TG+ D+T  IWD  T   +  L GH + V    +  D + + TGS+D TIR+W    G  
Sbjct: 161 TGAGDNTACIWDCDTQTRMCTLQGHHNWVLCCSWSPDGELIATGSMDNTIRLWESSKGKP 220

Query: 332 VS-TYRGHQDSVLSVD---------SFRKLIVSGSADKTVKVWHVESRTCY-TLRGHTGW 380
                RGH   + S+            +  + + S D T+K+W    R C  TL GHT  
Sbjct: 221 YGDALRGHSKWITSLSWEPIHLVKPGDKPRLATASKDGTIKIWDTTRRVCLLTLCGHTSS 280

Query: 381 VNCVKLHPKSFTCFSGSDDMTIRMWDIRTN-TCVRVFHGHVGQVQKVIPLTLGSDLIEXX 439
           V+CVK   K+   +SGS D TIR WD+  N  C+ +   H   V     L+L +D     
Sbjct: 281 VSCVKWGGKNV-LYSGSHDKTIRCWDMNLNGKCINILKSHAHWVNH---LSLSTDYALRL 336

Query: 440 XXXXXXXXXXXXXXXXSVQA-ANFDHSLP----YPTHLLSCSLDNTIKLWN-VKTGACIR 493
                             +A  N++        +   +++ S D T+ LWN +K+   I 
Sbjct: 337 GAFDHKGETPASPEEAQQKALKNYEKVAKRKGDFEELMVTASDDFTMYLWNPLKSTKPIT 396

Query: 494 TQFGHVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPV 542
              GH + V  +A   D   IVS S D S K+WD + GK + TF G  A V
Sbjct: 397 RMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFLSTFRGHVASV 447

 Score = 80.5 bits (197), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 77/285 (27%), Positives = 123/285 (43%), Gaps = 38/285 (13%)

Query: 274 TGSYDSTVAIWDLATGKLI-RRLSGHTDGVKALRF---------DDQKLITGSLDKTIRV 323
           TGS D+T+ +W+ + GK     L GH+  + +L +         D  +L T S D TI++
Sbjct: 203 TGSMDNTIRLWESSKGKPYGDALRGHSKWITSLSWEPIHLVKPGDKPRLATASKDGTIKI 262

Query: 324 WNYVTGACVSTYRGHQDSVLSVD-SFRKLIVSGSADKTVKVW--HVESRTCYTLRGHTGW 380
           W+     C+ T  GH  SV  V    + ++ SGS DKT++ W  ++  +    L+ H  W
Sbjct: 263 WDTTRRVCLLTLCGHTSSVSCVKWGGKNVLYSGSHDKTIRCWDMNLNGKCINILKSHAHW 322

Query: 381 VNCVKLHPKSFTCFSGSDDMTIRM--WDIRTNTCVRVFHGH---VGQVQKVIP------- 428
           VN + L          S D  +R+  +D +  T           +   +KV         
Sbjct: 323 VNHLSL----------STDYALRLGAFDHKGETPASPEEAQQKALKNYEKVAKRKGDFEE 372

Query: 429 -LTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVK 487
            +   SD                       +  N     P   +++S S DN+IKLW+ +
Sbjct: 373 LMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGR 432

Query: 488 TGACIRTQFGHVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQTGK 530
            G  + T  GHV  V+ +A  +D   +VS S D + KVWD++T K
Sbjct: 433 DGKFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRK 477

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 78/298 (26%), Positives = 116/298 (38%), Gaps = 84/298 (28%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK-LITGSLDKTIRVWNY-VTGAC 331
           T S D T+ IWD      +  L GHT  V  +++  +  L +GS DKTIR W+  + G C
Sbjct: 253 TASKDGTIKIWDTTRRVCLLTLCGHTSSVSCVKWGGKNVLYSGSHDKTIRCWDMNLNGKC 312

Query: 332 VSTYRGHQDSV----LSVD-------------------------------------SFRK 350
           ++  + H   V    LS D                                      F +
Sbjct: 313 INILKSHAHWVNHLSLSTDYALRLGAFDHKGETPASPEEAQQKALKNYEKVAKRKGDFEE 372

Query: 351 LIVSGSADKTVKVWHV--ESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIR 408
           L+V+ S D T+ +W+    ++    + GH   VN V   P      S S D +I++WD R
Sbjct: 373 LMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGR 432

Query: 409 TNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPY 468
               +  F GHV  V +V                                A + D  L  
Sbjct: 433 DGKFLSTFRGHVASVYQV--------------------------------AWSSDCRL-- 458

Query: 469 PTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVW--DIAADNFRIVSGSHDRSCKVW 524
              L+SCS D T+K+W+VKT        GH + V+  D + D  R+ SG  D+  ++W
Sbjct: 459 ---LVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 78/190 (41%), Gaps = 38/190 (20%)

Query: 352 IVSGSADKTVKVWHVESRT-CYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWD-IRT 409
           +V+G+ D T  +W  +++T   TL+GH  WV C    P      +GS D TIR+W+  + 
Sbjct: 159 MVTGAGDNTACIWDCDTQTRMCTLQGHHNWVLCCSWSPDGELIATGSMDNTIRLWESSKG 218

Query: 410 NTCVRVFHGHVGQVQKVI--PLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLP 467
                   GH   +  +   P+ L                         V+  +      
Sbjct: 219 KPYGDALRGHSKWITSLSWEPIHL-------------------------VKPGD------ 247

Query: 468 YPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFRIV-SGSHDRSCKVWDL 526
               L + S D TIK+W+     C+ T  GH   V  +      ++ SGSHD++ + WD+
Sbjct: 248 -KPRLATASKDGTIKIWDTTRRVCLLTLCGHTSSVSCVKWGGKNVLYSGSHDKTIRCWDM 306

Query: 527 Q-TGKCMHTF 535
              GKC++  
Sbjct: 307 NLNGKCINIL 316

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 4/79 (5%)

Query: 252 IQEFKGHMDGVXXXXXXX--XXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF-- 307
           +  F+GH+  V             + S D+T+ +WD+ T KL   L GH D V  + +  
Sbjct: 437 LSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSV 496

Query: 308 DDQKLITGSLDKTIRVWNY 326
           D +++ +G  DK +R+W +
Sbjct: 497 DGKRVCSGGKDKMVRIWTH 515

 Score = 37.4 bits (85), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 37/83 (44%), Gaps = 10/83 (12%)

Query: 476 SLDNTIKLWNVKTGACIRTQF-GHVEGVWDIA---------ADNFRIVSGSHDRSCKVWD 525
           S+DNTI+LW    G        GH + +  ++          D  R+ + S D + K+WD
Sbjct: 205 SMDNTIRLWESSKGKPYGDALRGHSKWITSLSWEPIHLVKPGDKPRLATASKDGTIKIWD 264

Query: 526 LQTGKCMHTFVGIHAPVACVGIG 548
                C+ T  G  + V+CV  G
Sbjct: 265 TTRRVCLLTLCGHTSSVSCVKWG 287

>KLLA0D04840g 413362..414273 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8 required for
           transport of permeases from the golgi to the plasma
           membrane, start by similarity
          Length = 303

 Score = 92.4 bits (228), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 78/296 (26%), Positives = 122/296 (41%), Gaps = 20/296 (6%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF-DDQKLITGSLDKTIRVWNYVTGAC- 331
           +  YD T+  W+  TG   R +      V  L    D+K +  +    +R+++  +    
Sbjct: 7   SAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKKYLAAAGHLHVRLYDIRSNNPN 66

Query: 332 -VSTYRGHQDSVLSV--DSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHP 388
            VS++ GH+ +V S+      + +VS S D T+KVW V S +      H   VN V +HP
Sbjct: 67  PVSSFEGHKGNVTSIAFQQENRWMVSSSEDGTIKVWDVRSPSVQRNYKHNAPVNEVAIHP 126

Query: 389 KSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQ-VQKVIPLTLGSDLIEXXXXXXXXXX 447
                 S   D  IR+WD+  N C           +Q +   + GS L+           
Sbjct: 127 NQGELISCDQDGNIRIWDLGENQCTNQLTPEDNTPLQSLSVASDGSMLVAGNNKGNCYVW 186

Query: 448 XXXXXXXXSV--QAANFDHSLPYPT---------HLLSCSLDNTIKLWNVKTGACIRTQF 496
                   S       F     Y T         HL +CS D+T ++WN++    + T  
Sbjct: 187 KMPHHTDASTLEPVTKFKSHTKYITRVLLSADVKHLATCSADHTARVWNIEDNFELETTL 246

Query: 497 -GHVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGIGD 549
            GH   VWD A  AD+  +V+   D   ++WDL T + +  + G H    CV + D
Sbjct: 247 DGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTSEIVRQYGGHHKGAVCVALND 302

 Score = 48.9 bits (115), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 88/225 (39%), Gaps = 51/225 (22%)

Query: 312 LITGSLDKTIRVWNYVTGACVSTYRGHQDSV---LSVDSFRKLIVSGSADKTVKVWHVES 368
           L +   D TIR W  +TG C  T + H DS    L + S +K + + +    V+++ + S
Sbjct: 5   LASAGYDHTIRFWEALTGVCSRTIQ-HADSQVNRLEITSDKKYL-AAAGHLHVRLYDIRS 62

Query: 369 RT---CYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQK 425
                  +  GH G V  +    ++    S S+D TI++WD+R+ +  R +  H   V +
Sbjct: 63  NNPNPVSSFEGHKGNVTSIAFQQENRWMVSSSEDGTIKVWDVRSPSVQRNY-KHNAPVNE 121

Query: 426 VIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWN 485
           V                                        P    L+SC  D  I++W+
Sbjct: 122 VAI-------------------------------------HPNQGELISCDQDGNIRIWD 144

Query: 486 VKTGACIRTQFGHVEGV----WDIAADNFRIVSGSHDRSCKVWDL 526
           +    C   Q    +        +A+D   +V+G++  +C VW +
Sbjct: 145 LGENQCTN-QLTPEDNTPLQSLSVASDGSMLVAGNNKGNCYVWKM 188

>KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces
           cerevisiae YBR198c TAF90 TFIID and SAGA subunit, start
           by similarity
          Length = 826

 Score = 95.9 bits (237), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 84/285 (29%), Positives = 121/285 (42%), Gaps = 80/285 (28%)

Query: 275 GSYDSTVAIWDLATGKLIR-------------RLSGHTDGVKALRF--DDQKLITGSLDK 319
           G  DST+ +W L    L                L GH+  V ++ F  D++ L++ S DK
Sbjct: 516 GFQDSTIKVWYLDGSPLQSILPSKAKDQSNSATLVGHSGPVYSVAFSPDNRYLLSASEDK 575

Query: 320 TIRVWNYVTGACVSTYRGHQDSVLSVDSFRKL---IVSGSADKTVKVWHVESRTCYTLR- 375
           T+R+W+  T  C+  Y+GH   V  V  F  L    ++ S D+T ++W  +    Y LR 
Sbjct: 576 TVRLWSLDTFTCLVCYKGHNHPVWYV-KFSPLGHYFITASHDQTARLWSCDH--IYPLRI 632

Query: 376 --GHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQ--KVIP--- 428
             GH   V+C   HP     F+GS D T RMWDI+T   VR+F GH   V   +V P   
Sbjct: 633 FSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGR 692

Query: 429 -LTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVK 487
            LT GS+                                           D TI +W++ 
Sbjct: 693 WLTTGSE-------------------------------------------DGTIIVWDIG 709

Query: 488 TGACIRTQFGHVEGVWDIAADNFR-----IVSGSHDRSCKVWDLQ 527
           TG  I+   GH  G   I +  F      +V+G  D+S +VWD++
Sbjct: 710 TGKRIKQMKGH--GKNPIYSITFNKEGNCLVTGGADQSVRVWDIK 752

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 66/252 (26%), Positives = 104/252 (41%), Gaps = 62/252 (24%)

Query: 308 DDQKLIT-GSLDKTIRVWNYVTGACV--------------STYRGHQDSVLSV--DSFRK 350
           DD +L   G  D TI+VW Y+ G+ +              +T  GH   V SV      +
Sbjct: 508 DDARLTAAGFQDSTIKVW-YLDGSPLQSILPSKAKDQSNSATLVGHSGPVYSVAFSPDNR 566

Query: 351 LIVSGSADKTVKVWHVESRTCYT-LRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRT 409
            ++S S DKTV++W +++ TC    +GH   V  VK  P      + S D T R+W    
Sbjct: 567 YLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQTARLWSCDH 626

Query: 410 NTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYP 469
              +R+F GH+  V                                       D S  +P
Sbjct: 627 IYPLRIFSGHLNDV---------------------------------------DCSTFHP 647

Query: 470 T--HLLSCSLDNTIKLWNVKTGACIRTQFGHVEGV--WDIAADNFRIVSGSHDRSCKVWD 525
              ++ + S D T ++W+++TG  +R   GH   V   +++ D   + +GS D +  VWD
Sbjct: 648 NGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGRWLTTGSEDGTIIVWD 707

Query: 526 LQTGKCMHTFVG 537
           + TGK +    G
Sbjct: 708 IGTGKRIKQMKG 719

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 60/252 (23%), Positives = 102/252 (40%), Gaps = 64/252 (25%)

Query: 320 TIRVWNYVTGA---CVSTYRGHQDSVLSVD--SFRKLIVSGSADKTVKVWHVE------- 367
           +I++ N  T A   C+ T+     ++  V+     +L  +G  D T+KVW+++       
Sbjct: 476 SIQLKNLQTSAPSVCMYTFHNTNGNMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSI 535

Query: 368 -------SRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHV 420
                       TL GH+G V  V   P +    S S+D T+R+W + T TC+  + GH 
Sbjct: 536 LPSKAKDQSNSATLVGHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHN 595

Query: 421 GQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNT 480
             V  V    LG                                      + ++ S D T
Sbjct: 596 HPVWYVKFSPLGH-------------------------------------YFITASHDQT 618

Query: 481 IKLWNVKTGACIRTQFGHVEGVWDIAADNFR-----IVSGSHDRSCKVWDLQTGKCMHTF 535
            +LW+      +R   GH+    D+    F      + +GS D++C++WD+QTG  +  F
Sbjct: 619 ARLWSCDHIYPLRIFSGHLN---DVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLF 675

Query: 536 VGIHAPVACVGI 547
           +G  +PV  + +
Sbjct: 676 LGHTSPVTALEV 687

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 88/195 (45%), Gaps = 28/195 (14%)

Query: 249 IYRIQEFKGHMDGVXXXXXXXX--XXXTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALR 306
           IY ++ F GH++ V             TGS D T  +WD+ TG  +R   GHT  V AL 
Sbjct: 627 IYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALE 686

Query: 307 F--DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRK---LIVSGSADKTV 361
              D + L TGS D TI VW+  TG  +   +GH  + +   +F K    +V+G AD++V
Sbjct: 687 VSPDGRWLTTGSEDGTIIVWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSV 746

Query: 362 KVWHVESRTCYTLRGHTGWVNCVKLHP-KSFTCFSGSDDMTI---------RMWDIRTNT 411
           +VW ++            + N   + P + F  +SG  ++++         R   I T  
Sbjct: 747 RVWDIKR-----------FTNEPGMEPEQQFNTYSGDMELSVNNDIKEFGRRRAVIPTQD 795

Query: 412 CVRVFHGHVGQVQKV 426
            +  FH     + KV
Sbjct: 796 LMASFHTKKTAIHKV 810

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 73/152 (48%), Gaps = 7/152 (4%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDD--QKLITGSLDKTIRVWNYVTGAC 331
           + S D TV +W L T   +    GH   V  ++F       IT S D+T R+W+      
Sbjct: 570 SASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQTARLWSCDHIYP 629

Query: 332 VSTYRGHQDSVLSVDSFRK---LIVSGSADKTVKVWHVESRTCYTL-RGHTGWVNCVKLH 387
           +  + GH + V    +F      + +GS+DKT ++W +++     L  GHT  V  +++ 
Sbjct: 630 LRIFSGHLNDV-DCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVS 688

Query: 388 PKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGH 419
           P      +GS+D TI +WDI T   ++   GH
Sbjct: 689 PDGRWLTTGSEDGTIIVWDIGTGKRIKQMKGH 720

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 67/141 (47%), Gaps = 6/141 (4%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGAC 331
           T S+D T  +W       +R  SGH + V    F      + TGS DKT R+W+  TG  
Sbjct: 612 TASHDQTARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDS 671

Query: 332 VSTYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWHVES-RTCYTLRGH-TGWVNCVKLH 387
           V  + GH   V  L V    + + +GS D T+ VW + + +    ++GH    +  +  +
Sbjct: 672 VRLFLGHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGTGKRIKQMKGHGKNPIYSITFN 731

Query: 388 PKSFTCFSGSDDMTIRMWDIR 408
            +     +G  D ++R+WDI+
Sbjct: 732 KEGNCLVTGGADQSVRVWDIK 752

>Sklu_2173.2 YCR072C, Contig c2173 2732-4279
          Length = 515

 Score = 94.0 bits (232), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 91/315 (28%), Positives = 133/315 (42%), Gaps = 66/315 (20%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGAC 331
           TG+ D+T  IWD  T   +  L GH + V  + +  D + + TGS+D TIR+W    G  
Sbjct: 161 TGAGDNTARIWDCNTQTPMSTLKGHFNWVLCVSWSPDGELIATGSMDNTIRLWEGNKGQP 220

Query: 332 VS-TYRGHQDSVLSVD---------SFRKLIVSGSADKTVKVWHVESRTCY-TLRGHTGW 380
           V    RGH   + S+            +  + S S D T+K+W    R C  TL GHT  
Sbjct: 221 VGDALRGHGKWITSLSWEPIHLVKPGQKPRLASASKDGTIKIWDTTRRVCLITLSGHTSS 280

Query: 381 VNCVKLHPKSFTCFSGSDDMTIRMWDIRT-NTCVRVFHGHVGQVQKVIPLTLGSDLIEXX 439
           V+C+K   +    +SGS D TIR WD+     C+ +   H   V     L+L +D     
Sbjct: 281 VSCIKWGGQGV-LYSGSHDKTIRAWDMNLGGKCINILKSHAHWVNH---LSLSTDY---- 332

Query: 440 XXXXXXXXXXXXXXXXSVQAANFDHSLPYPTH-------------------------LLS 474
                           +++   FDH+   P+                          +++
Sbjct: 333 ----------------ALRIGAFDHTSEKPSTPEEAQKRALKNYEKIAKRNGEVEELMVT 376

Query: 475 CSLDNTIKLWN-VKTGACIRTQFGHVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQTGKC 531
            S D T+ LWN +K+   I    GH + V  +A   D   IVS S D S K+W+ + GK 
Sbjct: 377 ASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWNGRDGKF 436

Query: 532 MHTFVGIHAPVACVG 546
           + TF G  A V  V 
Sbjct: 437 ISTFRGHVASVYQVA 451

 Score = 84.7 bits (208), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 75/278 (26%), Positives = 122/278 (43%), Gaps = 24/278 (8%)

Query: 274 TGSYDSTVAIWDLATGKLI-RRLSGHTDGVKALRFD---------DQKLITGSLDKTIRV 323
           TGS D+T+ +W+   G+ +   L GH   + +L ++           +L + S D TI++
Sbjct: 203 TGSMDNTIRLWEGNKGQPVGDALRGHGKWITSLSWEPIHLVKPGQKPRLASASKDGTIKI 262

Query: 324 WNYVTGACVSTYRGHQDSVLSVD-SFRKLIVSGSADKTVKVW--HVESRTCYTLRGHTGW 380
           W+     C+ T  GH  SV  +    + ++ SGS DKT++ W  ++  +    L+ H  W
Sbjct: 263 WDTTRRVCLITLSGHTSSVSCIKWGGQGVLYSGSHDKTIRAWDMNLGGKCINILKSHAHW 322

Query: 381 VNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHV------GQVQKVIPLTLGSD 434
           VN + L    +    G+ D T            R    +       G+V+++  +   SD
Sbjct: 323 VNHLSLS-TDYALRIGAFDHTSEKPSTPEEAQKRALKNYEKIAKRNGEVEEL--MVTASD 379

Query: 435 LIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRT 494
                                  +  N     P   H++S S DN+IKLWN + G  I T
Sbjct: 380 DFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWNGRDGKFIST 439

Query: 495 QFGHVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQTGK 530
             GHV  V+ +A  +D   +VS S D + KVWD++T K
Sbjct: 440 FRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTKK 477

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 76/298 (25%), Positives = 117/298 (39%), Gaps = 84/298 (28%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK-LITGSLDKTIRVWNY-VTGAC 331
           + S D T+ IWD      +  LSGHT  V  +++  Q  L +GS DKTIR W+  + G C
Sbjct: 253 SASKDGTIKIWDTTRRVCLITLSGHTSSVSCIKWGGQGVLYSGSHDKTIRAWDMNLGGKC 312

Query: 332 VSTYRGH----------QDSVLSVDSF-------------------------------RK 350
           ++  + H           D  L + +F                                +
Sbjct: 313 INILKSHAHWVNHLSLSTDYALRIGAFDHTSEKPSTPEEAQKRALKNYEKIAKRNGEVEE 372

Query: 351 LIVSGSADKTVKVWHV--ESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIR 408
           L+V+ S D T+ +W+    ++    + GH   VN V   P      S S D +I++W+ R
Sbjct: 373 LMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWNGR 432

Query: 409 TNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPY 468
               +  F GHV  V +V                                A + D  L  
Sbjct: 433 DGKFISTFRGHVASVYQV--------------------------------AWSSDCRL-- 458

Query: 469 PTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVW--DIAADNFRIVSGSHDRSCKVW 524
              L+SCS D T+K+W+VKT        GH + V+  D + D  R+ SG  D+  ++W
Sbjct: 459 ---LVSCSKDTTLKVWDVKTKKLAVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 76/188 (40%), Gaps = 34/188 (18%)

Query: 352 IVSGSADKTVKVWHVESRT-CYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTN 410
           +++G+ D T ++W   ++T   TL+GH  WV CV   P      +GS D TIR+W+    
Sbjct: 159 MITGAGDNTARIWDCNTQTPMSTLKGHFNWVLCVSWSPDGELIATGSMDNTIRLWEGNKG 218

Query: 411 TCV-RVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYP 469
             V     GH   +  +                             S +  +       P
Sbjct: 219 QPVGDALRGHGKWITSL-----------------------------SWEPIHLVKPGQKP 249

Query: 470 THLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA-ADNFRIVSGSHDRSCKVWDLQT 528
             L S S D TIK+W+     C+ T  GH   V  I       + SGSHD++ + WD+  
Sbjct: 250 -RLASASKDGTIKIWDTTRRVCLITLSGHTSSVSCIKWGGQGVLYSGSHDKTIRAWDMNL 308

Query: 529 -GKCMHTF 535
            GKC++  
Sbjct: 309 GGKCINIL 316

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/192 (21%), Positives = 69/192 (35%), Gaps = 48/192 (25%)

Query: 368 SRTCYTLRGHTGWVNCVKLHP-KSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKV 426
           +R+   + GH   + C    P  S    +G+ D T R+WD  T T +    GH   V   
Sbjct: 133 TRSSSAIAGHGSTILCSAFAPHTSSRMITGAGDNTARIWDCNTQTPMSTLKGHFNWVL-C 191

Query: 427 IPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNV 486
           +  +   +LI                                     + S+DNTI+LW  
Sbjct: 192 VSWSPDGELIA------------------------------------TGSMDNTIRLWEG 215

Query: 487 KTGACIRTQF-GHVEGVWDIAADNF---------RIVSGSHDRSCKVWDLQTGKCMHTFV 536
             G  +     GH + +  ++ +           R+ S S D + K+WD     C+ T  
Sbjct: 216 NKGQPVGDALRGHGKWITSLSWEPIHLVKPGQKPRLASASKDGTIKIWDTTRRVCLITLS 275

Query: 537 GIHAPVACVGIG 548
           G  + V+C+  G
Sbjct: 276 GHTSSVSCIKWG 287

>YBR198C (TAF5) [381] chr2 complement(616084..618480) Component of
           the TAF(II) complex (TBP-associated protein complex) and
           SAGA complex (Spt-Ada-Gcn5-acetyltransferase), required
           for activated transcription by RNA polymerase II, member
           of WD (WD-40) repeat family [2397 bp, 798 aa]
          Length = 798

 Score = 94.7 bits (234), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 77/281 (27%), Positives = 115/281 (40%), Gaps = 68/281 (24%)

Query: 275 GSYDSTVAIWDLATGKLI-----------------RRLSGHTDGVKALRF--DDQKLITG 315
           G  DS + IW L    L                  + L GH+  V +  F  D++ L++G
Sbjct: 484 GFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHSGTVYSTSFSPDNKYLLSG 543

Query: 316 SLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKL---IVSGSADKTVKVWHVESRTCY 372
           S DKT+R+W+  T   + +Y+GH   V  V SF  L     + S D+T ++W  +    Y
Sbjct: 544 SEDKTVRLWSMDTHTALVSYKGHNHPVWDV-SFSPLGHYFATASHDQTARLWSCDH--IY 600

Query: 373 TLR---GHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPL 429
            LR   GH   V+CV  HP     F+GS D T RMWD+ T   VR+F GH   V  +   
Sbjct: 601 PLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIA-- 658

Query: 430 TLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTG 489
                                                P    L + S D  I +W++ TG
Sbjct: 659 -----------------------------------VCPDGRWLSTGSEDGIINVWDIGTG 683

Query: 490 ACIRTQFGHVEGV---WDIAADNFRIVSGSHDRSCKVWDLQ 527
             ++   GH +        + +   ++SG  D + +VWDL+
Sbjct: 684 KRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLK 724

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 84/218 (38%), Gaps = 57/218 (26%)

Query: 350 KLIVSGSADKTVKVWHV------------------ESRTCYTLRGHTGWVNCVKLHPKSF 391
           ++  +G  D  +K+W +                  E  TC TL GH+G V      P + 
Sbjct: 479 RIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHSGTVYSTSFSPDNK 538

Query: 392 TCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXX 451
              SGS+D T+R+W + T+T +  + GH   V  V    LG                   
Sbjct: 539 YLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGH------------------ 580

Query: 452 XXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGV--WDIAADN 509
                              +  + S D T +LW+      +R   GH+  V       + 
Sbjct: 581 -------------------YFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNG 621

Query: 510 FRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGI 547
             + +GS D++C++WD+ TG  +  F+G  APV  + +
Sbjct: 622 CYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAV 659

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 67/130 (51%), Gaps = 7/130 (5%)

Query: 249 IYRIQEFKGHMDGVXXXXXXXX--XXXTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALR 306
           IY ++ F GH++ V             TGS D T  +WD++TG  +R   GHT  V ++ 
Sbjct: 599 IYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIA 658

Query: 307 F--DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRK---LIVSGSADKTV 361
              D + L TGS D  I VW+  TG  +   RGH  + +   S+ K   +++SG AD TV
Sbjct: 659 VCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTV 718

Query: 362 KVWHVESRTC 371
           +VW ++  T 
Sbjct: 719 RVWDLKKATT 728

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 75/166 (45%), Gaps = 12/166 (7%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGAC 331
           T S+D T  +W       +R  +GH + V  + F      + TGS DKT R+W+  TG  
Sbjct: 584 TASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDS 643

Query: 332 VSTYRGHQDSVLSVD--SFRKLIVSGSADKTVKVWHVES-RTCYTLRGH-TGWVNCVKLH 387
           V  + GH   V+S+      + + +GS D  + VW + + +    +RGH    +  +   
Sbjct: 644 VRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYS 703

Query: 388 PKSFTCFSGSDDMTIRMWDIRTNTCV------RVFHGHVGQVQKVI 427
            +     SG  D T+R+WD++  T          F G++G V   I
Sbjct: 704 KEGNVLISGGADHTVRVWDLKKATTEPSAEPDEPFIGYLGDVTASI 749

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 70/152 (46%), Gaps = 7/152 (4%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDD--QKLITGSLDKTIRVWNYVTGAC 331
           +GS D TV +W + T   +    GH   V  + F        T S D+T R+W+      
Sbjct: 542 SGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYP 601

Query: 332 VSTYRGHQDSVLSVDSFRK---LIVSGSADKTVKVWHVESRTCYTL-RGHTGWVNCVKLH 387
           +  + GH + V  V SF      + +GS+DKT ++W V +     L  GHT  V  + + 
Sbjct: 602 LRIFAGHLNDVDCV-SFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVC 660

Query: 388 PKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGH 419
           P      +GS+D  I +WDI T   ++   GH
Sbjct: 661 PDGRWLSTGSEDGIINVWDIGTGKRLKQMRGH 692

>YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741)
           Coatomer (COPI) complex beta' chain (beta'-COP) of
           secretory pathway vesicles, required for retrograde
           transport from Golgi to endoplasmic reticulum, member of
           the WD (WD-40) repeat family [2670 bp, 889 aa]
          Length = 889

 Score = 94.4 bits (233), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 80/276 (28%), Positives = 127/276 (46%), Gaps = 44/276 (15%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGAC 331
           T  Y   V +W+  T   +R +      V+A +F  +K  +I GS D  IRV+NY TG  
Sbjct: 30  TTLYSGRVELWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEK 89

Query: 332 VSTYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWHVESRTCY--TLRGHTGWVNCVKLH 387
           V  +  H D +  ++V   +  ++SGS D TVK+W+ E+      T  GH  +V CV  +
Sbjct: 90  VVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFN 149

Query: 388 PKSFTCF-SGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXX 446
           PK  + F SG  D T+++W +             GQ      LT G +            
Sbjct: 150 PKDPSTFASGCLDRTVKVWSL-------------GQSTPNFTLTTGQE------------ 184

Query: 447 XXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGV-WDI 505
                     V   ++ + LP   ++++ S D TIK+W+ +T +C+ T  GH+  V + +
Sbjct: 185 --------RGVNYVDY-YPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAV 235

Query: 506 AADNFR-IVSGSHDRSCKVWDLQTGKCMHTF-VGIH 539
                  I+SGS D + K+W+  T K   T  VG+ 
Sbjct: 236 FHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLE 271

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 55/186 (29%), Positives = 79/186 (42%), Gaps = 26/186 (13%)

Query: 244 NWRKGIYRIQEFKGHMDGVXXXXXXXXXXXT---GSYDSTVAIWDLATGKLIRRLS-GHT 299
           NW       Q F+GH   V           T   G  D TV +W L        L+ G  
Sbjct: 125 NWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQE 184

Query: 300 DGVKALRF----DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFR---KLI 352
            GV  + +    D   +IT S D TI++W+Y T +CV+T  GH  +V S   F     +I
Sbjct: 185 RGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNV-SFAVFHPTLPII 243

Query: 353 VSGSADKTVKVWHVES-RTCYTLRGHTGWVNCVKLHP------------KSFTCFS-GSD 398
           +SGS D T+K+W+  + +   TL        C+  HP              FT  S G+D
Sbjct: 244 ISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSLGND 303

Query: 399 DMTIRM 404
           + T+ +
Sbjct: 304 EPTLSL 309

>CAGL0M05335g complement(569132..571552) similar to sp|P38129
           Saccharomyces cerevisiae YBR198c Transcription
           initiation factor TFIID 90, hypothetical start
          Length = 806

 Score = 94.4 bits (233), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 83/284 (29%), Positives = 115/284 (40%), Gaps = 69/284 (24%)

Query: 275 GSYDSTVAIWDLATGKLIR------------------RLSGHTDGVKALRF--DDQKLIT 314
           G  DS + IW L    LI                    L GH+  V +  F  D+  L++
Sbjct: 491 GFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCSTLVGHSGTVYSTSFSPDNMYLVS 550

Query: 315 GSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKL---IVSGSADKTVKVWHVESRTC 371
           GS DKT+++W+  T   +  Y+GH   V  V  F  L     S S D+T ++W  +    
Sbjct: 551 GSEDKTVKLWSMDTHTALVNYKGHNHPVWDV-KFSPLGHYFASASHDQTARLWACDH--I 607

Query: 372 YTLR---GHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIP 428
           Y LR   GHT  V+ V  HP     F+GS D T RMWD+ T   VR+F GH   V     
Sbjct: 608 YPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPV----- 662

Query: 429 LTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKT 488
                                      S Q +      P    L + S D  I LW++ T
Sbjct: 663 --------------------------LSTQVS------PDGRWLATGSEDGVICLWDIGT 690

Query: 489 GACIRTQFGHVEGVWDIAADNFR---IVSGSHDRSCKVWDLQTG 529
           G  I+   GH +      + N     ++SG  D S +VWD++ G
Sbjct: 691 GKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDVKHG 734

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 51/214 (23%), Positives = 82/214 (38%), Gaps = 58/214 (27%)

Query: 350 KLIVSGSADKTVKVWHV-------------------ESRTCYTLRGHTGWVNCVKLHPKS 390
           +L  +G  D  +K+W +                   +  TC TL GH+G V      P +
Sbjct: 486 RLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCSTLVGHSGTVYSTSFSPDN 545

Query: 391 FTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXX 450
               SGS+D T+++W + T+T +  + GH   V  V    LG                  
Sbjct: 546 MYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGH----------------- 588

Query: 451 XXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA--AD 508
                               +  S S D T +LW       +R   GH   V  ++   +
Sbjct: 589 --------------------YFASASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPN 628

Query: 509 NFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPV 542
              + +GS D++C++WD+ TG  +  F+G  APV
Sbjct: 629 GCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPV 662

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 79/166 (47%), Gaps = 12/166 (7%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGAC 331
           + S+D T  +W       +R  +GHT+ V  + F      + TGS DKT R+W+  TG  
Sbjct: 592 SASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDS 651

Query: 332 VSTYRGHQDSVLS--VDSFRKLIVSGSADKTVKVWHVES-RTCYTLRGH-TGWVNCVKLH 387
           V  + GH   VLS  V    + + +GS D  + +W + + +    +RGH    V+ +  +
Sbjct: 652 VRLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFN 711

Query: 388 PKSFTCFSGSDDMTIRMWDIRTNTC------VRVFHGHVGQVQKVI 427
            +     SG  D ++R+WD++  T        + F+ HVG +   I
Sbjct: 712 KEGNVLISGGADHSVRVWDVKHGTTEQGPEPEQPFNAHVGDITASI 757

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 60/211 (28%), Positives = 85/211 (40%), Gaps = 44/211 (20%)

Query: 333 STYRGHQDSVLSVDSFRK---LIVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHP 388
           ST  GH  +V S  SF      +VSGS DKTVK+W +++ T     +GH   V  VK  P
Sbjct: 527 STLVGHSGTVYST-SFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSP 585

Query: 389 KSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXX 448
                 S S D T R+W       +R+F GH   V  V                      
Sbjct: 586 LGHYFASASHDQTARLWACDHIYPLRIFAGHTNDVDTV---------------------- 623

Query: 449 XXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWD--IA 506
                       +F    P   ++ + S D T ++W+V TG  +R   GH   V    ++
Sbjct: 624 ------------SFH---PNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVS 668

Query: 507 ADNFRIVSGSHDRSCKVWDLQTGKCMHTFVG 537
            D   + +GS D    +WD+ TGK +    G
Sbjct: 669 PDGRWLATGSEDGVICLWDIGTGKRIKQMRG 699

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 66/130 (50%), Gaps = 7/130 (5%)

Query: 249 IYRIQEFKGHMDGVXXXXXXXX--XXXTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALR 306
           IY ++ F GH + V             TGS D T  +WD++TG  +R   GHT  V + +
Sbjct: 607 IYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQ 666

Query: 307 F--DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRK---LIVSGSADKTV 361
              D + L TGS D  I +W+  TG  +   RGH  + +   SF K   +++SG AD +V
Sbjct: 667 VSPDGRWLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSV 726

Query: 362 KVWHVESRTC 371
           +VW V+  T 
Sbjct: 727 RVWDVKHGTT 736

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 71/152 (46%), Gaps = 7/152 (4%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDD--QKLITGSLDKTIRVWNYVTGAC 331
           +GS D TV +W + T   +    GH   V  ++F        + S D+T R+W       
Sbjct: 550 SGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFASASHDQTARLWACDHIYP 609

Query: 332 VSTYRGHQDSVLSVDSFRK---LIVSGSADKTVKVWHVESRTCYTL-RGHTGWVNCVKLH 387
           +  + GH + V +V SF      + +GS+DKT ++W V +     L  GHT  V   ++ 
Sbjct: 610 LRIFAGHTNDVDTV-SFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVS 668

Query: 388 PKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGH 419
           P      +GS+D  I +WDI T   ++   GH
Sbjct: 669 PDGRWLATGSEDGVICLWDIGTGKRIKQMRGH 700

>Scas_695.15
          Length = 327

 Score = 91.3 bits (225), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 85/301 (28%), Positives = 133/301 (44%), Gaps = 26/301 (8%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF-DDQKLITGSLDKTIRVWNYVTGA-- 330
           +  YD T+  W+  TG   R +      V  L   +D+KL+  +  + +R+++  T    
Sbjct: 27  SAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAAAGYQNVRLYDIRTTNPN 86

Query: 331 CVSTYRGHQDSVLSVDSFR---KLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLH 387
            V+T+ GH+ +V SV SF+   K +V+ S D T+KVW V S +      H   VN V +H
Sbjct: 87  AVATFEGHKGNVTSV-SFQQDNKWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVIH 145

Query: 388 PKSFTCFSGSDDMTIRMWDIRTNTCVR--VFHGHVGQVQKVIPLTLGSDLIEXXXXXXXX 445
           P      S   D TI++WD+  N C    +       +Q +   + GS L+         
Sbjct: 146 PNQGELISCDRDGTIKIWDLGENQCTHQLIPDDDNTSLQSLSVASDGSMLVAANNKGDCY 205

Query: 446 XXXXXXXXXXS-VQAAN-FDHSLPYPT---------HLLSCSLDNTIKLWNV---KTGAC 491
                     S ++  N F     Y T         H+ +CS D T K+W+V   +    
Sbjct: 206 VWEMPNHTDASNLKPINKFSAHKDYITRVVLSSDVKHMATCSADRTAKIWSVGETEDDFN 265

Query: 492 IRTQF-GHVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGIG 548
           + T   GH   VWD A  AD+  +V+ S D   ++WDL T + +  + G H    CV + 
Sbjct: 266 LETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALN 325

Query: 549 D 549
           D
Sbjct: 326 D 326

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 89/225 (39%), Gaps = 50/225 (22%)

Query: 312 LITGSLDKTIRVWNYVTGACVSTYRGHQDSV---LSVDSFRKLIVSGSADKTVKVWHVES 368
           L++   D TIR W  +TG C  T + H DS    L + + +KL+ +    + V+++ + +
Sbjct: 25  LVSAGYDHTIRFWEALTGVCSRTIQ-HSDSQVNRLEITNDKKLLAAAGY-QNVRLYDIRT 82

Query: 369 ---RTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQK 425
                  T  GH G V  V     +    + S+D TI++WD+R+ +  R +  H   V +
Sbjct: 83  TNPNAVATFEGHKGNVTSVSFQQDNKWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNE 141

Query: 426 VIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWN 485
           V+                                       P    L+SC  D TIK+W+
Sbjct: 142 VVI-------------------------------------HPNQGELISCDRDGTIKIWD 164

Query: 486 VKTGACIRTQFGHVEGV----WDIAADNFRIVSGSHDRSCKVWDL 526
           +    C        +        +A+D   +V+ ++   C VW++
Sbjct: 165 LGENQCTHQLIPDDDNTSLQSLSVASDGSMLVAANNKGDCYVWEM 209

>CAGL0J03476g 331933..333486 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 517

 Score = 93.2 bits (230), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 88/292 (30%), Positives = 128/292 (43%), Gaps = 28/292 (9%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGAC 331
           TG  D+T  IWD  T      L+GH + V  + +  D + + TGS+D TIR+W+  +G  
Sbjct: 163 TGGGDNTARIWDCDTQTPKVTLNGHRNWVLCVSWSADGEVIATGSMDNTIRLWDAESGKP 222

Query: 332 VS-TYRGHQDSVLSV---------DSFRKLIVSGSADKTVKVWHVESRTCY-TLRGHTGW 380
           +    RGH   + S+            +  + S S D T+++W    R C  TL GHT  
Sbjct: 223 LGDALRGHSKWITSLTWEPIHLVEPGSKPRLASASKDGTIRIWDSSRRVCLMTLGGHTNS 282

Query: 381 VNCVKLHPKSFTCFSGSDDMTIRMWDIRTN-TCVRVFHGHVGQVQKV-----IPLTLGS- 433
           V+CVK   +    +SGS D T+R WD++ N  C+ +   H   V  +       L +G+ 
Sbjct: 283 VSCVKWGGEGI-LYSGSHDKTVRAWDMKQNGKCINILKSHAHWVNHLSLSTDYALRVGAF 341

Query: 434 DLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWN-VKTGACI 492
           D                      V   N  H       +++ S D T+ LWN +K    I
Sbjct: 342 DYTGVKPANAKEARDKALQNYEKVARKNGKHE----ELMVTASDDFTMFLWNPLKGTKPI 397

Query: 493 RTQFGHVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPV 542
               GH + V  +A   D   IVS S D S K+WD + G  + TF G  A V
Sbjct: 398 SRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWDGKEGTFLSTFRGHVASV 449

 Score = 83.6 bits (205), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 78/280 (27%), Positives = 122/280 (43%), Gaps = 28/280 (10%)

Query: 274 TGSYDSTVAIWDLATGK-LIRRLSGHTDGVKALRFD---------DQKLITGSLDKTIRV 323
           TGS D+T+ +WD  +GK L   L GH+  + +L ++           +L + S D TIR+
Sbjct: 205 TGSMDNTIRLWDAESGKPLGDALRGHSKWITSLTWEPIHLVEPGSKPRLASASKDGTIRI 264

Query: 324 WNYVTGACVSTYRGHQDSVLSVD-SFRKLIVSGSADKTVKVWHVE--SRTCYTLRGHTGW 380
           W+     C+ T  GH +SV  V      ++ SGS DKTV+ W ++   +    L+ H  W
Sbjct: 265 WDSSRRVCLMTLGGHTNSVSCVKWGGEGILYSGSHDKTVRAWDMKQNGKCINILKSHAHW 324

Query: 381 VNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIP--------LTLG 432
           VN + L    +    G+ D T     ++           +   +KV          +   
Sbjct: 325 VNHLSLS-TDYALRVGAFDYT----GVKPANAKEARDKALQNYEKVARKNGKHEELMVTA 379

Query: 433 SDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACI 492
           SD                       +  N     P   +++S S DN+IKLW+ K G  +
Sbjct: 380 SDDFTMFLWNPLKGTKPISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWDGKEGTFL 439

Query: 493 RTQFGHVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQTGK 530
            T  GHV  V+ +A  +D   +VS S D + KVWD++T K
Sbjct: 440 STFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRK 479

 Score = 75.1 bits (183), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 74/298 (24%), Positives = 119/298 (39%), Gaps = 84/298 (28%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLI-TGSLDKTIRVWNYV-TGAC 331
           + S D T+ IWD +    +  L GHT+ V  +++  + ++ +GS DKT+R W+    G C
Sbjct: 255 SASKDGTIRIWDSSRRVCLMTLGGHTNSVSCVKWGGEGILYSGSHDKTVRAWDMKQNGKC 314

Query: 332 VSTYRGH----------QDSVLSVDSF-------------------------------RK 350
           ++  + H           D  L V +F                                +
Sbjct: 315 INILKSHAHWVNHLSLSTDYALRVGAFDYTGVKPANAKEARDKALQNYEKVARKNGKHEE 374

Query: 351 LIVSGSADKTVKVWHV--ESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIR 408
           L+V+ S D T+ +W+    ++    + GH   VN V   P      S S D +I++WD +
Sbjct: 375 LMVTASDDFTMFLWNPLKGTKPISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWDGK 434

Query: 409 TNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPY 468
             T +  F GHV  V +V                                A + D  L  
Sbjct: 435 EGTFLSTFRGHVASVYQV--------------------------------AWSSDCRL-- 460

Query: 469 PTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVW--DIAADNFRIVSGSHDRSCKVW 524
              L+SCS D T+K+W+VKT        GH + V+  D + D  R+ SG  D+  ++W
Sbjct: 461 ---LVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKMMRLW 515

 Score = 61.6 bits (148), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 58/124 (46%), Gaps = 11/124 (8%)

Query: 311 KLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVD--SFRKLIVSGSADKTVKVWHVES 368
           +++TG  D T R+W+  T     T  GH++ VL V   +  ++I +GS D T+++W  ES
Sbjct: 160 RVVTGGGDNTARIWDCDTQTPKVTLNGHRNWVLCVSWSADGEVIATGSMDNTIRLWDAES 219

Query: 369 RTCY--TLRGHTGWVNCVKLHPKSFT-------CFSGSDDMTIRMWDIRTNTCVRVFHGH 419
                  LRGH+ W+  +   P             S S D TIR+WD     C+    GH
Sbjct: 220 GKPLGDALRGHSKWITSLTWEPIHLVEPGSKPRLASASKDGTIRIWDSSRRVCLMTLGGH 279

Query: 420 VGQV 423
              V
Sbjct: 280 TNSV 283

 Score = 37.7 bits (86), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 41/192 (21%), Positives = 69/192 (35%), Gaps = 48/192 (25%)

Query: 368 SRTCYTLRGHTGWVNCVKLHP-KSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKV 426
           +R+   + GH   + C    P  S    +G  D T R+WD  T T     +GH   V   
Sbjct: 135 TRSSSAIAGHGATILCSAFAPHTSSRVVTGGGDNTARIWDCDTQTPKVTLNGHRNWVL-C 193

Query: 427 IPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNV 486
           +  +   ++I                                     + S+DNTI+LW+ 
Sbjct: 194 VSWSADGEVIA------------------------------------TGSMDNTIRLWDA 217

Query: 487 KTGACIRTQF-GHVEGVWDIAADNF---------RIVSGSHDRSCKVWDLQTGKCMHTFV 536
           ++G  +     GH + +  +  +           R+ S S D + ++WD     C+ T  
Sbjct: 218 ESGKPLGDALRGHSKWITSLTWEPIHLVEPGSKPRLASASKDGTIRIWDSSRRVCLMTLG 277

Query: 537 GIHAPVACVGIG 548
           G    V+CV  G
Sbjct: 278 GHTNSVSCVKWG 289

>AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)
           [1542 bp, 513 aa]
          Length = 513

 Score = 93.2 bits (230), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 88/291 (30%), Positives = 130/291 (44%), Gaps = 26/291 (8%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGV--KALRFDDQKLITGSLDKTIRVWNYVTGAC 331
           TG+ D+T  IWD  T   +  L GH++ V   A   D + + TGS+D TIR+W+   G  
Sbjct: 159 TGAGDNTARIWDCDTQTPLCTLKGHSNWVLCVAWSADGEVIATGSMDATIRLWDSEKGQS 218

Query: 332 VS-TYRGHQDSVLSVD---------SFRKLIVSGSADKTVKVWHVESRTC-YTLRGHTGW 380
           +    RGH   + S+            +  + S S D T+K+W    R C YTL GHT  
Sbjct: 219 LGDALRGHTKWITSLSWEPIHLVKPGEKPRLASASKDGTIKIWDTTRRVCIYTLSGHTSS 278

Query: 381 VNCVKLHPKSFTCFSGSDDMTIRMWDIRT-NTCVRVFHGHVGQVQKVIPLTLGSDLIEXX 439
           V+C+K   ++   +S S D T+R WD+     C+ +   H   V     L+L +D     
Sbjct: 279 VSCIKWGGRNV-LYSASHDRTVRCWDMAAGGKCINILKSHAHWVNH---LSLSTDYALRM 334

Query: 440 XXXXXXXXXXXXXXXXSVQAA-NFD----HSLPYPTHLLSCSLDNTIKLWN-VKTGACIR 493
                             +A  N++     +      +++ S D T+ LWN +K    I 
Sbjct: 335 GPFDHTGTKPASPEDAQARALRNYEKVAKKNGTMEELMVTGSDDFTMYLWNPLKGSKPIL 394

Query: 494 TQFGHVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPV 542
              GH + V  +A   D   IVS S D S K+WD + GK + TF G  A V
Sbjct: 395 RMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFIATFRGHVASV 445

 Score = 83.6 bits (205), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 75/280 (26%), Positives = 123/280 (43%), Gaps = 28/280 (10%)

Query: 274 TGSYDSTVAIWDLATGK-LIRRLSGHTDGVKALRFD---------DQKLITGSLDKTIRV 323
           TGS D+T+ +WD   G+ L   L GHT  + +L ++           +L + S D TI++
Sbjct: 201 TGSMDATIRLWDSEKGQSLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASASKDGTIKI 260

Query: 324 WNYVTGACVSTYRGHQDSVLSVD-SFRKLIVSGSADKTVKVWHVES--RTCYTLRGHTGW 380
           W+     C+ T  GH  SV  +    R ++ S S D+TV+ W + +  +    L+ H  W
Sbjct: 261 WDTTRRVCIYTLSGHTSSVSCIKWGGRNVLYSASHDRTVRCWDMAAGGKCINILKSHAHW 320

Query: 381 VN--------CVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLG 432
           VN         +++ P   T    +     +   +R    V   +G + ++     +  G
Sbjct: 321 VNHLSLSTDYALRMGPFDHTGTKPASPEDAQARALRNYEKVAKKNGTMEEL-----MVTG 375

Query: 433 SDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACI 492
           SD                       +  N     P   +++S S DN+IKLW+ + G  I
Sbjct: 376 SDDFTMYLWNPLKGSKPILRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFI 435

Query: 493 RTQFGHVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQTGK 530
            T  GHV  V+ +A  +D   +VS S D + KVWD++T K
Sbjct: 436 ATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRK 475

 Score = 79.0 bits (193), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 77/298 (25%), Positives = 116/298 (38%), Gaps = 84/298 (28%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK-LITGSLDKTIRVWNYVTGA-C 331
           + S D T+ IWD      I  LSGHT  V  +++  +  L + S D+T+R W+   G  C
Sbjct: 251 SASKDGTIKIWDTTRRVCIYTLSGHTSSVSCIKWGGRNVLYSASHDRTVRCWDMAAGGKC 310

Query: 332 VSTYRGHQDSV----LSVD-------------------------------------SFRK 350
           ++  + H   V    LS D                                     +  +
Sbjct: 311 INILKSHAHWVNHLSLSTDYALRMGPFDHTGTKPASPEDAQARALRNYEKVAKKNGTMEE 370

Query: 351 LIVSGSADKTVKVWHV--ESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIR 408
           L+V+GS D T+ +W+    S+    + GH   VN V   P      S S D +I++WD R
Sbjct: 371 LMVTGSDDFTMYLWNPLKGSKPILRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGR 430

Query: 409 TNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPY 468
               +  F GHV  V +V                                A + D  L  
Sbjct: 431 DGKFIATFRGHVASVYQV--------------------------------AWSSDCRL-- 456

Query: 469 PTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVW--DIAADNFRIVSGSHDRSCKVW 524
              L+SCS D T+K+W+VKT        GH + V+  D + D  R+ SG  D+  ++W
Sbjct: 457 ---LVSCSKDTTLKVWDVKTRKLTVDLPGHNDEVYTVDWSVDGKRVCSGGKDKMVRLW 511

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 77/188 (40%), Gaps = 34/188 (18%)

Query: 352 IVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTN 410
           +V+G+ D T ++W  +++T   TL+GH+ WV CV          +GS D TIR+WD    
Sbjct: 157 MVTGAGDNTARIWDCDTQTPLCTLKGHSNWVLCVAWSADGEVIATGSMDATIRLWDSEKG 216

Query: 411 TCV-RVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYP 469
             +     GH   +  +                             S +  +       P
Sbjct: 217 QSLGDALRGHTKWITSL-----------------------------SWEPIHLVKPGEKP 247

Query: 470 THLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFRIV-SGSHDRSCKVWDLQT 528
             L S S D TIK+W+     CI T  GH   V  I      ++ S SHDR+ + WD+  
Sbjct: 248 -RLASASKDGTIKIWDTTRRVCIYTLSGHTSSVSCIKWGGRNVLYSASHDRTVRCWDMAA 306

Query: 529 -GKCMHTF 535
            GKC++  
Sbjct: 307 GGKCINIL 314

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/192 (21%), Positives = 72/192 (37%), Gaps = 48/192 (25%)

Query: 368 SRTCYTLRGHTGWVNCVKLHP-KSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKV 426
           +R+   + GH   + C    P  S    +G+ D T R+WD  T T +    GH   V  V
Sbjct: 131 TRSSSAIAGHGATILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPLCTLKGHSNWVLCV 190

Query: 427 IPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNV 486
                                           A + D  +     + + S+D TI+LW+ 
Sbjct: 191 --------------------------------AWSADGEV-----IATGSMDATIRLWDS 213

Query: 487 KTGACIRTQF-GHVEGVWDIA---------ADNFRIVSGSHDRSCKVWDLQTGKCMHTFV 536
           + G  +     GH + +  ++          +  R+ S S D + K+WD     C++T  
Sbjct: 214 EKGQSLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASASKDGTIKIWDTTRRVCIYTLS 273

Query: 537 GIHAPVACVGIG 548
           G  + V+C+  G
Sbjct: 274 GHTSSVSCIKWG 285

>Kwal_23.6324
          Length = 514

 Score = 92.8 bits (229), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 88/291 (30%), Positives = 126/291 (43%), Gaps = 26/291 (8%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGAC 331
           TGS D+T  IWD  T   +  L GH + V  + +  D + + TGS+D TIR+W+   G  
Sbjct: 160 TGSGDNTARIWDCNTNTPMYTLKGHFNWVLCVAWCPDGELIATGSMDNTIRLWDSNKGES 219

Query: 332 V-STYRGHQDSVLSVD---------SFRKLIVSGSADKTVKVWHVESRTC-YTLRGHTGW 380
                RGH   + S+            +  + S S D T+K+W    R C  TL GHT  
Sbjct: 220 YGEALRGHAKWITSLTWEPMHLVKAGDQPRLASASKDGTIKIWDTTRRVCVLTLSGHTNS 279

Query: 381 VNCVKLHPKSFTCFSGSDDMTIRMWDIRT-NTCVRVFHGHVGQVQKVIPLTLGSDLIEXX 439
           V+CVK   +    +SGS D TIR WD+     C+ +   H   +     L+L +D     
Sbjct: 280 VSCVKWGGRGI-LYSGSHDKTIRAWDMAAGGKCINILKSHAHWINH---LSLNTDYALRV 335

Query: 440 XXXXXXXXXXXXXXXXSVQA-ANFDHSLPYPTHL----LSCSLDNTIKLWN-VKTGACIR 493
                             +A  N++        L    ++ S D T+ LW+ +K    I 
Sbjct: 336 GAFDHTGEKPSSPEEARAKALKNYEKIAKKNGQLEELMVTASDDFTMYLWDPLKASKPIT 395

Query: 494 TQFGHVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPV 542
              GH + V  +A   D   IVS S D S K+WD + G  + TF G  A V
Sbjct: 396 RMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRNGTFIATFRGHVASV 446

 Score = 87.0 bits (214), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 76/278 (27%), Positives = 123/278 (44%), Gaps = 24/278 (8%)

Query: 274 TGSYDSTVAIWDLATGKLI-RRLSGHTDGVKALRF---------DDQKLITGSLDKTIRV 323
           TGS D+T+ +WD   G+     L GH   + +L +         D  +L + S D TI++
Sbjct: 202 TGSMDNTIRLWDSNKGESYGEALRGHAKWITSLTWEPMHLVKAGDQPRLASASKDGTIKI 261

Query: 324 WNYVTGACVSTYRGHQDSVLSVD-SFRKLIVSGSADKTVKVWHVES--RTCYTLRGHTGW 380
           W+     CV T  GH +SV  V    R ++ SGS DKT++ W + +  +    L+ H  W
Sbjct: 262 WDTTRRVCVLTLSGHTNSVSCVKWGGRGILYSGSHDKTIRAWDMAAGGKCINILKSHAHW 321

Query: 381 VNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHV------GQVQKVIPLTLGSD 434
           +N + L+   +    G+ D T            +    +       GQ++++  +   SD
Sbjct: 322 INHLSLN-TDYALRVGAFDHTGEKPSSPEEARAKALKNYEKIAKKNGQLEEL--MVTASD 378

Query: 435 LIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRT 494
                                  +  N     P   +++S S DN+IKLW+ + G  I T
Sbjct: 379 DFTMYLWDPLKASKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRNGTFIAT 438

Query: 495 QFGHVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQTGK 530
             GHV  V+ +A  +D   +VS S D + KVWD++T K
Sbjct: 439 FRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTKK 476

 Score = 80.9 bits (198), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 76/298 (25%), Positives = 117/298 (39%), Gaps = 84/298 (28%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLI-TGSLDKTIRVWNYVTGA-C 331
           + S D T+ IWD      +  LSGHT+ V  +++  + ++ +GS DKTIR W+   G  C
Sbjct: 252 SASKDGTIKIWDTTRRVCVLTLSGHTNSVSCVKWGGRGILYSGSHDKTIRAWDMAAGGKC 311

Query: 332 VSTYRGHQ----------DSVLSVDSF-------------------------------RK 350
           ++  + H           D  L V +F                                +
Sbjct: 312 INILKSHAHWINHLSLNTDYALRVGAFDHTGEKPSSPEEARAKALKNYEKIAKKNGQLEE 371

Query: 351 LIVSGSADKTVKVWHV--ESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIR 408
           L+V+ S D T+ +W     S+    + GH   VN V   P      S S D +I++WD R
Sbjct: 372 LMVTASDDFTMYLWDPLKASKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGR 431

Query: 409 TNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPY 468
             T +  F GHV  V +V                                A + D  L  
Sbjct: 432 NGTFIATFRGHVASVYQV--------------------------------AWSSDCRL-- 457

Query: 469 PTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVW--DIAADNFRIVSGSHDRSCKVW 524
              L+SCS D T+K+W+V+T        GH + V+  D + D  R+ S   D+  ++W
Sbjct: 458 ---LVSCSKDTTLKVWDVRTKKLSVDLPGHNDEVYTVDWSVDGKRVCSAGKDKMVRIW 512

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 55/190 (28%), Positives = 81/190 (42%), Gaps = 38/190 (20%)

Query: 352 IVSGSADKTVKVWHVESRT-CYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDI-RT 409
           +V+GS D T ++W   + T  YTL+GH  WV CV   P      +GS D TIR+WD  + 
Sbjct: 158 MVTGSGDNTARIWDCNTNTPMYTLKGHFNWVLCVAWCPDGELIATGSMDNTIRLWDSNKG 217

Query: 410 NTCVRVFHGHVGQVQKVI--PLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLP 467
            +      GH   +  +   P+ L                         V+A +      
Sbjct: 218 ESYGEALRGHAKWITSLTWEPMHL-------------------------VKAGD------ 246

Query: 468 YPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFRIV-SGSHDRSCKVWDL 526
               L S S D TIK+W+     C+ T  GH   V  +      I+ SGSHD++ + WD+
Sbjct: 247 -QPRLASASKDGTIKIWDTTRRVCVLTLSGHTNSVSCVKWGGRGILYSGSHDKTIRAWDM 305

Query: 527 QT-GKCMHTF 535
              GKC++  
Sbjct: 306 AAGGKCINIL 315

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 69/192 (35%), Gaps = 48/192 (25%)

Query: 368 SRTCYTLRGHTGWVNCVKLHP-KSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKV 426
           +R+   + GH   + C    P  S    +GS D T R+WD  TNT +    GH   V  V
Sbjct: 132 TRSSSAIAGHGSTILCSAFAPHTSGRMVTGSGDNTARIWDCNTNTPMYTLKGHFNWVLCV 191

Query: 427 IPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNV 486
                G +LI                                     + S+DNTI+LW+ 
Sbjct: 192 AWCPDG-ELIA------------------------------------TGSMDNTIRLWDS 214

Query: 487 KTGACIRTQF-GHVEGVWDI---------AADNFRIVSGSHDRSCKVWDLQTGKCMHTFV 536
             G        GH + +  +         A D  R+ S S D + K+WD     C+ T  
Sbjct: 215 NKGESYGEALRGHAKWITSLTWEPMHLVKAGDQPRLASASKDGTIKIWDTTRRVCVLTLS 274

Query: 537 GIHAPVACVGIG 548
           G    V+CV  G
Sbjct: 275 GHTNSVSCVKWG 286

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 42/85 (49%), Gaps = 5/85 (5%)

Query: 246 RKGIYRIQEFKGHMDGVXXXXXXX--XXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGVK 303
           R G + I  F+GH+  V             + S D+T+ +WD+ T KL   L GH D V 
Sbjct: 431 RNGTF-IATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTKKLSVDLPGHNDEVY 489

Query: 304 ALRF--DDQKLITGSLDKTIRVWNY 326
            + +  D +++ +   DK +R+W +
Sbjct: 490 TVDWSVDGKRVCSAGKDKMVRIWTH 514

>AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH]
           (799876..800298,800493..801074) [1005 bp, 334 aa]
          Length = 334

 Score = 90.9 bits (224), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 59/174 (33%), Positives = 87/174 (50%), Gaps = 14/174 (8%)

Query: 274 TGSYDSTVAIWDLA-----TGKLIRRLSGHTDGVK--ALRFDDQKLITGSLDKTIRVWNY 326
           +GS D T+  W L       G  +R   GH+  V+   +  D +  ++ S DKT+R+W+ 
Sbjct: 51  SGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIVQDCTVTHDGKYALSASWDKTLRLWDL 110

Query: 327 VTGACVSTYRGHQDSVLSV--DSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCV 384
            +G C+  + GH+  V+SV  D     IVS S DKTVKVW+       TL GH  WV+ V
Sbjct: 111 QSGKCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTVKVWNTVGDCVVTLLGHNDWVSNV 170

Query: 385 KLHPK-----SFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGS 433
           ++ P      + T  S   D  +++WD+++ T    F GH   V  V P   GS
Sbjct: 171 RIAPSEKSDDAVTVISAGMDKVVKVWDLQSFTIEADFIGHNNYVTTVTPSPDGS 224

 Score = 79.7 bits (195), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 55/174 (31%), Positives = 82/174 (47%), Gaps = 13/174 (7%)

Query: 252 IQEFKGHMDGVX--XXXXXXXXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDD 309
           ++ FKGH   V             + S+D T+ +WDL +GK I+R  GH   V ++  D 
Sbjct: 74  VRSFKGHSHIVQDCTVTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDP 133

Query: 310 Q--KLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSV-------DSFRKLIVSGSADKT 360
           +  ++++ S DKT++VWN V G CV T  GH D V +V             ++S   DK 
Sbjct: 134 RATQIVSASRDKTVKVWNTV-GDCVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKV 192

Query: 361 VKVWHVESRTCYT-LRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCV 413
           VKVW ++S T      GH  +V  V   P      S   D  I +W++   T +
Sbjct: 193 VKVWDLQSFTIEADFIGHNNYVTTVTPSPDGSIFASAGKDGQIILWNLNEKTAL 246

 Score = 68.2 bits (165), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 59/229 (25%), Positives = 94/229 (41%), Gaps = 56/229 (24%)

Query: 334 TYRGHQDSVLSVDSFR---KLIVSGSADKTVKVWHVESR------TCYTLRGHTGWV-NC 383
           T  GH   V S+ +      +++SGS DKT+  W +            + +GH+  V +C
Sbjct: 28  TLEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIVQDC 87

Query: 384 VKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXX 443
              H   +   S S D T+R+WD+++  C++ F GH   V  V                 
Sbjct: 88  TVTHDGKY-ALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSV----------------- 129

Query: 444 XXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVW 503
                            + D   P  T ++S S D T+K+WN   G C+ T  GH + V 
Sbjct: 130 -----------------SID---PRATQIVSASRDKTVKVWNT-VGDCVVTLLGHNDWVS 168

Query: 504 DI-------AADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACV 545
           ++       + D   ++S   D+  KVWDLQ+      F+G +  V  V
Sbjct: 169 NVRIAPSEKSDDAVTVISAGMDKVVKVWDLQSFTIEADFIGHNNYVTTV 217

 Score = 62.4 bits (150), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 76/187 (40%), Gaps = 46/187 (24%)

Query: 373 TLRGHTGWVNCVKLHP-KSFTCFSGSDDMTIRMW-----DIRTNTCVRVFHGHVGQVQKV 426
           TL GH GWV  +   P +     SGS D T+  W     D +    VR F GH       
Sbjct: 28  TLEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGH------- 80

Query: 427 IPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNV 486
                                         VQ     H   Y    LS S D T++LW++
Sbjct: 81  ---------------------------SHIVQDCTVTHDGKYA---LSASWDKTLRLWDL 110

Query: 487 KTGACIRTQFGHVEGVWDIAAD--NFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVAC 544
           ++G CI+   GH   V  ++ D    +IVS S D++ KVW+   G C+ T +G +  V+ 
Sbjct: 111 QSGKCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTVKVWN-TVGDCVVTLLGHNDWVSN 169

Query: 545 VGIGDSE 551
           V I  SE
Sbjct: 170 VRIAPSE 176

 Score = 36.2 bits (82), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 48/246 (19%), Positives = 82/246 (33%), Gaps = 71/246 (28%)

Query: 233 VVYRERFKVESNWRKGIYR--------IQEFKGHMDGVXXXXXX--XXXXXTGSYDSTVA 282
           V +  ++ + ++W K +          I+ F GH   V             + S D TV 
Sbjct: 89  VTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTVK 148

Query: 283 IWDLATGKLIRRLSGHTDGVKALRF-------DDQKLITGSLDKTIRVWNYVTGACVSTY 335
           +W+   G  +  L GH D V  +R        D   +I+  +DK ++VW+  +    + +
Sbjct: 149 VWN-TVGDCVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKVVKVWDLQSFTIEADF 207

Query: 336 RGHQDSVLSVDSFR--KLIVSGSADKTVKVWHVESRTC-YTLRGHTGWVNCVKLHPKSF- 391
            GH + V +V       +  S   D  + +W++  +T  YTL      V  V   P  + 
Sbjct: 208 IGHNNYVTTVTPSPDGSIFASAGKDGQIILWNLNEKTALYTLDAKDE-VFAVAFSPNRYW 266

Query: 392 ------------------------------------------------TCFSGSDDMTIR 403
                                                           T F+G  D  IR
Sbjct: 267 LTAATASGIKIFDLEERTIVDDLKPEFAGYNKAQDPHAVSLAWSADGQTLFAGYTDNIIR 326

Query: 404 MWDIRT 409
           +W + T
Sbjct: 327 VWQVMT 332

>Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement
          Length = 749

 Score = 93.2 bits (230), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 81/283 (28%), Positives = 119/283 (42%), Gaps = 76/283 (26%)

Query: 275 GSYDSTVAIWDLATGKLIRRLS-------------GHTDGVKALRF--DDQKLITGSLDK 319
           G  DS + +W L    L  +L              GH+  V +  F  D++ L++ S DK
Sbjct: 439 GFQDSYIKLWSLDGTPLDSKLPSKQREKINNTTLIGHSGTVYSTSFSPDNKYLLSASEDK 498

Query: 320 TIRVWNYVTGACVSTYRGHQDSVLSVDSFRKL---IVSGSADKTVKVWHVESRTCYTLR- 375
           T+R+W+  T + + +Y+GH   V  V SF  L     + S D+T ++W  +    Y LR 
Sbjct: 499 TVRLWSMDTYSSLVSYKGHNHPVWDV-SFSPLGHYFATASHDQTARLWSCDH--IYPLRI 555

Query: 376 --GHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQV--QKVIP--- 428
             GH   V+CV  HP     F+GS D T RMWDI T   VR+F GH   V    V P   
Sbjct: 556 FAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGR 615

Query: 429 -LTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVK 487
            L+ GS+                                           D  I +W++ 
Sbjct: 616 WLSTGSE-------------------------------------------DGIINVWDIG 632

Query: 488 TGACIRTQFGH-VEGVWDI--AADNFRIVSGSHDRSCKVWDLQ 527
           TG  ++   GH    V+ +  + +   +VSG  D S +VWDL+
Sbjct: 633 TGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDLK 675

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 87/211 (41%), Gaps = 44/211 (20%)

Query: 333 STYRGHQDSVLSVDSF---RKLIVSGSADKTVKVWHVES-RTCYTLRGHTGWVNCVKLHP 388
           +T  GH  +V S  SF    K ++S S DKTV++W +++  +  + +GH   V  V   P
Sbjct: 470 TTLIGHSGTVYST-SFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSP 528

Query: 389 KSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXX 448
                 + S D T R+W       +R+F GH+  V  V                      
Sbjct: 529 LGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCV---------------------- 566

Query: 449 XXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWD--IA 506
                       +F    P  T++ + S D T ++W++ TG  +R   GH   V    ++
Sbjct: 567 ------------SFH---PNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVS 611

Query: 507 ADNFRIVSGSHDRSCKVWDLQTGKCMHTFVG 537
            D   + +GS D    VWD+ TGK +    G
Sbjct: 612 PDGRWLSTGSEDGIINVWDIGTGKRLKQMRG 642

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 70/145 (48%), Gaps = 6/145 (4%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGAC 331
           T S+D T  +W       +R  +GH + V  + F  +   + TGS DKT R+W+  TG  
Sbjct: 535 TASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDS 594

Query: 332 VSTYRGHQDSVLS--VDSFRKLIVSGSADKTVKVWHVES-RTCYTLRGH-TGWVNCVKLH 387
           V  + GH   V+S  V    + + +GS D  + VW + + +    +RGH    V  +   
Sbjct: 595 VRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYS 654

Query: 388 PKSFTCFSGSDDMTIRMWDIRTNTC 412
            +     SG  D ++R+WD++ +T 
Sbjct: 655 KEGTVLVSGGADHSVRVWDLKRSTA 679

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 49/125 (39%), Gaps = 44/125 (35%)

Query: 467 PYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA-------------------- 506
           P   +LLS S D T++LW++ T + + +  GH   VWD++                    
Sbjct: 486 PDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLW 545

Query: 507 ------------------------ADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPV 542
                                    +   + +GS D++C++WD+ TG  +  F+G  APV
Sbjct: 546 SCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPV 605

Query: 543 ACVGI 547
               +
Sbjct: 606 ISTAV 610

>Kwal_26.8776
          Length = 433

 Score = 91.7 bits (226), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 52/158 (32%), Positives = 80/158 (50%), Gaps = 5/158 (3%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGAC 331
           TGS D+T+ +WD+A+GKL   L+GH   V+++    +   + + S DK ++ W+    A 
Sbjct: 139 TGSNDTTIKVWDMASGKLKLTLTGHVMTVRSVAVSQRHPLMFSASEDKMVKCWDLERNAA 198

Query: 332 VSTYRGHQDSVLSVD--SFRKLIVSGSADKTVKVWHVESR-TCYTLRGHTGWVNCVKLHP 388
           +  Y GH   V +VD      LI S   D  V++W + +R    TL GH   +N VK  P
Sbjct: 199 IRDYHGHFSGVNTVDVHPTLDLIASAGRDAVVRLWDIRTRLPVMTLAGHKSPINQVKCFP 258

Query: 389 KSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKV 426
                 S S D T+R+WDIR     ++   H   V+ +
Sbjct: 259 VDPQIMSCSSDATVRLWDIRAGKATKILTHHSKSVRAI 296

 Score = 85.5 bits (210), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 65/227 (28%), Positives = 93/227 (40%), Gaps = 43/227 (18%)

Query: 287 ATGKLIRRLSGHTDGVKAL---RFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVL 343
           A  KL+R ++GH   V+ +     D+    TGS D TI+VW+  +G    T  GH  +V 
Sbjct: 109 APWKLMRVINGHNGWVRCVCPDPVDNAWFATGSNDTTIKVWDMASGKLKLTLTGHVMTVR 168

Query: 344 SVDSFRK--LIVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHPKSFTCFSGSDDM 400
           SV   ++  L+ S S DK VK W +E         GH   VN V +HP      S   D 
Sbjct: 169 SVAVSQRHPLMFSASEDKMVKCWDLERNAAIRDYHGHFSGVNTVDVHPTLDLIASAGRDA 228

Query: 401 TIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAA 460
            +R+WDIRT   V    GH   + +V                                  
Sbjct: 229 VVRLWDIRTRLPVMTLAGHKSPINQV---------------------------------- 254

Query: 461 NFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAA 507
                 P    ++SCS D T++LW+++ G   +    H + V  IAA
Sbjct: 255 ---KCFPVDPQIMSCSSDATVRLWDIRAGKATKILTHHSKSVRAIAA 298

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 72/185 (38%), Gaps = 40/185 (21%)

Query: 364 WHVESRTCYTLRGHTGWVNCVKLHPKSFTCF-SGSDDMTIRMWDIRTNTCVRVFHGHVGQ 422
           WH   +    + GH GWV CV   P     F +GS+D TI++WD+ +        GHV  
Sbjct: 107 WHAPWKLMRVINGHNGWVRCVCPDPVDNAWFATGSNDTTIKVWDMASGKLKLTLTGHVMT 166

Query: 423 VQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIK 482
           V+ V                                A +  H L     + S S D  +K
Sbjct: 167 VRSV--------------------------------AVSQRHPL-----MFSASEDKMVK 189

Query: 483 LWNVKTGACIRTQFGHVEGV--WDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHA 540
            W+++  A IR   GH  GV   D+      I S   D   ++WD++T   + T  G  +
Sbjct: 190 CWDLERNAAIRDYHGHFSGVNTVDVHPTLDLIASAGRDAVVRLWDIRTRLPVMTLAGHKS 249

Query: 541 PVACV 545
           P+  V
Sbjct: 250 PINQV 254

 Score = 37.7 bits (86), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 2/74 (2%)

Query: 476 SLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFR--IVSGSHDRSCKVWDLQTGKCMH 533
           S D TIK+W++ +G    T  GHV  V  +A       + S S D+  K WDL+    + 
Sbjct: 141 SNDTTIKVWDMASGKLKLTLTGHVMTVRSVAVSQRHPLMFSASEDKMVKCWDLERNAAIR 200

Query: 534 TFVGIHAPVACVGI 547
            + G  + V  V +
Sbjct: 201 DYHGHFSGVNTVDV 214

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 21/40 (52%)

Query: 508 DNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGI 547
           DN    +GS+D + KVWD+ +GK   T  G    V  V +
Sbjct: 133 DNAWFATGSNDTTIKVWDMASGKLKLTLTGHVMTVRSVAV 172

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 56/138 (40%), Gaps = 10/138 (7%)

Query: 201 HMKRARYIKSDKASASKGEGEDAPQSRMRPWKVVYRERFKVESNWR-KGIYRIQEFKGHM 259
           H K  R I +  A +S      A  S +R W+       ++ +N+  +GI  I     + 
Sbjct: 289 HSKSVRAIAAHPAESSVAT---ASTSDVRSWR---HSDGQLLTNYHSEGIGIINSLSVNA 342

Query: 260 DGVXXXXXXXXXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQ--KLITGSL 317
           DGV              Y S     +L T K+   L     G+ +  FD    +LITG  
Sbjct: 343 DGVLFGGGDDGNLSFFDYKSGHKYQELPTTKIPGSLDSER-GILSASFDQTGLRLITGES 401

Query: 318 DKTIRVWNYVTGACVSTY 335
           DK+I++W  +  A   T+
Sbjct: 402 DKSIKMWKQIPEATPETH 419

>Scas_721.115*
          Length = 318

 Score = 89.7 bits (221), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 84/167 (50%), Gaps = 14/167 (8%)

Query: 274 TGSYDSTVAIWDLAT-----GKLIRRLSGHTDGVK--ALRFDDQKLITGSLDKTIRVWNY 326
           +GS D T+  W L       G  +R   GH+  V+   L  D    ++ S DKT+R+W+ 
Sbjct: 35  SGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDV 94

Query: 327 VTGACVSTYRGHQDSVLSVDSFRK--LIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCV 384
            TG     + GH+  V+SV   RK  +I+SGS DKT+KVW ++ +   TL GH  WV+ V
Sbjct: 95  ATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQV 154

Query: 385 KLHPK-----SFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKV 426
           ++ P      S T  S  +D  ++ W++        F GH G V  V
Sbjct: 155 RIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTV 201

 Score = 76.3 bits (186), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 52/168 (30%), Positives = 79/168 (47%), Gaps = 13/168 (7%)

Query: 252 IQEFKGHMDGVX--XXXXXXXXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDD 309
           ++ FKGH   V             + S+D T+ +WD+ATG+  +R  GH   V ++  D 
Sbjct: 58  VRSFKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDR 117

Query: 310 QK--LITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSV-------DSFRKLIVSGSADKT 360
           +   +I+GS DKTI+VW  + G C++T  GH D V  V       +     ++S   DK 
Sbjct: 118 KASMIISGSRDKTIKVWT-IKGQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKM 176

Query: 361 VKVWHVES-RTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDI 407
           VK W++   +      GH G VN V   P      S   D  I +W++
Sbjct: 177 VKAWNLNQFQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLWNL 224

 Score = 57.4 bits (137), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 54/187 (28%), Positives = 76/187 (40%), Gaps = 46/187 (24%)

Query: 373 TLRGHTGWVNCVKLHP-KSFTCFSGSDDMTIRMW-----DIRTNTCVRVFHGHVGQVQKV 426
           TL GH GWV  +     +     SGS D T+  W     D +    VR F GH   VQ  
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 427 IPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNV 486
              TL  D                                    + LS S D T++LW+V
Sbjct: 72  ---TLTQD----------------------------------GAYALSASWDKTLRLWDV 94

Query: 487 KTGACIRTQFGHVEGVWDIAADN--FRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVAC 544
            TG   +   GH   V  +A D     I+SGS D++ KVW ++ G+C+ T +G +  V+ 
Sbjct: 95  ATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQ 153

Query: 545 VGIGDSE 551
           V I  ++
Sbjct: 154 VRIAPTD 160

 Score = 55.5 bits (132), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 87/228 (38%), Gaps = 54/228 (23%)

Query: 334 TYRGHQDSVLSVDSFR---KLIVSGSADKTVKVWHVESR------TCYTLRGHTGWVNCV 384
           T  GH   V S+ +      L++SGS DKT+  W +            + +GH+  V   
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 385 KLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXX 444
            L        S S D T+R+WD+ T    + F GH   V  V                  
Sbjct: 72  TLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSV------------------ 113

Query: 445 XXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGV-- 502
                         A +   S+     ++S S D TIK+W +K G C+ T  GH + V  
Sbjct: 114 --------------AIDRKASM-----IISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQ 153

Query: 503 -----WDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACV 545
                 D   D+  ++S  +D+  K W+L   +    FVG +  V  V
Sbjct: 154 VRIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTV 201

>YNL006W (LST8) [4579] chr14 (620066..620977) Protein required for
           transport of permeases from the Golgi to the plasma
           membrane [912 bp, 303 aa]
          Length = 303

 Score = 89.4 bits (220), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 81/297 (27%), Positives = 129/297 (43%), Gaps = 22/297 (7%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF-DDQKLITGSLDKTIRVWNYVTGAC- 331
           +  YD T+  W+  TG   R +      V  L   +D+KL+  +  + +R+++  T    
Sbjct: 7   SAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPN 66

Query: 332 -VSTYRGHQDSVLSVDSFR---KLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLH 387
            V+++ GH+ +V SV SF+   + +V+ S D T+KVW V S +      H   VN V +H
Sbjct: 67  PVASFEGHRGNVTSV-SFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIH 125

Query: 388 PKSFTCFSGSDDMTIRMWDIRTNTCV-RVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXX 446
           P      S   D  IR+WD+  N C  ++       +Q +   + GS L           
Sbjct: 126 PNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYV 185

Query: 447 XXXXXXXXXS--VQAANFDHSLPYPT---------HLLSCSLDNTIKLWNVKTGACIRTQ 495
                    S       F     Y T         HL +CS D+T ++W++     + T 
Sbjct: 186 WEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETT 245

Query: 496 F-GHVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGIGD 549
             GH   VWD A  AD+  +V+ S D   ++WDL T + +  + G H    CV + D
Sbjct: 246 LDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALND 302

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 61/122 (50%), Gaps = 9/122 (7%)

Query: 312 LITGSLDKTIRVWNYVTGACVSTYRGHQDSV---LSVDSFRKLIVSGSADKTVKVWHVES 368
           L++   D TIR W  +TG C  T + H DS    L + + +KL+ + +  + V+++ + +
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQ-HSDSQVNRLEITNDKKLLAT-AGHQNVRLYDIRT 62

Query: 369 RT---CYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQK 425
                  +  GH G V  V     +    + S+D TI++WD+R+ +  R +  H   V +
Sbjct: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNY-KHNAPVNE 121

Query: 426 VI 427
           V+
Sbjct: 122 VV 123

>Scas_592.4*
          Length = 318

 Score = 89.0 bits (219), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 56/167 (33%), Positives = 84/167 (50%), Gaps = 14/167 (8%)

Query: 274 TGSYDSTVAIWDLAT-----GKLIRRLSGHTDGVK--ALRFDDQKLITGSLDKTIRVWNY 326
           +GS D T+  W L       G  +R   GH+  V+   L  D    ++ S DKT+R+W+ 
Sbjct: 35  SGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDV 94

Query: 327 VTGACVSTYRGHQDSVLSVDSFRK--LIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCV 384
            TG     + GH+  V+SV   RK  +I+SGS DKT+KVW ++ +   TL GH  WV+ V
Sbjct: 95  ATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQV 154

Query: 385 KLHPK-----SFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKV 426
           ++ P      + T  S  +D  ++ W++        F GH G V  V
Sbjct: 155 RIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAV 201

 Score = 76.6 bits (187), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 52/168 (30%), Positives = 79/168 (47%), Gaps = 13/168 (7%)

Query: 252 IQEFKGHMDGVX--XXXXXXXXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDD 309
           ++ FKGH   V             + S+D T+ +WD+ATG+  +R  GH   V ++  D 
Sbjct: 58  VRSFKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDR 117

Query: 310 QK--LITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSV-------DSFRKLIVSGSADKT 360
           +   +I+GS DKTI+VW  + G C++T  GH D V  V       +     ++S   DK 
Sbjct: 118 KASMIISGSRDKTIKVWT-IKGQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKM 176

Query: 361 VKVWHVES-RTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDI 407
           VK W++   +      GH G VN V   P      S   D  I +W++
Sbjct: 177 VKAWNLNQFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLWNL 224

 Score = 57.8 bits (138), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 54/187 (28%), Positives = 76/187 (40%), Gaps = 46/187 (24%)

Query: 373 TLRGHTGWVNCVKLHP-KSFTCFSGSDDMTIRMW-----DIRTNTCVRVFHGHVGQVQKV 426
           TL GH GWV  +     +     SGS D T+  W     D +    VR F GH   VQ  
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 427 IPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNV 486
              TL  D                                    + LS S D T++LW+V
Sbjct: 72  ---TLTQD----------------------------------GAYALSASWDKTLRLWDV 94

Query: 487 KTGACIRTQFGHVEGVWDIAADN--FRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVAC 544
            TG   +   GH   V  +A D     I+SGS D++ KVW ++ G+C+ T +G +  V+ 
Sbjct: 95  ATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQ 153

Query: 545 VGIGDSE 551
           V I  ++
Sbjct: 154 VRIAPTD 160

 Score = 55.1 bits (131), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 86/228 (37%), Gaps = 54/228 (23%)

Query: 334 TYRGHQDSVLSVDSFR---KLIVSGSADKTVKVWHVESR------TCYTLRGHTGWVNCV 384
           T  GH   V S+ +      L++SGS DKT+  W +            + +GH+  V   
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 385 KLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXX 444
            L        S S D T+R+WD+ T    + F GH   V  V                  
Sbjct: 72  TLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSV------------------ 113

Query: 445 XXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGV-- 502
                         A +   S+     ++S S D TIK+W +K G C+ T  GH + V  
Sbjct: 114 --------------AIDRKASM-----IISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQ 153

Query: 503 -----WDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACV 545
                 D   D   ++S  +D+  K W+L   +    FVG +  V  V
Sbjct: 154 VRIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAV 201

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 48/217 (22%), Positives = 74/217 (34%), Gaps = 61/217 (28%)

Query: 253 QEFKGHMDGVXXXXX--XXXXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--- 307
           Q F GH   V             +GS D T+ +W +  G+ +  L GH D V  +R    
Sbjct: 101 QRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTI-KGQCLATLLGHNDWVSQVRIAPT 159

Query: 308 ----DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFR--KLIVSGSADKTV 361
               D   +I+   DK ++ WN       + + GH  +V +V +     LI S   D  +
Sbjct: 160 DQNDDAVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEI 219

Query: 362 KVWHV-ESRTCYTLRGHTG-----------WVNCVK--------LHPKSF---------- 391
            +W++ E +  YTL                W+            L P+S           
Sbjct: 220 MLWNLAEKKAMYTLSAQDEVFSLAFSPNRYWLAAATASGIKIFCLDPQSLIDDLRPEFAG 279

Query: 392 -------------------TCFSGSDDMTIRMWDIRT 409
                              T F+G  D  IR+W + T
Sbjct: 280 YNKSAEPHAVSLAWSADGQTLFAGYTDSVIRVWQVMT 316

>Scas_624.11
          Length = 1205

 Score = 92.0 bits (227), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 72/266 (27%), Positives = 120/266 (45%), Gaps = 30/266 (11%)

Query: 277 YDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGACVST 334
           + ST+ +WD   G L+ R   H   V+++ F   +   ++G  D TI+VW+  T  C+ T
Sbjct: 31  FSSTIQLWDYRMGTLLHRFEDHEGPVRSVDFHPTQPIFVSGGDDYTIKVWSLETNKCLYT 90

Query: 335 YRGHQDSVLSVDSFRKL--IVSGSADKTVKVWHVESRTCYT-LRGHTGWVNCVKLHPKSF 391
             GH D + +V   ++L  I+S S D+T+++W+ ++R     L GH  +V C + HP   
Sbjct: 91  LNGHLDYIRTVFFHKELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDD 150

Query: 392 TCFSGSDDMTIRMWDI------RTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXX 445
              S S D TIR+WDI       +      F   +   Q ++    G  +++        
Sbjct: 151 LVVSASLDETIRVWDISGLRKKHSAPGTSTFDDQMAAQQNLLDGGFGDCVVK-------- 202

Query: 446 XXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGAC--IRTQFGHVEGVW 503
                      V  A+F  +LP    ++S S D  +KLW   +     + T  GH   V 
Sbjct: 203 --FILEGHTRGVNWASFHPTLPM---IVSGSDDRQVKLWKYNSTKAWEVDTCRGHTNNVD 257

Query: 504 DI---AADNFRIVSGSHDRSCKVWDL 526
            +       F I+S   D++ ++WDL
Sbjct: 258 CVIFHPTQKF-ILSVGEDKTLRIWDL 282

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 69/280 (24%), Positives = 105/280 (37%), Gaps = 76/280 (27%)

Query: 290 KLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVD- 346
           K++ +    +   K + F   +  ++      TI++W+Y  G  +  +  H+  V SVD 
Sbjct: 2   KMLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRSVDF 61

Query: 347 -SFRKLIVSGSADKTVKVWHVESRTC-YTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRM 404
              + + VSG  D T+KVW +E+  C YTL GH  ++  V  H +     S SDD TIR+
Sbjct: 62  HPTQPIFVSGGDDYTIKVWSLETNKCLYTLNGHLDYIRTVFFHKELPWIISASDDQTIRI 121

Query: 405 WDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDH 464
           W+ +    +    GH                                     V  A F  
Sbjct: 122 WNWQNRKEIACLTGH----------------------------------NHFVMCAQFH- 146

Query: 465 SLPYPTHLLSCSLDNTIKLWNVK----------------------------TGACIRTQF 496
             P    ++S SLD TI++W++                              G C+  +F
Sbjct: 147 --PTDDLVVSASLDETIRVWDISGLRKKHSAPGTSTFDDQMAAQQNLLDGGFGDCV-VKF 203

Query: 497 ---GHVEGV-WDIAADNF-RIVSGSHDRSCKVWDLQTGKC 531
              GH  GV W         IVSGS DR  K+W   + K 
Sbjct: 204 ILEGHTRGVNWASFHPTLPMIVSGSDDRQVKLWKYNSTKA 243

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 98/239 (41%), Gaps = 41/239 (17%)

Query: 229 RPWKVVYRERFKVES-NWRKG--IYRIQEFKGHMDGVXXXXXXXXXXXTGSYDSTVAIWD 285
           RPW +V      ++  ++R G  ++R ++ +G +  V           +G  D T+ +W 
Sbjct: 23  RPWVLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRSVDFHPTQPIFV-SGGDDYTIKVWS 81

Query: 286 LATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGACVSTYRGHQDSVL 343
           L T K +  L+GH D ++ + F  +   +I+ S D+TIR+WN+     ++   GH   V+
Sbjct: 82  LETNKCLYTLNGHLDYIRTVFFHKELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVM 141

Query: 344 --SVDSFRKLIVSGSADKTVKVWHVESR-------------------------------T 370
                    L+VS S D+T++VW +                                   
Sbjct: 142 CAQFHPTDDLVVSASLDETIRVWDISGLRKKHSAPGTSTFDDQMAAQQNLLDGGFGDCVV 201

Query: 371 CYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTC--VRVFHGHVGQVQKVI 427
            + L GHT  VN    HP      SGSDD  +++W   +     V    GH   V  VI
Sbjct: 202 KFILEGHTRGVNWASFHPTLPMIVSGSDDRQVKLWKYNSTKAWEVDTCRGHTNNVDCVI 260

 Score = 71.6 bits (174), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 77/180 (42%), Gaps = 37/180 (20%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYV---- 327
           + S D T+ IW+    K I  L+GH   V   +F   D  +++ SLD+TIRVW+      
Sbjct: 112 SASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLVVSASLDETIRVWDISGLRK 171

Query: 328 ------------------------TGACVSTY--RGHQDSV--LSVDSFRKLIVSGSADK 359
                                    G CV  +   GH   V   S      +IVSGS D+
Sbjct: 172 KHSAPGTSTFDDQMAAQQNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLPMIVSGSDDR 231

Query: 360 TVKVWHVESRTCY---TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVF 416
            VK+W   S   +   T RGHT  V+CV  HP      S  +D T+R+WD+     V+ F
Sbjct: 232 QVKLWKYNSTKAWEVDTCRGHTNNVDCVIFHPTQKFILSVGEDKTLRIWDLDKRIPVKQF 291

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 71/182 (39%), Gaps = 42/182 (23%)

Query: 360 TVKVWHVESRTC-YTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHG 418
           T+++W     T  +    H G V  V  HP      SG DD TI++W + TN C+   +G
Sbjct: 34  TIQLWDYRMGTLLHRFEDHEGPVRSVDFHPTQPIFVSGGDDYTIKVWSLETNKCLYTLNG 93

Query: 419 HVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLD 478
           H+  ++ V                                   F   LP+   ++S S D
Sbjct: 94  HLDYIRTVF----------------------------------FHKELPW---IISASDD 116

Query: 479 NTIKLW---NVKTGACIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTF 535
            TI++W   N K  AC+ T   H          +  +VS S D + +VWD+   +  H+ 
Sbjct: 117 QTIRIWNWQNRKEIACL-TGHNHFVMCAQFHPTDDLVVSASLDETIRVWDISGLRKKHSA 175

Query: 536 VG 537
            G
Sbjct: 176 PG 177

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 60/171 (35%), Gaps = 55/171 (32%)

Query: 384 VKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXX 443
           +  HP            TI++WD R  T +  F  H G V+ V                 
Sbjct: 17  IAFHPSRPWVLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRSV----------------- 59

Query: 444 XXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGAC----------IR 493
                            +F  + P     +S   D TIK+W+++T  C          IR
Sbjct: 60  -----------------DFHPTQPI---FVSGGDDYTIKVWSLETNKCLYTLNGHLDYIR 99

Query: 494 TQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVAC 544
           T F H E  W        I+S S D++ ++W+ Q  K +    G +  V C
Sbjct: 100 TVFFHKELPW--------IISASDDQTIRIWNWQNRKEIACLTGHNHFVMC 142

 Score = 29.6 bits (65), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 47/104 (45%), Gaps = 6/104 (5%)

Query: 274 TGSYDSTVAIWDLATGKL--IRRLSGHTDGVKALRF-DDQKLITG-SLDKTIRVWNYVTG 329
           +GS D  V +W   + K   +    GHT+ V  + F   QK I     DKT+R+W+    
Sbjct: 226 SGSDDRQVKLWKYNSTKAWEVDTCRGHTNNVDCVIFHPTQKFILSVGEDKTLRIWDLDKR 285

Query: 330 ACVSTYRGHQDSVLSVDSFRKLIVSGSA-DKTVKVWHVE-SRTC 371
             V  ++   D    + S   + + G+A D  + V+ ++  R C
Sbjct: 286 IPVKQFKRENDRFWLIASHPNINLFGAAHDAGIMVFKLDRERPC 329

>CAGL0H08932g join(871668..871685,872089..874779) highly similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
          Length = 902

 Score = 91.3 bits (225), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 74/271 (27%), Positives = 127/271 (46%), Gaps = 43/271 (15%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGAC 331
           T  Y   V IW+  T + +R +      V+A +F  +K  ++ GS D  +RV+NY TG  
Sbjct: 30  TTLYSGRVEIWNYETQQEVRSIQVTDTPVRAGKFITRKNWIVVGSDDNKVRVFNYNTGEK 89

Query: 332 VSTYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWHVESRTCY--TLRGHTGWVNCVKLH 387
           V+ +  H D +  ++V   +  I++GS D TVK+W+ E+      T +GH  +V CV  +
Sbjct: 90  VADFVAHPDYIRSIAVHPSKPYILTGSDDLTVKLWNWENDWSLEQTFKGHEHFVMCVAFN 149

Query: 388 PKSFTCF-SGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXX 446
           PK    F SG  D  +++W +  +T    F  H GQ +       G + ++         
Sbjct: 150 PKDPNVFASGCLDHKVKVWSLGQSTPN--FTLHTGQEK-------GVNYVDY-------- 192

Query: 447 XXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGV-WDI 505
                            + LP   ++++ S D T+K+++ +T +C+ T  GH+  V + +
Sbjct: 193 -----------------YPLPDKPYMITSSDDTTVKIFDYQTKSCVATLEGHMSNVSFAV 235

Query: 506 AADNFR-IVSGSHDRSCKVWDLQTGKCMHTF 535
                  I+SGS D + K+W+  T K   T 
Sbjct: 236 FHPTLPIIISGSEDGTVKLWNSSTYKLEKTL 266

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 88/194 (45%), Gaps = 14/194 (7%)

Query: 229 RPWKVVYRERFKVES-NWRKGIYRIQEFKGHMDGVXXXXX--XXXXXXTGSYDSTVAIWD 285
           + W VV  +  KV   N+  G  ++ +F  H D +             TGS D TV +W+
Sbjct: 67  KNWIVVGSDDNKVRVFNYNTG-EKVADFVAHPDYIRSIAVHPSKPYILTGSDDLTVKLWN 125

Query: 286 LATG-KLIRRLSGHTDGVKALRF---DDQKLITGSLDKTIRVWNY-VTGACVSTYRGHQD 340
                 L +   GH   V  + F   D     +G LD  ++VW+   +    + + G + 
Sbjct: 126 WENDWSLEQTFKGHEHFVMCVAFNPKDPNVFASGCLDHKVKVWSLGQSTPNFTLHTGQEK 185

Query: 341 SVLSVDSF----RKLIVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHPKSFTCFS 395
            V  VD +    +  +++ S D TVK++  ++++C  TL GH   V+    HP      S
Sbjct: 186 GVNYVDYYPLPDKPYMITSSDDTTVKIFDYQTKSCVATLEGHMSNVSFAVFHPTLPIIIS 245

Query: 396 GSDDMTIRMWDIRT 409
           GS+D T+++W+  T
Sbjct: 246 GSEDGTVKLWNSST 259

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 74/185 (40%), Gaps = 33/185 (17%)

Query: 244 NWRKGIYRIQEFKGHMDGV---XXXXXXXXXXXTGSYDSTVAIWDLATGKLIRRLSGHTD 300
           NW       Q FKGH   V              +G  D  V +W L  G+     + HT 
Sbjct: 125 NWENDWSLEQTFKGHEHFVMCVAFNPKDPNVFASGCLDHKVKVWSL--GQSTPNFTLHTG 182

Query: 301 GVKALRF-------DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFR---K 350
             K + +       D   +IT S D T+++++Y T +CV+T  GH  +V S   F     
Sbjct: 183 QEKGVNYVDYYPLPDKPYMITSSDDTTVKIFDYQTKSCVATLEGHMSNV-SFAVFHPTLP 241

Query: 351 LIVSGSADKTVKVWHVES---RTCYTLRGHTGWVNCVKLHP------------KSFTCFS 395
           +I+SGS D TVK+W+  +        L     W  C+  HP              FT  S
Sbjct: 242 IIISGSEDGTVKLWNSSTYKLEKTLNLGLERSW--CIATHPVGRKNCIASGFDNGFTVLS 299

Query: 396 GSDDM 400
             +DM
Sbjct: 300 LGNDM 304

>Scas_721.32
          Length = 822

 Score = 90.5 bits (223), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 74/250 (29%), Positives = 104/250 (41%), Gaps = 63/250 (25%)

Query: 295 LSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKL- 351
           L GH+  V +  F  D++ L++GS DKT+R+W+  T   + +Y+GH   V  V  F  L 
Sbjct: 545 LIGHSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDV-QFSPLG 603

Query: 352 --IVSGSADKTVKVWHVESRTCYTLR---GHTGWVNCVKLHPKSFTCFSGSDDMTIRMWD 406
               + S D+T ++W  +    Y LR   GH   V+CV  HP     F+GS D T RMWD
Sbjct: 604 HYFATASHDQTARLWSCDH--IYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWD 661

Query: 407 IRTNTCVRVFHGHVGQV--QKVIP----LTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAA 460
           I T   VR+F GH   V    V P    L  GS+                          
Sbjct: 662 ISTGDSVRLFLGHTAPVLCTAVSPDGRWLATGSE-------------------------- 695

Query: 461 NFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGV---WDIAADNFRIVSGSH 517
                            D  I LW++ T   ++   GH +          +   +VSG  
Sbjct: 696 -----------------DGIINLWDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGA 738

Query: 518 DRSCKVWDLQ 527
           D S +VWDL+
Sbjct: 739 DHSVRVWDLK 748

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 58/217 (26%), Positives = 87/217 (40%), Gaps = 44/217 (20%)

Query: 337 GHQDSVL---SVD-SFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFT 392
           G QDS +   S+D S  K I   SAD ++    +   T  TL GH+G V      P +  
Sbjct: 505 GFQDSYIKLWSLDGSSLKQIQEKSAD-SINTGDMNDNTSTTLIGHSGAVYSTSFSPDNRY 563

Query: 393 CFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXX 452
             SGS+D T+R+W   T T +  + GH   V  V    LG                    
Sbjct: 564 LLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPLGH------------------- 604

Query: 453 XXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGV--WDIAADNF 510
                             +  + S D T +LW+      +R   GH+  V       +  
Sbjct: 605 ------------------YFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGC 646

Query: 511 RIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGI 547
            + +GS D++C++WD+ TG  +  F+G  APV C  +
Sbjct: 647 YVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAV 683

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 65/130 (50%), Gaps = 7/130 (5%)

Query: 249 IYRIQEFKGHMDGVXXXXXXXX--XXXTGSYDSTVAIWDLATGKLIRRLSGHTDGV--KA 304
           IY ++ F GH+  V             TGS D T  +WD++TG  +R   GHT  V   A
Sbjct: 623 IYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTA 682

Query: 305 LRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRK---LIVSGSADKTV 361
           +  D + L TGS D  I +W+  T   +   RGH  + +   S+ K   ++VSG AD +V
Sbjct: 683 VSPDGRWLATGSEDGIINLWDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSV 742

Query: 362 KVWHVESRTC 371
           +VW ++  T 
Sbjct: 743 RVWDLKKSTA 752

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 70/152 (46%), Gaps = 7/152 (4%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDD--QKLITGSLDKTIRVWNYVTGAC 331
           +GS D TV +W   T   +    GH   V  ++F        T S D+T R+W+      
Sbjct: 566 SGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPLGHYFATASHDQTARLWSCDHIYP 625

Query: 332 VSTYRGHQDSVLSVDSFRK---LIVSGSADKTVKVWHVESRTCYTL-RGHTGWVNCVKLH 387
           +  + GH   V  V SF      + +GS+DKT ++W + +     L  GHT  V C  + 
Sbjct: 626 LRIFAGHLSDVDCV-SFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVS 684

Query: 388 PKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGH 419
           P      +GS+D  I +WDI T   ++V  GH
Sbjct: 685 PDGRWLATGSEDGIINLWDIGTAKRLKVMRGH 716

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 62/265 (23%), Positives = 105/265 (39%), Gaps = 66/265 (24%)

Query: 301 GVKALRF-DDQKLIT-GSLDKTIRVWNY--------------------VTGACVSTYRGH 338
           G+ +L+F +D +L+  G  D  I++W+                     +     +T  GH
Sbjct: 489 GMTSLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADSINTGDMNDNTSTTLIGH 548

Query: 339 QDSVLSVDSF---RKLIVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHPKSFTCF 394
             +V S  SF    + ++SGS DKTV++W  ++ T   + +GH   V  V+  P      
Sbjct: 549 SGAVYST-SFSPDNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPLGHYFA 607

Query: 395 SGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXX 454
           + S D T R+W       +R+F GH+  V  V                            
Sbjct: 608 TASHDQTARLWSCDHIYPLRIFAGHLSDVDCV---------------------------- 639

Query: 455 XSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVW--DIAADNFRI 512
                 +F    P   ++ + S D T ++W++ TG  +R   GH   V    ++ D   +
Sbjct: 640 ------SFH---PNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWL 690

Query: 513 VSGSHDRSCKVWDLQTGKCMHTFVG 537
            +GS D    +WD+ T K +    G
Sbjct: 691 ATGSEDGIINLWDIGTAKRLKVMRG 715

>CAGL0I03718g complement(317565..321170) highly similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 Coatomer alpha
           subunit, start by similarity
          Length = 1201

 Score = 90.1 bits (222), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 72/268 (26%), Positives = 121/268 (45%), Gaps = 16/268 (5%)

Query: 277 YDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGACVST 334
           + ST+ +WD   G L+ R  GH   V+A+ F   +   ++   D +I+VW+  T  C+ T
Sbjct: 31  FSSTIQLWDYRMGTLLHRFEGHEGPVRAVDFHPTQPIFVSAGDDASIKVWSLETNRCLYT 90

Query: 335 YRGHQDSVLSVDSFRKL--IVSGSADKTVKVWHVESRTCYT-LRGHTGWVNCVKLHPKSF 391
             GH D V +V    +L  ++S S D+TV++W+ ++R     L GH  +V C + H    
Sbjct: 91  LTGHLDYVRTVFFHSELPWVISASDDQTVRIWNWQNRKELACLTGHNHFVMCAQFHQTED 150

Query: 392 TCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXX 451
              S S D T+R+WDI   + +R  H   G       L    +L++              
Sbjct: 151 LVVSASLDETVRVWDI---SGLRKKHSAPGVTSYEDSLASQQNLLD-GAFGDCKVKFILE 206

Query: 452 XXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGAC--IRTQFGHVEGVWDIA--A 507
                V  A+F  +LP    +++   D  +KLW + +     + T  GH   V  +    
Sbjct: 207 GHTRGVNWASFHPTLPL---IVTGGDDRQVKLWRMSSNKAWEVDTCRGHTNNVDCVVFHP 263

Query: 508 DNFRIVSGSHDRSCKVWDLQTGKCMHTF 535
           D   I+S + D++ ++WDL     +  F
Sbjct: 264 DQNLILSVAEDKTLRIWDLDKRTPVKQF 291

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 66/257 (25%), Positives = 104/257 (40%), Gaps = 30/257 (11%)

Query: 290 KLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVD- 346
           KL+ +    +   K + F   +   +      TI++W+Y  G  +  + GH+  V +VD 
Sbjct: 2   KLLTKFESKSTRAKGIAFHPSRPWALVALFSSTIQLWDYRMGTLLHRFEGHEGPVRAVDF 61

Query: 347 -SFRKLIVSGSADKTVKVWHVESRTC-YTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRM 404
              + + VS   D ++KVW +E+  C YTL GH  +V  V  H +     S SDD T+R+
Sbjct: 62  HPTQPIFVSAGDDASIKVWSLETNRCLYTLTGHLDYVRTVFFHSELPWVISASDDQTVRI 121

Query: 405 WDIRTNTCVRVFHGH-----VGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQA 459
           W+ +    +    GH       Q  +   L + + L E                   +  
Sbjct: 122 WNWQNRKELACLTGHNHFVMCAQFHQTEDLVVSASLDE-------------TVRVWDISG 168

Query: 460 ANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQF---GHVEGV-WDIAADNFR-IVS 514
               HS P  T     SL +   L +   G C + +F   GH  GV W         IV+
Sbjct: 169 LRKKHSAPGVTS-YEDSLASQQNLLDGAFGDC-KVKFILEGHTRGVNWASFHPTLPLIVT 226

Query: 515 GSHDRSCKVWDLQTGKC 531
           G  DR  K+W + + K 
Sbjct: 227 GGDDRQVKLWRMSSNKA 243

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/180 (30%), Positives = 80/180 (44%), Gaps = 37/180 (20%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVW------- 324
           + S D TV IW+    K +  L+GH   V   +F   +  +++ SLD+T+RVW       
Sbjct: 112 SASDDQTVRIWNWQNRKELACLTGHNHFVMCAQFHQTEDLVVSASLDETVRVWDISGLRK 171

Query: 325 ------------------NYVTGA---CVSTY--RGHQDSV--LSVDSFRKLIVSGSADK 359
                             N + GA   C   +   GH   V   S      LIV+G  D+
Sbjct: 172 KHSAPGVTSYEDSLASQQNLLDGAFGDCKVKFILEGHTRGVNWASFHPTLPLIVTGGDDR 231

Query: 360 TVKVWHVESRTCY---TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVF 416
            VK+W + S   +   T RGHT  V+CV  HP      S ++D T+R+WD+   T V+ F
Sbjct: 232 QVKLWRMSSNKAWEVDTCRGHTNNVDCVVFHPDQNLILSVAEDKTLRIWDLDKRTPVKQF 291

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 72/191 (37%), Gaps = 58/191 (30%)

Query: 360 TVKVWHVESRTC-YTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHG 418
           T+++W     T  +   GH G V  V  HP      S  DD +I++W + TN C+    G
Sbjct: 34  TIQLWDYRMGTLLHRFEGHEGPVRAVDFHPTQPIFVSAGDDASIKVWSLETNRCLYTLTG 93

Query: 419 HVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLD 478
           H+  V+ V                                   F   LP+   ++S S D
Sbjct: 94  HLDYVRTVF----------------------------------FHSELPW---VISASDD 116

Query: 479 NTIKLWN---VKTGACIR--------TQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQ 527
            T+++WN    K  AC+          QF   E +         +VS S D + +VWD+ 
Sbjct: 117 QTVRIWNWQNRKELACLTGHNHFVMCAQFHQTEDL---------VVSASLDETVRVWDIS 167

Query: 528 TGKCMHTFVGI 538
             +  H+  G+
Sbjct: 168 GLRKKHSAPGV 178

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/170 (21%), Positives = 66/170 (38%), Gaps = 39/170 (22%)

Query: 384 VKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXX 443
           +  HP            TI++WD R  T +  F GH G                      
Sbjct: 17  IAFHPSRPWALVALFSSTIQLWDYRMGTLLHRFEGHEG---------------------- 54

Query: 444 XXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVW 503
                        V+A +F  + P     +S   D +IK+W+++T  C+ T  GH++ V 
Sbjct: 55  ------------PVRAVDFHPTQPI---FVSAGDDASIKVWSLETNRCLYTLTGHLDYVR 99

Query: 504 DIA--ADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGIGDSE 551
            +   ++   ++S S D++ ++W+ Q  K +    G +  V C     +E
Sbjct: 100 TVFFHSELPWVISASDDQTVRIWNWQNRKELACLTGHNHFVMCAQFHQTE 149

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 54/119 (45%), Gaps = 7/119 (5%)

Query: 274 TGSYDSTVAIWDLATGKL--IRRLSGHTDGVKALRF-DDQKLITG-SLDKTIRVWNYVTG 329
           TG  D  V +W +++ K   +    GHT+ V  + F  DQ LI   + DKT+R+W+    
Sbjct: 226 TGGDDRQVKLWRMSSNKAWEVDTCRGHTNNVDCVVFHPDQNLILSVAEDKTLRIWDLDKR 285

Query: 330 ACVSTYRGHQDSVLSVDSFRKLIVSGSA-DKTVKVWHV--ESRTCYTLRGHTGWVNCVK 385
             V  ++   D    + S   + + G+A D  + ++ +  E     T +    +VN  K
Sbjct: 286 TPVKQFKRENDRFWLIRSHPNMSLFGAAHDSGIMIFKLDRERPAATTYQNQLFFVNKEK 344

>CAGL0M02277g complement(271836..273119) highly similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46 Pre-mRNA splicing
           factor PRP46, hypothetical start
          Length = 427

 Score = 87.8 bits (216), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 68/254 (26%), Positives = 105/254 (41%), Gaps = 46/254 (18%)

Query: 291 LIRRLSGHTDGVKAL---RFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSV--LSV 345
           L R + GH   V+ +   + D++   TGS DKTI++WN  +G    T + H  +V  L++
Sbjct: 107 LTRVIHGHHGWVRCIAMDKVDNEWFATGSNDKTIKIWNLASGKLKVTLKAHDMTVRDLAI 166

Query: 346 DSFRKLIVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRM 404
            +    + S S DKTVK W +E  T      GH   V+ V +HP      +   D  +++
Sbjct: 167 SNRHPYMFSVSEDKTVKCWDLEKNTAIRNYHGHLSGVHTVDIHPTVDVVVTAGRDSVVKV 226

Query: 405 WDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDH 464
           WDIRT   V    GH G + KV                                      
Sbjct: 227 WDIRTRLPVMTLPGHKGPITKV-------------------------------------R 249

Query: 465 SLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAA--DNFRIVSGSHDRSCK 522
            LP    ++S S+D +I+LW++  G  ++    H   V DI+     F   S   +   +
Sbjct: 250 CLPVDPQVISSSVDASIRLWDLVAGKSMKVLTHHQRTVRDISVHPSEFSFASACTN-DIR 308

Query: 523 VWDLQTGKCMHTFV 536
            W L  G+ +  FV
Sbjct: 309 SWLLPKGELLTNFV 322

 Score = 82.8 bits (203), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 78/158 (49%), Gaps = 5/158 (3%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGAC 331
           TGS D T+ IW+LA+GKL   L  H   V+ L   ++   + + S DKT++ W+      
Sbjct: 133 TGSNDKTIKIWNLASGKLKVTLKAHDMTVRDLAISNRHPYMFSVSEDKTVKCWDLEKNTA 192

Query: 332 VSTYRGHQDSVLSVD--SFRKLIVSGSADKTVKVWHVESR-TCYTLRGHTGWVNCVKLHP 388
           +  Y GH   V +VD      ++V+   D  VKVW + +R    TL GH G +  V+  P
Sbjct: 193 IRNYHGHLSGVHTVDIHPTVDVVVTAGRDSVVKVWDIRTRLPVMTLPGHKGPITKVRCLP 252

Query: 389 KSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKV 426
                 S S D +IR+WD+     ++V   H   V+ +
Sbjct: 253 VDPQVISSSVDASIRLWDLVAGKSMKVLTHHQRTVRDI 290

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 88/204 (43%), Gaps = 40/204 (19%)

Query: 352 IVSGSADKTVKVWHVES-RTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTN 410
             +GS DKT+K+W++ S +   TL+ H   V  + +  +    FS S+D T++ WD+  N
Sbjct: 131 FATGSNDKTIKIWNLASGKLKVTLKAHDMTVRDLAISNRHPYMFSVSEDKTVKCWDLEKN 190

Query: 411 TCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPT 470
           T +R +HGH+  V  V       D+                               P   
Sbjct: 191 TAIRNYHGHLSGVHTV-------DI------------------------------HPTVD 213

Query: 471 HLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDI--AADNFRIVSGSHDRSCKVWDLQT 528
            +++   D+ +K+W+++T   + T  GH   +  +     + +++S S D S ++WDL  
Sbjct: 214 VVVTAGRDSVVKVWDIRTRLPVMTLPGHKGPITKVRCLPVDPQVISSSVDASIRLWDLVA 273

Query: 529 GKCMHTFVGIHAPVACVGIGDSEF 552
           GK M         V  + +  SEF
Sbjct: 274 GKSMKVLTHHQRTVRDISVHPSEF 297

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 69/185 (37%), Gaps = 40/185 (21%)

Query: 364 WHVESRTCYTLRGHTGWVNCVKLHPKSFTCF-SGSDDMTIRMWDIRTNTCVRVFHGHVGQ 422
           WH        + GH GWV C+ +       F +GS+D TI++W++ +         H   
Sbjct: 101 WHAPWHLTRVIHGHHGWVRCIAMDKVDNEWFATGSNDKTIKIWNLASGKLKVTLKAH--- 157

Query: 423 VQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIK 482
                                            +V+     +  PY   + S S D T+K
Sbjct: 158 -------------------------------DMTVRDLAISNRHPY---MFSVSEDKTVK 183

Query: 483 LWNVKTGACIRTQFGHVEGVW--DIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHA 540
            W+++    IR   GH+ GV   DI      +V+   D   KVWD++T   + T  G   
Sbjct: 184 CWDLEKNTAIRNYHGHLSGVHTVDIHPTVDVVVTAGRDSVVKVWDIRTRLPVMTLPGHKG 243

Query: 541 PVACV 545
           P+  V
Sbjct: 244 PITKV 248

>KLLA0F04884g complement(478044..481682) similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 coatomer complex
           alpha chain of secretory pathway vesicles, start by
           similarity
          Length = 1212

 Score = 89.4 bits (220), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 72/274 (26%), Positives = 120/274 (43%), Gaps = 28/274 (10%)

Query: 277 YDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGACVST 334
           + ST+ +WD   G L+ R   H   V+ + F   +   ++   D TI+VW+  +  C+ T
Sbjct: 31  FSSTIQLWDYRMGVLLHRFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVWSLESNKCLFT 90

Query: 335 YRGHQDSVLSVDSFRKL--IVSGSADKTVKVWHVESRTCYT-LRGHTGWVNCVKLHPKSF 391
             GH D V +V    +L  I+S S D+T+++W+ ++R     L GH  +V C + HP   
Sbjct: 91  LDGHLDYVRTVFFHHELPWIISSSDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPVED 150

Query: 392 TCFSGSDDMTIRMWDI------RTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXX 445
              S S D T+R+WDI       +    + F   + Q Q ++    G  +++        
Sbjct: 151 LVVSASLDETVRVWDISGLRKRHSAPGTQSFEEQMRQQQNLLDGGFGDCVVKFILEGHTR 210

Query: 446 XXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGAC--IRTQFGHVEGVW 503
                      V  A+F  +LP    ++S S D  +KLW +       + T  GH   V 
Sbjct: 211 ----------GVNWASFHPTLPL---IVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVD 257

Query: 504 DIA--ADNFRIVSGSHDRSCKVWDLQTGKCMHTF 535
            +        I+S   D++ +VWDL     +  F
Sbjct: 258 SVIFHPQQNLIISVGEDKTVRVWDLDKRTPIKQF 291

 Score = 75.9 bits (185), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 97/239 (40%), Gaps = 41/239 (17%)

Query: 229 RPWKVVYRERFKVES-NWRKGI--YRIQEFKGHMDGVXXXXXXXXXXXTGSYDSTVAIWD 285
           RPW +V      ++  ++R G+  +R ++ +G + G+            G  D T+ +W 
Sbjct: 23  RPWVLVALFSSTIQLWDYRMGVLLHRFEDHEGPVRGIDFHPTQPLFVSAGD-DYTIKVWS 81

Query: 286 LATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGACVSTYRGHQDSVL 343
           L + K +  L GH D V+ + F  +   +I+ S D+TIR+WN+     ++   GH   V+
Sbjct: 82  LESNKCLFTLDGHLDYVRTVFFHHELPWIISSSDDQTIRIWNWQNRKEIACLTGHNHFVM 141

Query: 344 --SVDSFRKLIVSGSADKTVKVWHVESR-------------------------------T 370
                    L+VS S D+TV+VW +                                   
Sbjct: 142 CAQFHPVEDLVVSASLDETVRVWDISGLRKRHSAPGTQSFEEQMRQQQNLLDGGFGDCVV 201

Query: 371 CYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTC--VRVFHGHVGQVQKVI 427
            + L GHT  VN    HP      SGSDD  +++W +       V    GH   V  VI
Sbjct: 202 KFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVI 260

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 101/257 (39%), Gaps = 30/257 (11%)

Query: 290 KLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVD- 346
           K++ +    +   K + F   +  ++      TI++W+Y  G  +  +  H+  V  +D 
Sbjct: 2   KMLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGVLLHRFEDHEGPVRGIDF 61

Query: 347 -SFRKLIVSGSADKTVKVWHVESRTC-YTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRM 404
              + L VS   D T+KVW +ES  C +TL GH  +V  V  H +     S SDD TIR+
Sbjct: 62  HPTQPLFVSAGDDYTIKVWSLESNKCLFTLDGHLDYVRTVFFHHELPWIISSSDDQTIRI 121

Query: 405 WDIRTNTCVRVFHGH-----VGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQA 459
           W+ +    +    GH       Q   V  L + + L E                   +  
Sbjct: 122 WNWQNRKEIACLTGHNHFVMCAQFHPVEDLVVSASLDE-------------TVRVWDISG 168

Query: 460 ANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQF---GHVEGV-WDIAADNFR-IVS 514
               HS P  T      +     L +   G C+  +F   GH  GV W         IVS
Sbjct: 169 LRKRHSAP-GTQSFEEQMRQQQNLLDGGFGDCV-VKFILEGHTRGVNWASFHPTLPLIVS 226

Query: 515 GSHDRSCKVWDLQTGKC 531
           GS DR  K+W +   K 
Sbjct: 227 GSDDRQVKLWRMSATKA 243

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 79/180 (43%), Gaps = 37/180 (20%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFD--DQKLITGSLDKTIRVWNYV---- 327
           + S D T+ IW+    K I  L+GH   V   +F   +  +++ SLD+T+RVW+      
Sbjct: 112 SSSDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPVEDLVVSASLDETVRVWDISGLRK 171

Query: 328 ------------------------TGACVSTY--RGHQDSV--LSVDSFRKLIVSGSADK 359
                                    G CV  +   GH   V   S      LIVSGS D+
Sbjct: 172 RHSAPGTQSFEEQMRQQQNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDR 231

Query: 360 TVKVWHVESRTCY---TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVF 416
            VK+W + +   +   T RGHT  V+ V  HP+     S  +D T+R+WD+   T ++ F
Sbjct: 232 QVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPQQNLIISVGEDKTVRVWDLDKRTPIKQF 291

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 72/193 (37%), Gaps = 58/193 (30%)

Query: 360 TVKVWHVESRTC-YTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHG 418
           T+++W        +    H G V  +  HP      S  DD TI++W + +N C+    G
Sbjct: 34  TIQLWDYRMGVLLHRFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVWSLESNKCLFTLDG 93

Query: 419 HVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLD 478
           H+  V+ V                                   F H LP+   ++S S D
Sbjct: 94  HLDYVRTVF----------------------------------FHHELPW---IISSSDD 116

Query: 479 NTIKLWN---VKTGACIR--------TQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQ 527
            TI++WN    K  AC+          QF  VE +         +VS S D + +VWD+ 
Sbjct: 117 QTIRIWNWQNRKEIACLTGHNHFVMCAQFHPVEDL---------VVSASLDETVRVWDIS 167

Query: 528 TGKCMHTFVGIHA 540
             +  H+  G  +
Sbjct: 168 GLRKRHSAPGTQS 180

 Score = 37.4 bits (85), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 34/163 (20%), Positives = 61/163 (37%), Gaps = 39/163 (23%)

Query: 384 VKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXX 443
           +  HP            TI++WD R    +  F  H G V+ +                 
Sbjct: 17  IAFHPSRPWVLVALFSSTIQLWDYRMGVLLHRFEDHEGPVRGI----------------- 59

Query: 444 XXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVW 503
                            +F  + P     +S   D TIK+W++++  C+ T  GH++ V 
Sbjct: 60  -----------------DFHPTQPL---FVSAGDDYTIKVWSLESNKCLFTLDGHLDYVR 99

Query: 504 DIAADNFR--IVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVAC 544
            +   +    I+S S D++ ++W+ Q  K +    G +  V C
Sbjct: 100 TVFFHHELPWIISSSDDQTIRIWNWQNRKEIACLTGHNHFVMC 142

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 43/88 (48%), Gaps = 4/88 (4%)

Query: 274 TGSYDSTVAIWDLATGKL--IRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTG 329
           +GS D  V +W ++  K   +    GHT+ V ++ F  Q+  +I+   DKT+RVW+    
Sbjct: 226 SGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPQQNLIISVGEDKTVRVWDLDKR 285

Query: 330 ACVSTYRGHQDSVLSVDSFRKLIVSGSA 357
             +  ++   D    V +   L + G+A
Sbjct: 286 TPIKQFKRENDRFWLVRAHPNLNLFGAA 313

>ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH]
           (843171..846785) [3615 bp, 1204 aa]
          Length = 1204

 Score = 89.4 bits (220), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 73/268 (27%), Positives = 119/268 (44%), Gaps = 16/268 (5%)

Query: 277 YDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGACVST 334
           + ST+ +WD   G L+ R   H   V+ + F   +   ++   D +I+VW+  T  C+ T
Sbjct: 31  FSSTIQLWDYRMGVLLHRFEEHEGPVRGVDFHPTQPLFVSAGDDYSIKVWSLSTHKCLFT 90

Query: 335 YRGHQDSVLSVDSFRKL--IVSGSADKTVKVWHVESR-TCYTLRGHTGWVNCVKLHPKSF 391
             GH D V +V    +L  I+S S D+T+++W+ ++R     L GH  +V C + HP   
Sbjct: 91  LNGHLDYVRTVFFHTELPWIISASDDQTIRIWNWQNRREIACLTGHNHFVMCAQFHPTED 150

Query: 392 TCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXX 451
              S S D T+R+WDI   + +R  H   G       +    +L +              
Sbjct: 151 LVVSASLDETVRIWDI---SGLRKRHSAPGSQSFEEQMITQQNLFD-GGFGDCVVKFILE 206

Query: 452 XXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGAC--IRTQFGHVEGVWDIAADN 509
                V  A+F  +LP    ++S S D  +KLW + +     + T  GH   V  +    
Sbjct: 207 GHTRGVNWASFHPTLPL---IVSGSDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHP 263

Query: 510 FR--IVSGSHDRSCKVWDLQTGKCMHTF 535
           F+  I+S   D + +VWDL     +  F
Sbjct: 264 FQNLIISVGEDSTIRVWDLDKRTPVKQF 291

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 70/270 (25%), Positives = 106/270 (39%), Gaps = 83/270 (30%)

Query: 229 RPWKVVYRERFKVES-NWRKGI--YRIQEFKGHMDGVXXXXXXXXXXXTGSYDSTVAIWD 285
           RPW +V      ++  ++R G+  +R +E +G + GV            G  D ++ +W 
Sbjct: 23  RPWVLVALFSSTIQLWDYRMGVLLHRFEEHEGPVRGVDFHPTQPLFVSAGD-DYSIKVWS 81

Query: 286 LATGKLIRRLSGHTDGVKALRF-----------DDQKL---------------------- 312
           L+T K +  L+GH D V+ + F           DDQ +                      
Sbjct: 82  LSTHKCLFTLNGHLDYVRTVFFHTELPWIISASDDQTIRIWNWQNRREIACLTGHNHFVM 141

Query: 313 -----------ITGSLDKTIRVWN-------------------YVT---------GACVS 333
                      ++ SLD+T+R+W+                    +T         G CV 
Sbjct: 142 CAQFHPTEDLVVSASLDETVRIWDISGLRKRHSAPGSQSFEEQMITQQNLFDGGFGDCVV 201

Query: 334 TY--RGHQDSV--LSVDSFRKLIVSGSADKTVKVWHVESRTCY---TLRGHTGWVNCVKL 386
            +   GH   V   S      LIVSGS D+ VK+W + S   +   T RGHT  V+ V  
Sbjct: 202 KFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIF 261

Query: 387 HPKSFTCFSGSDDMTIRMWDIRTNTCVRVF 416
           HP      S  +D TIR+WD+   T V+ F
Sbjct: 262 HPFQNLIISVGEDSTIRVWDLDKRTPVKQF 291

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 67/282 (23%), Positives = 106/282 (37%), Gaps = 80/282 (28%)

Query: 290 KLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVD- 346
           K++ +    +   KA+ F   +  ++      TI++W+Y  G  +  +  H+  V  VD 
Sbjct: 2   KMLTKFESKSTRAKAIAFHPSRPWVLVALFSSTIQLWDYRMGVLLHRFEEHEGPVRGVDF 61

Query: 347 -SFRKLIVSGSADKTVKVWHVESRTC-YTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRM 404
              + L VS   D ++KVW + +  C +TL GH  +V  V  H +     S SDD TIR+
Sbjct: 62  HPTQPLFVSAGDDYSIKVWSLSTHKCLFTLNGHLDYVRTVFFHTELPWIISASDDQTIRI 121

Query: 405 WDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDH 464
           W+ +    +    GH                                     V  A F  
Sbjct: 122 WNWQNRREIACLTGH----------------------------------NHFVMCAQF-- 145

Query: 465 SLPYPTH--LLSCSLDNTIKLWNVK----------------------------TGACIRT 494
              +PT   ++S SLD T+++W++                              G C+  
Sbjct: 146 ---HPTEDLVVSASLDETVRIWDISGLRKRHSAPGSQSFEEQMITQQNLFDGGFGDCV-V 201

Query: 495 QF---GHVEGV-WDIAADNFR-IVSGSHDRSCKVWDLQTGKC 531
           +F   GH  GV W         IVSGS DR  K+W + + K 
Sbjct: 202 KFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSSTKA 243

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 67/181 (37%), Gaps = 40/181 (22%)

Query: 360 TVKVWHVESRTC-YTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHG 418
           T+++W        +    H G V  V  HP      S  DD +I++W + T+ C+   +G
Sbjct: 34  TIQLWDYRMGVLLHRFEEHEGPVRGVDFHPTQPLFVSAGDDYSIKVWSLSTHKCLFTLNG 93

Query: 419 HVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLD 478
           H+  V+ V                                   F   LP+   ++S S D
Sbjct: 94  HLDYVRTVF----------------------------------FHTELPW---IISASDD 116

Query: 479 NTIKLWNVKTGACIRTQFGHVEGVW--DIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFV 536
            TI++WN +    I    GH   V           +VS S D + ++WD+   +  H+  
Sbjct: 117 QTIRIWNWQNRREIACLTGHNHFVMCAQFHPTEDLVVSASLDETVRIWDISGLRKRHSAP 176

Query: 537 G 537
           G
Sbjct: 177 G 177

 Score = 38.1 bits (87), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 37/83 (44%), Gaps = 7/83 (8%)

Query: 458 QAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACI---RTQFGHVEGVWDIAADNFRIVS 514
           +A  F  S P+   +L     +TI+LW+ + G  +       G V GV D        VS
Sbjct: 15  KAIAFHPSRPW---VLVALFSSTIQLWDYRMGVLLHRFEEHEGPVRGV-DFHPTQPLFVS 70

Query: 515 GSHDRSCKVWDLQTGKCMHTFVG 537
              D S KVW L T KC+ T  G
Sbjct: 71  AGDDYSIKVWSLSTHKCLFTLNG 93

 Score = 37.7 bits (86), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 37/179 (20%), Positives = 60/179 (33%), Gaps = 55/179 (30%)

Query: 383 CVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXX 442
            +  HP            TI++WD R    +  F  H G V+ V                
Sbjct: 16  AIAFHPSRPWVLVALFSSTIQLWDYRMGVLLHRFEEHEGPVRGV---------------- 59

Query: 443 XXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGAC----------I 492
                             +F  + P     +S   D +IK+W++ T  C          +
Sbjct: 60  ------------------DFHPTQPL---FVSAGDDYSIKVWSLSTHKCLFTLNGHLDYV 98

Query: 493 RTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGIGDSE 551
           RT F H E  W        I+S S D++ ++W+ Q  + +    G +  V C     +E
Sbjct: 99  RTVFFHTELPW--------IISASDDQTIRIWNWQNRREIACLTGHNHFVMCAQFHPTE 149

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 49/99 (49%), Gaps = 5/99 (5%)

Query: 274 TGSYDSTVAIWDLATGKL--IRRLSGHTDGVKALRFD--DQKLITGSLDKTIRVWNYVTG 329
           +GS D  V +W +++ K   +    GHT+ V ++ F      +I+   D TIRVW+    
Sbjct: 226 SGSDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPFQNLIISVGEDSTIRVWDLDKR 285

Query: 330 ACVSTYRGHQDSVLSVDSFRKLIVSGSA-DKTVKVWHVE 367
             V  ++  QD   S+ +   + + G+A D  + V+ ++
Sbjct: 286 TPVKQFKREQDRFWSIRAHPNVNLFGAAHDSGIMVFKLD 324

>YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative
           spliceosomal protein with similarity to S. pombe prp5p,
           has four WD (WD-40) repeats [1356 bp, 451 aa]
          Length = 451

 Score = 87.8 bits (216), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 78/151 (51%), Gaps = 5/151 (3%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGAC 331
           TGS D+T+ +WDLATGKL   L+GH   V+ +   D+   L + S DKT++ W+      
Sbjct: 157 TGSNDTTMKVWDLATGKLKTTLAGHVMTVRDVAVSDRHPYLFSVSEDKTVKCWDLEKNQI 216

Query: 332 VSTYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWHVESRT-CYTLRGHTGWVNCVKLHP 388
           +  Y GH   V  +S+     LI +   D  +K+W + +R    TL GH G +N V+  P
Sbjct: 217 IRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLWDMRTRIPVITLVGHKGPINQVQCTP 276

Query: 389 KSFTCFSGSDDMTIRMWDIRTNTCVRVFHGH 419
                 S S D T+R+WD+     ++V   H
Sbjct: 277 VDPQVVSSSTDATVRLWDVVAGKTMKVLTHH 307

 Score = 78.6 bits (192), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 68/257 (26%), Positives = 102/257 (39%), Gaps = 46/257 (17%)

Query: 287 ATGKLIRRLSGHTDGVKALRFD---DQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSV- 342
           A  KL R ++GH   V+ +  D   ++  ITGS D T++VW+  TG   +T  GH  +V 
Sbjct: 127 APWKLSRVINGHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAGHVMTVR 186

Query: 343 -LSVDSFRKLIVSGSADKTVKVWHVE-SRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDM 400
            ++V      + S S DKTVK W +E ++      GH   V  V +HP      +   D 
Sbjct: 187 DVAVSDRHPYLFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDS 246

Query: 401 TIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAA 460
            I++WD+RT   V    GH G + +V                                  
Sbjct: 247 VIKLWDMRTRIPVITLVGHKGPINQV---------------------------------- 272

Query: 461 NFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA--ADNFRIVSGSHD 518
                 P    ++S S D T++LW+V  G  ++    H   V   A     F + S   D
Sbjct: 273 ---QCTPVDPQVVSSSTDATVRLWDVVAGKTMKVLTHHKRSVRATALHPKEFSVASACTD 329

Query: 519 RSCKVWDLQTGKCMHTF 535
              + W L  G  +  F
Sbjct: 330 -DIRSWGLAEGSLLTNF 345

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 76/185 (41%), Gaps = 40/185 (21%)

Query: 364 WHVESRTCYTLRGHTGWVNCVKLHPKSFTCF-SGSDDMTIRMWDIRTNTCVRVFHGHVGQ 422
           WH   +    + GH GWV CV + P     F +GS+D T+++WD+ T        GHV  
Sbjct: 125 WHAPWKLSRVINGHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAGHVMT 184

Query: 423 VQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIK 482
           V+ V                                A +  H  PY   L S S D T+K
Sbjct: 185 VRDV--------------------------------AVSDRH--PY---LFSVSEDKTVK 207

Query: 483 LWNVKTGACIRTQFGHVEGVWDIAADNF--RIVSGSHDRSCKVWDLQTGKCMHTFVGIHA 540
            W+++    IR  +GH+ GV  ++       I +   D   K+WD++T   + T VG   
Sbjct: 208 CWDLEKNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLWDMRTRIPVITLVGHKG 267

Query: 541 PVACV 545
           P+  V
Sbjct: 268 PINQV 272

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 53/205 (25%), Positives = 86/205 (41%), Gaps = 42/205 (20%)

Query: 352 IVSGSADKTVKVWHVES-RTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTN 410
            ++GS D T+KVW + + +   TL GH   V  V +  +    FS S+D T++ WD+  N
Sbjct: 155 FITGSNDTTMKVWDLATGKLKTTLAGHVMTVRDVAVSDRHPYLFSVSEDKTVKCWDLEKN 214

Query: 411 TCVRVFHGHVGQVQKV-IPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYP 469
             +R ++GH+  V+ V I  TL  DLI                                 
Sbjct: 215 QIIRDYYGHLSGVRTVSIHPTL--DLIA-------------------------------- 240

Query: 470 THLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAAD--NFRIVSGSHDRSCKVWDLQ 527
               +   D+ IKLW+++T   + T  GH   +  +     + ++VS S D + ++WD+ 
Sbjct: 241 ----TAGRDSVIKLWDMRTRIPVITLVGHKGPINQVQCTPVDPQVVSSSTDATVRLWDVV 296

Query: 528 TGKCMHTFVGIHAPVACVGIGDSEF 552
            GK M         V    +   EF
Sbjct: 297 AGKTMKVLTHHKRSVRATALHPKEF 321

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 28/145 (19%), Positives = 61/145 (42%), Gaps = 14/145 (9%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKL-ITGSLDKTIRVWNYVTGACV 332
           + S D+TV +WD+  GK ++ L+ H   V+A     ++  +  +    IR W    G+ +
Sbjct: 283 SSSTDATVRLWDVVAGKTMKVLTHHKRSVRATALHPKEFSVASACTDDIRSWGLAEGSLL 342

Query: 333 STYRGHQDSVLSVDSFRK--LIVSGSADKTVKVWHVESRTCY----------TLRGHTGW 380
           + +   +  +++  S  +  ++ +G  +  +  +  +S   Y          +L G    
Sbjct: 343 TNFESEKTGIINTLSINQDDVLFAGGDNGVLSFYDYKSGHKYQSLATREMVGSLEGERS- 401

Query: 381 VNCVKLHPKSFTCFSGSDDMTIRMW 405
           V C           +G  D +I++W
Sbjct: 402 VLCSTFDKTGLRLITGEADKSIKIW 426

 Score = 37.0 bits (84), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 28/63 (44%)

Query: 487 KTGACIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVG 546
           K    I    G V  V     DN   ++GS+D + KVWDL TGK   T  G    V  V 
Sbjct: 130 KLSRVINGHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAGHVMTVRDVA 189

Query: 547 IGD 549
           + D
Sbjct: 190 VSD 192

>Sklu_2420.2 YPL151C, Contig c2420 3924-5249
          Length = 441

 Score = 87.8 bits (216), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 69/257 (26%), Positives = 103/257 (40%), Gaps = 46/257 (17%)

Query: 287 ATGKLIRRLSGHTDGVKALR---FDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSV- 342
           A  KL+R ++GH   V+ +     D++   TGS D TI++W+  TG    T  GH  +V 
Sbjct: 117 APWKLMRVINGHNGWVRTVAVDPIDNEWFATGSNDTTIKIWDLATGKLKLTLSGHIMTVK 176

Query: 343 -LSVDSFRKLIVSGSADKTVKVWHVE-SRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDM 400
            + +      + S S DK VK W +E +R      GH   V+ V +HP      +   D 
Sbjct: 177 DICISKRHPYMFSASEDKLVKCWDLEKNRVIRDYHGHLSGVHTVDIHPTLNLIATAGRDS 236

Query: 401 TIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAA 460
            +R+WDIRT   V    GH   + +V                                  
Sbjct: 237 VVRLWDIRTKLPVMTMAGHKSPINRV---------------------------------- 262

Query: 461 NFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA--ADNFRIVSGSHD 518
                LP    ++SCS D T++LW++  G  ++    H   V DI      F I S   D
Sbjct: 263 ---KCLPVDPQVVSCSADATVRLWDITAGKTLKVLTHHKRSVRDIGIHPGEFSISSACTD 319

Query: 519 RSCKVWDLQTGKCMHTF 535
              + W L  G+ +  F
Sbjct: 320 -DIRSWKLPEGQLLTNF 335

 Score = 84.3 bits (207), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 53/158 (33%), Positives = 78/158 (49%), Gaps = 5/158 (3%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGAC 331
           TGS D+T+ IWDLATGKL   LSGH   VK +    +   + + S DK ++ W+      
Sbjct: 147 TGSNDTTIKIWDLATGKLKLTLSGHIMTVKDICISKRHPYMFSASEDKLVKCWDLEKNRV 206

Query: 332 VSTYRGHQDSVLSVD--SFRKLIVSGSADKTVKVWHVESR-TCYTLRGHTGWVNCVKLHP 388
           +  Y GH   V +VD      LI +   D  V++W + ++    T+ GH   +N VK  P
Sbjct: 207 IRDYHGHLSGVHTVDIHPTLNLIATAGRDSVVRLWDIRTKLPVMTMAGHKSPINRVKCLP 266

Query: 389 KSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKV 426
                 S S D T+R+WDI     ++V   H   V+ +
Sbjct: 267 VDPQVVSCSADATVRLWDITAGKTLKVLTHHKRSVRDI 304

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 83/204 (40%), Gaps = 40/204 (19%)

Query: 352 IVSGSADKTVKVWHVES-RTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTN 410
             +GS D T+K+W + + +   TL GH   V  + +  +    FS S+D  ++ WD+  N
Sbjct: 145 FATGSNDTTIKIWDLATGKLKLTLSGHIMTVKDICISKRHPYMFSASEDKLVKCWDLEKN 204

Query: 411 TCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPT 470
             +R +HGH+  V  V       D+                               P   
Sbjct: 205 RVIRDYHGHLSGVHTV-------DI------------------------------HPTLN 227

Query: 471 HLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQT 528
            + +   D+ ++LW+++T   + T  GH   +  +     + ++VS S D + ++WD+  
Sbjct: 228 LIATAGRDSVVRLWDIRTKLPVMTMAGHKSPINRVKCLPVDPQVVSCSADATVRLWDITA 287

Query: 529 GKCMHTFVGIHAPVACVGIGDSEF 552
           GK +         V  +GI   EF
Sbjct: 288 GKTLKVLTHHKRSVRDIGIHPGEF 311

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 70/185 (37%), Gaps = 40/185 (21%)

Query: 364 WHVESRTCYTLRGHTGWVNCVKLHPKSFTCF-SGSDDMTIRMWDIRTNTCVRVFHGHVGQ 422
           WH   +    + GH GWV  V + P     F +GS+D TI++WD+ T        GH+  
Sbjct: 115 WHAPWKLMRVINGHNGWVRTVAVDPIDNEWFATGSNDTTIKIWDLATGKLKLTLSGHIMT 174

Query: 423 VQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIK 482
           V+ +                                        PY   + S S D  +K
Sbjct: 175 VKDIC----------------------------------ISKRHPY---MFSASEDKLVK 197

Query: 483 LWNVKTGACIRTQFGHVEGVW--DIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHA 540
            W+++    IR   GH+ GV   DI      I +   D   ++WD++T   + T  G  +
Sbjct: 198 CWDLEKNRVIRDYHGHLSGVHTVDIHPTLNLIATAGRDSVVRLWDIRTKLPVMTMAGHKS 257

Query: 541 PVACV 545
           P+  V
Sbjct: 258 PINRV 262

 Score = 29.6 bits (65), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 32/73 (43%), Gaps = 10/73 (13%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSG--------HTDGVKALRFDDQ--KLITGSLDKTIRVW 324
           GS +  ++ +D  TG   ++L             G+    FD    +LITG  DK+I++W
Sbjct: 357 GSDNGVLSFYDYKTGHKYQQLDTTEIPGSLESERGILTSTFDQTGLRLITGESDKSIKIW 416

Query: 325 NYVTGACVSTYRG 337
                A   TY G
Sbjct: 417 KQDQDATPETYTG 429

>Sklu_2442.2 YNL006W, Contig c2442 3831-4742
          Length = 303

 Score = 85.5 bits (210), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 80/301 (26%), Positives = 127/301 (42%), Gaps = 30/301 (9%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF-DDQKLITGSLDKTIRVWNYVTGAC- 331
           +  YD T+  W+  TG   R +      V  L    D++ +  +    +R+++  T    
Sbjct: 7   SAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKRFLAAAGHLHVRLYDIRTTNPN 66

Query: 332 -VSTYRGHQDSVLSVDSFR---KLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLH 387
            V+++ GH+ +V S+ SF+   K +VS S D T+KVW V + +      H   VN V +H
Sbjct: 67  PVTSFEGHRGNVTSI-SFQQDNKWMVSSSEDGTIKVWDVRAPSVQRNYKHHAPVNEVVIH 125

Query: 388 PKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQ-VQKVIPLTLGSDLIEXXXXXXXXX 446
           P      S   D  IR+WD+  N C           +Q +   + GS L+          
Sbjct: 126 PNQGELISCDQDGNIRIWDLGENQCTHQLTPEDDTPLQSLSIASDGSMLV----AGNNKG 181

Query: 447 XXXXXXXXXSVQAAN------FDHSLPYPT---------HLLSCSLDNTIKLWNVKTGAC 491
                       AAN      F     Y T         HL +CS D+T ++W+++    
Sbjct: 182 NCYVWQMPNHTDAANLKPVTKFRSHTKYITRVLLSSDVKHLATCSADHTARVWSIEDNFK 241

Query: 492 IRTQF-GHVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGIG 548
           + T   GH   VWD A  AD+  +V+   D   ++WDL T + +  + G H    CV + 
Sbjct: 242 LETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAVCVALN 301

Query: 549 D 549
           D
Sbjct: 302 D 302

 Score = 48.9 bits (115), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 48/224 (21%), Positives = 85/224 (37%), Gaps = 49/224 (21%)

Query: 312 LITGSLDKTIRVWNYVTGACVSTYRGHQDSV---LSVDSFRKLIVSGSADKTVKVWHVES 368
           L +   D TIR W  +TG C  T + H DS    L + S ++ + + +    V+++ + +
Sbjct: 5   LASAGYDHTIRFWEALTGVCSRTIQ-HADSQVNRLEITSDKRFL-AAAGHLHVRLYDIRT 62

Query: 369 RT---CYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQK 425
                  +  GH G V  +     +    S S+D TI++WD+R  +  R +  H    + 
Sbjct: 63  TNPNPVTSFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVQRNYKHHAPVNEV 122

Query: 426 VIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWN 485
           VI                                       P    L+SC  D  I++W+
Sbjct: 123 VIH--------------------------------------PNQGELISCDQDGNIRIWD 144

Query: 486 VKTGACIRTQFGHVEG---VWDIAADNFRIVSGSHDRSCKVWDL 526
           +    C        +       IA+D   +V+G++  +C VW +
Sbjct: 145 LGENQCTHQLTPEDDTPLQSLSIASDGSMLVAGNNKGNCYVWQM 188

>Kwal_0.212
          Length = 303

 Score = 84.7 bits (208), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 77/300 (25%), Positives = 123/300 (41%), Gaps = 28/300 (9%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFD-DQKLITGSLDKTIRVWNYVTGAC- 331
           +  YD T+  W+  TG   R +      V  L    D++ +  +    +R+++  T    
Sbjct: 7   SAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTTNPN 66

Query: 332 -VSTYRGHQDSVLSV--DSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHP 388
            V+++ GH+ +V S+      K +VS S D T+KVW V + +      H   VN V +HP
Sbjct: 67  PVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVVIHP 126

Query: 389 KSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQ-VQKVIPLTLGSDLIEXXXXXXXXXX 447
                 S   D  +R+WD+  N CV          +Q +   + GS L+           
Sbjct: 127 NQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLV----AGNNKGN 182

Query: 448 XXXXXXXXSVQAAN------FDHSLPYPT---------HLLSCSLDNTIKLWNVKTGACI 492
                      AAN      F     Y T         HL +CS D+T ++W++     +
Sbjct: 183 CYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQL 242

Query: 493 RTQF-GHVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGIGD 549
            T    H   VWD A  AD+  +V+   D   ++WDL T + +  + G H    CV + D
Sbjct: 243 ETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVALND 302

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/225 (20%), Positives = 89/225 (39%), Gaps = 51/225 (22%)

Query: 312 LITGSLDKTIRVWNYVTGACVSTYRGHQDSV---LSVDSFRKLIVSGSADKTVKVWHVES 368
           L +   D TIR W  +TG C  T + H DS    L + S ++ + + +    V+++ + +
Sbjct: 5   LASAGYDHTIRFWEALTGVCSRTIQ-HSDSQVNRLEISSDKRFL-AAAGHLNVRLYDIRT 62

Query: 369 RT---CYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQK 425
                  +  GH G V  +    ++    S S+D TI++WD+R  +  R +  H   V +
Sbjct: 63  TNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNY-KHQAAVNE 121

Query: 426 VIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWN 485
           V+                                       P    L+SC  D  +++W+
Sbjct: 122 VVI-------------------------------------HPNQGELISCDQDGNVRIWD 144

Query: 486 VKTGACIRTQFGHVEGV----WDIAADNFRIVSGSHDRSCKVWDL 526
           +    C+  Q    +        +A+D   +V+G++  +C VW +
Sbjct: 145 LGENQCVH-QLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQM 188

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 65/172 (37%), Gaps = 13/172 (7%)

Query: 252 IQEFKGHMDGVXXXXXXXXX--XXTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDD 309
           +  F+GH   V             + S D T+ +WD+    + R         + +   +
Sbjct: 68  VTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVVIHPN 127

Query: 310 Q-KLITGSLDKTIRVWNYVTGACVSTYRGHQDS---VLSVDSFRKLIVSGSADKTVKVWH 365
           Q +LI+   D  +R+W+     CV       D+    LSV S   ++V+G+      VW 
Sbjct: 128 QGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQ 187

Query: 366 VESRT-------CYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTN 410
           +  +T           R H  ++  V L        + S D T R+W I  N
Sbjct: 188 MPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDN 239

>Kwal_27.12053
          Length = 755

 Score = 87.4 bits (215), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 74/277 (26%), Positives = 113/277 (40%), Gaps = 64/277 (23%)

Query: 275 GSYDSTVAIWDLATGKLIRRLS-------------GHTDGVKALRF--DDQKLITGSLDK 319
           G  DS + IW L    L  +L              GH+  V +  F  D++ L++ S DK
Sbjct: 445 GFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLVGHSGTVYSTSFSPDNRYLLSASEDK 504

Query: 320 TIRVWNYVTGACVSTYRGHQDSVLSVDSFRKL---IVSGSADKTVKVWHVESRTCYTLR- 375
           T+R+W+  T   +  Y+GH   +  V +F  L     + S D+T ++W  +    Y LR 
Sbjct: 505 TVRLWSTDTYTSLVNYKGHNHPIWDV-AFSPLGHYFATASHDQTARLWSCDH--IYPLRI 561

Query: 376 --GHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGS 433
             GH   V+ V  HP     F+GS D T RMWDI +   VR+F GH   V          
Sbjct: 562 FAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTA------ 615

Query: 434 DLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIR 493
                                            P    L + S D  I +W++ TG  ++
Sbjct: 616 -------------------------------VSPDGRWLSTGSEDGVINVWDIGTGKRLK 644

Query: 494 TQFGH-VEGVWDI--AADNFRIVSGSHDRSCKVWDLQ 527
              GH    V+ +  + +   ++SG  D S +VWD++
Sbjct: 645 QMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDVK 681

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 66/130 (50%), Gaps = 7/130 (5%)

Query: 249 IYRIQEFKGHMDGVXXXX--XXXXXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGV--KA 304
           IY ++ F GH++ V             TGS D T  +WD+ +G  +R   GHT  V   A
Sbjct: 556 IYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTA 615

Query: 305 LRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRK---LIVSGSADKTV 361
           +  D + L TGS D  I VW+  TG  +   RGH  + +   S+ K   +++SG AD +V
Sbjct: 616 VSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSV 675

Query: 362 KVWHVESRTC 371
           +VW V+  T 
Sbjct: 676 RVWDVKKSTA 685

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/249 (22%), Positives = 94/249 (37%), Gaps = 60/249 (24%)

Query: 321 IRVWNYVTGA---CVSTYRGHQDSVLSV---DSFRKLIVSGSADKTVKVWHV-------- 366
           IR+ N  + A   C+ T+      + S+   D  R L  +G  D  +K+W +        
Sbjct: 406 IRLENLQSSAPSVCMYTFHNTNSEMTSLEFSDDVR-LAAAGFQDSIIKIWSLDGEPLKNK 464

Query: 367 ------ESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHV 420
                 E     TL GH+G V      P +    S S+D T+R+W   T T +  + GH 
Sbjct: 465 LPSKQGERTNNETLVGHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHN 524

Query: 421 GQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNT 480
             +  V    LG                                      +  + S D T
Sbjct: 525 HPIWDVAFSPLGH-------------------------------------YFATASHDQT 547

Query: 481 IKLWNVKTGACIRTQFGHVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGI 538
            +LW+      +R   GH+  V  ++   +   + +GS D++C++WD+ +G  +  F+G 
Sbjct: 548 ARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLGH 607

Query: 539 HAPVACVGI 547
            APV    +
Sbjct: 608 TAPVTSTAV 616

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 76/166 (45%), Gaps = 12/166 (7%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGAC 331
           T S+D T  +W       +R  +GH + V  + F  +   + TGS DKT R+W+  +G  
Sbjct: 541 TASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDS 600

Query: 332 VSTYRGHQDSVLS--VDSFRKLIVSGSADKTVKVWHVES-RTCYTLRGH-TGWVNCVKLH 387
           V  + GH   V S  V    + + +GS D  + VW + + +    +RGH    V  +   
Sbjct: 601 VRLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLSYS 660

Query: 388 PKSFTCFSGSDDMTIRMWDIRTNTC------VRVFHGHVGQVQKVI 427
            +     SG  D ++R+WD++ +T        + F G+ G V   +
Sbjct: 661 KEGHVLISGGADHSVRVWDVKKSTAEPGSEPEQPFTGYSGDVTSSV 706

>YMR116C (ASC1) [4073] chr13
           complement(499455..499877,500151..500687) Ribosomal
           protein of the 40S ribosomal subunit that influences
           translational efficiency and cell size, contains two WD
           (WD-40) repeats [960 bp, 319 aa]
          Length = 319

 Score = 84.7 bits (208), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 53/168 (31%), Positives = 83/168 (49%), Gaps = 15/168 (8%)

Query: 274 TGSYDSTVAIWDLAT-----GKLIRRLSGHTDGVK--ALRFDDQKLITGSLDKTIRVWNY 326
           + S D T+  W L       G  +R   GH+  V+   L  D    ++ S DKT+R+W+ 
Sbjct: 35  SASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDV 94

Query: 327 VTGACVSTYRGHQDSVLSVDSFRK--LIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCV 384
            TG     + GH+  V+SVD  +K  +I+SGS DKT+KVW ++ +   TL GH  WV+ V
Sbjct: 95  ATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQV 154

Query: 385 KLHPK------SFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKV 426
           ++ P       S T  S  +D  ++ W++        F GH   +  +
Sbjct: 155 RVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTL 202

 Score = 58.5 bits (140), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 97/259 (37%), Gaps = 55/259 (21%)

Query: 295 LSGHTDGVKALRFDDQK---LITGSLDKTIRVWNYVT-----GACVSTYRGH----QDSV 342
           L GH   V +L     +   L++ S DKT+  W         G  V +++GH    QD  
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 343 LSVDSFRKLIVSGSADKTVKVWHVESRTCYT-LRGHTGWVNCVKLHPKSFTCFSGSDDMT 401
           L+ D    L  S S DKT+++W V +   Y    GH   V  V +  K+    SGS D T
Sbjct: 73  LTADGAYAL--SASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKT 130

Query: 402 IRMWDIRTNTCVRVFHGH---VGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQ 458
           I++W I+   C+    GH   V QV +V+P     D                        
Sbjct: 131 IKVWTIK-GQCLATLLGHNDWVSQV-RVVPNEKADD------------------------ 164

Query: 459 AANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAA--DNFRIVSGS 516
                        ++S   D  +K WN+          GH   +  + A  D   I S  
Sbjct: 165 ---------DSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAG 215

Query: 517 HDRSCKVWDLQTGKCMHTF 535
            D    +W+L   K M+T 
Sbjct: 216 KDGEIMLWNLAAKKAMYTL 234

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 77/194 (39%), Gaps = 46/194 (23%)

Query: 373 TLRGHTGWVNCVKLHP-KSFTCFSGSDDMTIRMW-----DIRTNTCVRVFHGHVGQVQKV 426
           TL GH GWV  +     +     S S D T+  W     D +    VR F GH   VQ  
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 427 IPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNV 486
              TL +D                                    + LS S D T++LW+V
Sbjct: 72  ---TLTAD----------------------------------GAYALSASWDKTLRLWDV 94

Query: 487 KTGACIRTQFGHVEGVW--DIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVAC 544
            TG   +   GH   V   DI      I+SGS D++ KVW ++ G+C+ T +G +  V+ 
Sbjct: 95  ATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQ 153

Query: 545 VGIGDSEFVSGDEL 558
           V +  +E    D +
Sbjct: 154 VRVVPNEKADDDSV 167

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/221 (23%), Positives = 82/221 (37%), Gaps = 55/221 (24%)

Query: 334 TYRGHQDSVLSVDSFR---KLIVSGSADKTVKVWHVESR------TCYTLRGHTGWVNCV 384
           T  GH   V S+ +      L++S S DKT+  W +            + +GH+  V   
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 385 KLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXX 444
            L        S S D T+R+WD+ T    + F GH   V  V                  
Sbjct: 72  TLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSV------------------ 113

Query: 445 XXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWD 504
                           + D      + ++S S D TIK+W +K G C+ T  GH + V  
Sbjct: 114 ----------------DIDKK---ASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQ 153

Query: 505 IAA--------DNFRIVSGSHDRSCKVWDLQTGKCMHTFVG 537
           +          D+  I+S  +D+  K W+L   +    F+G
Sbjct: 154 VRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIG 194

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 56/138 (40%), Gaps = 14/138 (10%)

Query: 253 QEFKGHMDGVXXXX--XXXXXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--- 307
           Q F GH   V             +GS D T+ +W +  G+ +  L GH D V  +R    
Sbjct: 101 QRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTI-KGQCLATLLGHNDWVSQVRVVPN 159

Query: 308 -----DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSV--LSVDSFRKLIVSGSADKT 360
                D   +I+   DK ++ WN       + + GH  ++  L+      LI S   D  
Sbjct: 160 EKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGE 219

Query: 361 VKVWHVESRTC-YTLRGH 377
           + +W++ ++   YTL   
Sbjct: 220 IMLWNLAAKKAMYTLSAQ 237

>AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH]
           complement(216252..216269,216423..218903) [2499 bp, 832
           aa]
          Length = 832

 Score = 87.4 bits (215), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 73/270 (27%), Positives = 113/270 (41%), Gaps = 47/270 (17%)

Query: 277 YDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGACVST 334
           Y     IW+  T   +R +S     V+A +F  +K  +I GS D  IRV+NY TG  V  
Sbjct: 33  YSGRAEIWNYETQTEVRSISVCEAPVRAGKFIPRKSWIIVGSDDFKIRVFNYNTGEKVVD 92

Query: 335 YRGHQDSV--LSVDSFRKLIVSGSADKTVKVWHVESRTCY--TLRGHTGWVNCVKLHPKS 390
           +  H D +  L+V   R  ++S S D TVK+W+ E       T  GH  +V  V  +PK 
Sbjct: 93  FEAHPDYIRALAVHPTRSYVLSASDDLTVKLWNWEKNWALEQTFEGHEHFVMSVTFNPKD 152

Query: 391 FTCFSGS-DDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXX 449
              F+ +  D T+++W +   T       H+ +                           
Sbjct: 153 PNTFATACLDHTVKIWSLGQETSNFTLRAHLEK--------------------------- 185

Query: 450 XXXXXXSVQAANFDHSLPY--PTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAA 507
                      NF    P+    +L++ S D T+K+W+ +T +C+ T  GH+  V     
Sbjct: 186 ---------GVNFVDYYPFQDKPYLITSSDDRTVKVWDYQTKSCVATLEGHLSNVSYAVY 236

Query: 508 DNFR--IVSGSHDRSCKVWDLQTGKCMHTF 535
                 I+SGS D + K+W+  T K   T 
Sbjct: 237 HPMLPIIISGSEDGTVKIWNSNTYKLERTL 266

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 65/244 (26%), Positives = 105/244 (43%), Gaps = 49/244 (20%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTG-AC 331
           GS D  + +++  TG+ +     H D ++AL     +  +++ S D T+++WN+    A 
Sbjct: 73  GSDDFKIRVFNYNTGEKVVDFEAHPDYIRALAVHPTRSYVLSASDDLTVKLWNWEKNWAL 132

Query: 332 VSTYRGHQDSVLSVDSFRK---LIVSGSADKTVKVWHVESRTC-YTLRGH-TGWVNCVKL 386
             T+ GH+  V+SV    K      +   D TVK+W +   T  +TLR H    VN V  
Sbjct: 133 EQTFEGHEHFVMSVTFNPKDPNTFATACLDHTVKIWSLGQETSNFTLRAHLEKGVNFVDY 192

Query: 387 HP---KSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXX 443
           +P   K +   + SDD T+++WD +T +CV    GH+  V   +                
Sbjct: 193 YPFQDKPY-LITSSDDRTVKVWDYQTKSCVATLEGHLSNVSYAV---------------- 235

Query: 444 XXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVW 503
                             +   LP    ++S S D T+K+WN  T    RT    +E  W
Sbjct: 236 ------------------YHPMLPI---IISGSEDGTVKIWNSNTYKLERTLNLGLERSW 274

Query: 504 DIAA 507
            +AA
Sbjct: 275 CVAA 278

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 68/158 (43%), Gaps = 15/158 (9%)

Query: 244 NWRKGIYRIQEFKGH---MDGVXXXXXXXXXXXTGSYDSTVAIWDLATGKLIRRLSGHTD 300
           NW K     Q F+GH   +  V           T   D TV IW L        L  H +
Sbjct: 125 NWEKNWALEQTFEGHEHFVMSVTFNPKDPNTFATACLDHTVKIWSLGQETSNFTLRAHLE 184

Query: 301 -GVKALRF----DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSV--LSVDSFRKLIV 353
            GV  + +    D   LIT S D+T++VW+Y T +CV+T  GH  +V          +I+
Sbjct: 185 KGVNFVDYYPFQDKPYLITSSDDRTVKVWDYQTKSCVATLEGHLSNVSYAVYHPMLPIII 244

Query: 354 SGSADKTVKVWHVES---RTCYTLRGHTGWVNCVKLHP 388
           SGS D TVK+W+  +        L     W  CV  HP
Sbjct: 245 SGSEDGTVKIWNSNTYKLERTLNLGLERSW--CVAAHP 280

>KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46, start by
           similarity
          Length = 434

 Score = 85.9 bits (211), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 73/284 (25%), Positives = 115/284 (40%), Gaps = 19/284 (6%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGAC 331
           TGS D+T+ IWDLA GKL   L GH   V+ +    +   + + S DK ++ W+      
Sbjct: 140 TGSNDTTIKIWDLAAGKLKITLIGHVMSVRDIAISKRHPYMFSASEDKLVKCWDLERNTA 199

Query: 332 VSTYRGHQDSVLSVDSFRKL--IVSGSADKTVKVWHVESRT-CYTLRGHTGWVNCVKLHP 388
           +  + GH   V +VD    L  I +   D  V++W + SR+    L GH   +N VK  P
Sbjct: 200 IRDFHGHLSGVHTVDVHPSLDIIATAGRDAVVRLWDIRSRSEIMVLPGHKSPINKVKCLP 259

Query: 389 KSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXX 448
                 S S D T+R+WDI      +V   H   ++ +                      
Sbjct: 260 VDPQIISCSGDATVRLWDIIAGKASKVLTHHSRNIRDLTLHPAEFSFASVSTNDVRSWKL 319

Query: 449 XXXXXXXSVQAANF----DHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQF-----GHV 499
                  + Q+ N       S+ +   LL+   D T+  ++ KTG   ++       G +
Sbjct: 320 PEGQLLTNFQSQNTGILNTVSINHDNVLLAGGDDGTLCFYDYKTGHKYQSMMTTEVAGSL 379

Query: 500 EGVWDIAADNF-----RIVSGSHDRSCKVWDLQTGKCMHTFVGI 538
           E    I    F     R+++G  D+S K+W         TF G+
Sbjct: 380 ESERSILCSTFDVTGTRLITGEGDKSIKIWKQVPDATEDTFPGL 423

 Score = 84.0 bits (206), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 69/259 (26%), Positives = 106/259 (40%), Gaps = 50/259 (19%)

Query: 287 ATGKLIRRLSGHTDGVKAL---RFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSV- 342
           A  KL + ++GHT  V+ +     D++   TGS D TI++W+   G    T  GH  SV 
Sbjct: 110 APWKLSKVINGHTGWVRCVCVDPVDNEWFATGSNDTTIKIWDLAAGKLKITLIGHVMSVR 169

Query: 343 -LSVDSFRKLIVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHPKSFTCFSGSDDM 400
            +++      + S S DK VK W +E  T      GH   V+ V +HP      +   D 
Sbjct: 170 DIAISKRHPYMFSASEDKLVKCWDLERNTAIRDFHGHLSGVHTVDVHPSLDIIATAGRDA 229

Query: 401 TIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAA 460
            +R+WDIR+ + + V  GH   + KV                                  
Sbjct: 230 VVRLWDIRSRSEIMVLPGHKSPINKV---------------------------------- 255

Query: 461 NFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDI----AADNFRIVSGS 516
                LP    ++SCS D T++LW++  G   +    H   + D+    A  +F  VS +
Sbjct: 256 ---KCLPVDPQIISCSGDATVRLWDIIAGKASKVLTHHSRNIRDLTLHPAEFSFASVSTN 312

Query: 517 HDRSCKVWDLQTGKCMHTF 535
             RS   W L  G+ +  F
Sbjct: 313 DVRS---WKLPEGQLLTNF 328

 Score = 58.2 bits (139), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 73/185 (39%), Gaps = 40/185 (21%)

Query: 364 WHVESRTCYTLRGHTGWVNCVKLHPKSFTCF-SGSDDMTIRMWDIRTNTCVRVFHGHVGQ 422
           WH   +    + GHTGWV CV + P     F +GS+D TI++WD+          GHV  
Sbjct: 108 WHAPWKLSKVINGHTGWVRCVCVDPVDNEWFATGSNDTTIKIWDLAAGKLKITLIGHVMS 167

Query: 423 VQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIK 482
           V+ +                                A +  H  PY   + S S D  +K
Sbjct: 168 VRDI--------------------------------AISKRH--PY---MFSASEDKLVK 190

Query: 483 LWNVKTGACIRTQFGHVEGVW--DIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHA 540
            W+++    IR   GH+ GV   D+      I +   D   ++WD+++   +    G  +
Sbjct: 191 CWDLERNTAIRDFHGHLSGVHTVDVHPSLDIIATAGRDAVVRLWDIRSRSEIMVLPGHKS 250

Query: 541 PVACV 545
           P+  V
Sbjct: 251 PINKV 255

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 36/77 (46%), Gaps = 2/77 (2%)

Query: 476 SLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFR--IVSGSHDRSCKVWDLQTGKCMH 533
           S D TIK+W++  G    T  GHV  V DIA       + S S D+  K WDL+    + 
Sbjct: 142 SNDTTIKIWDLAAGKLKITLIGHVMSVRDIAISKRHPYMFSASEDKLVKCWDLERNTAIR 201

Query: 534 TFVGIHAPVACVGIGDS 550
            F G  + V  V +  S
Sbjct: 202 DFHGHLSGVHTVDVHPS 218

>Scas_630.6
          Length = 621

 Score = 86.7 bits (213), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 82/316 (25%), Positives = 124/316 (39%), Gaps = 77/316 (24%)

Query: 280 TVAIWDLATGKLIRRLSGHTDG---------------------VKALRF--DDQKLITGS 316
           T  I+D+ATG+L  +L   T                       ++++ F  D + L TG+
Sbjct: 301 TTQIFDVATGELYVKLLDDTVNTAIVTTTTENNETVTTTADLYIRSICFSPDGEFLATGA 360

Query: 317 LDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFR--KLIVSGSADKTVKVWHVESRTCYTL 374
            DK IR+WN      V   +GH+  + S+D F   + +VSGS D+++++W +++  C   
Sbjct: 361 EDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSGDRSIRIWDLKTGQCSLT 420

Query: 375 RGHTGWVNCVKLHPKSFTCF-SGSDDMTIRMWDIRTNTCVRVF-------HGHVGQVQKV 426
                 V  V + P       +GS D ++R+WD  T   V          +GH   V  V
Sbjct: 421 LSIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDSSTGFLVERLDSDNESGNGHQDSVYSV 480

Query: 427 IPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNV 486
                G                                      H++S SLD T+KLWN+
Sbjct: 481 AFTKDGQ-------------------------------------HVVSGSLDRTVKLWNL 503

Query: 487 -----KTGACIRTQFGHVEGVWDIAA--DNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIH 539
                 TG C  T  GH + V  +A   D+  I SGS DR   +WD  +G  +    G  
Sbjct: 504 GDTQSGTGKCEVTYIGHKDFVLSVATSNDDKYIFSGSKDRGVIIWDKDSGNPILMLQGHR 563

Query: 540 APVACVGIGDSEFVSG 555
             V  V   +S    G
Sbjct: 564 KSVISVATVNSNVDDG 579

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 82/155 (52%), Gaps = 24/155 (15%)

Query: 275 GSYDSTVAIWDLATGKLIRRL-------SGHTDGVKALRF--DDQKLITGSLDKTIRVWN 325
           GS D +V IWD +TG L+ RL       +GH D V ++ F  D Q +++GSLD+T+++WN
Sbjct: 443 GSLDRSVRIWDSSTGFLVERLDSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWN 502

Query: 326 Y-----VTGACVSTYRGHQDSVLSVDSFR--KLIVSGSADKTVKVWHVES-RTCYTLRGH 377
                  TG C  TY GH+D VLSV +    K I SGS D+ V +W  +S      L+GH
Sbjct: 503 LGDTQSGTGKCEVTYIGHKDFVLSVATSNDDKYIFSGSKDRGVIIWDKDSGNPILMLQGH 562

Query: 378 ------TGWVNCVKLHPKSFTCF-SGSDDMTIRMW 405
                    VN      K++  F +GS D   R+W
Sbjct: 563 RKSVISVATVNSNVDDGKNYKLFATGSGDCKARIW 597

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 69/211 (32%), Positives = 100/211 (47%), Gaps = 32/211 (15%)

Query: 228 MRPWKVVYRERFKVESNWRKGIYRIQEFKGHMDGVXXXXXXXXXXXTGSYDSTVAIWDLA 287
           +R W +  R+   V     + IY +  F    DG            +GS D ++ IWDL 
Sbjct: 365 IRIWNIKERKIVMVLKGHEQDIYSLDYFP---DG--------QKLVSGSGDRSIRIWDLK 413

Query: 288 TGKLIRRLSGHTDGVK--ALRFDDQKLIT-GSLDKTIRVWNYVTGACVS-------TYRG 337
           TG+    LS   DGV   A+  ++ KLI  GSLD+++R+W+  TG  V        +  G
Sbjct: 414 TGQCSLTLSIE-DGVTTVAVSPNEGKLIAAGSLDRSVRIWDSSTGFLVERLDSDNESGNG 472

Query: 338 HQDSVLSVDSFRK---LIVSGSADKTVKVWHV------ESRTCYTLRGHTGWVNCVKLHP 388
           HQDSV SV +F K    +VSGS D+TVK+W++        +   T  GH  +V  V    
Sbjct: 473 HQDSVYSV-AFTKDGQHVVSGSLDRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLSVATSN 531

Query: 389 KSFTCFSGSDDMTIRMWDIRTNTCVRVFHGH 419
                FSGS D  + +WD  +   + +  GH
Sbjct: 532 DDKYIFSGSKDRGVIIWDKDSGNPILMLQGH 562

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 71/278 (25%), Positives = 119/278 (42%), Gaps = 63/278 (22%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGAC 331
           TG+ D  + IW++   K++  L GH   + +L +  D QKL++GS D++IR+W+  TG C
Sbjct: 358 TGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSGDRSIRIWDLKTGQC 417

Query: 332 VSTYRGHQDSVLSV---DSFRKLIVSGSADKTVKVWHVESRTCYTLR----------GHT 378
             T    +D V +V    +  KLI +GS D++V++W  +S T + +           GH 
Sbjct: 418 SLTL-SIEDGVTTVAVSPNEGKLIAAGSLDRSVRIW--DSSTGFLVERLDSDNESGNGHQ 474

Query: 379 GWVNCVKLHPKSFTCFSGSDDMTIRMWDI-----RTNTCVRVFHGHVGQVQKVIPLTLGS 433
             V  V          SGS D T+++W++      T  C   + GH              
Sbjct: 475 DSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQSGTGKCEVTYIGH-------------K 521

Query: 434 DLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIR 493
           D +                   SV  +N D       ++ S S D  + +W+  +G  I 
Sbjct: 522 DFV------------------LSVATSNDDK------YIFSGSKDRGVIIWDKDSGNPIL 557

Query: 494 TQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKC 531
              GH + V  +A  N  +  G   ++ K++   +G C
Sbjct: 558 MLQGHRKSVISVATVNSNVDDG---KNYKLFATGSGDC 592

>Kwal_56.24526
          Length = 1210

 Score = 87.0 bits (214), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 69/274 (25%), Positives = 118/274 (43%), Gaps = 28/274 (10%)

Query: 277 YDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGACVST 334
           + S++ +WD   G L+ +   H   V+ + F   +   ++   D TI+VW+  T  C+ T
Sbjct: 31  FSSSIQLWDYRMGTLLHKFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVWSLDTKKCLFT 90

Query: 335 YRGHQDSVLSVDSFRKL--IVSGSADKTVKVWHVESRTCYT-LRGHTGWVNCVKLHPKSF 391
             GH D V +V   R+L  I+S S D+T+++W+ ++R     L GH  +V C   HP   
Sbjct: 91  LNGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCADFHPTED 150

Query: 392 TCFSGSDDMTIRMWDI------RTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXX 445
              S S D T+R+WDI       +          +   Q ++    G  +++        
Sbjct: 151 LVVSASLDETVRVWDISGLRKRHSAPSTYTLEDQIAAQQNLLDGGFGDCVVK-------- 202

Query: 446 XXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGAC--IRTQFGHVEGVW 503
                      V  A+F  +LP    ++S   D  +KLW + +     + T  GH   V 
Sbjct: 203 --FILEGHSRGVNWASFHPTLPL---IVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVD 257

Query: 504 DIAADNFR--IVSGSHDRSCKVWDLQTGKCMHTF 535
            +     +  I+S   D++ +VWDL     +  F
Sbjct: 258 SVIFHPHQNLIISVGEDKTVRVWDLDKRTPVKQF 291

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 55/180 (30%), Positives = 77/180 (42%), Gaps = 37/180 (20%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWN------ 325
           + S D T+ IW+    K I  L+GH   V    F   +  +++ SLD+T+RVW+      
Sbjct: 112 SASDDQTIRIWNWQNRKEIACLTGHNHFVMCADFHPTEDLVVSASLDETVRVWDISGLRK 171

Query: 326 -------YVT---------------GACVSTY--RGHQDSV--LSVDSFRKLIVSGSADK 359
                  Y                 G CV  +   GH   V   S      LIVSG  D+
Sbjct: 172 RHSAPSTYTLEDQIAAQQNLLDGGFGDCVVKFILEGHSRGVNWASFHPTLPLIVSGGDDR 231

Query: 360 TVKVWHVESRTCY---TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVF 416
            VK+W + S   +   T RGHT  V+ V  HP      S  +D T+R+WD+   T V+ F
Sbjct: 232 QVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPHQNLIISVGEDKTVRVWDLDKRTPVKQF 291

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 59/153 (38%), Gaps = 39/153 (25%)

Query: 401 TIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAA 460
           +I++WD R  T +  F  H G V+ +                                  
Sbjct: 34  SIQLWDYRMGTLLHKFEDHEGPVRGI---------------------------------- 59

Query: 461 NFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFR--IVSGSHD 518
           +F  + P     +S   D TIK+W++ T  C+ T  GH++ V  +        I+S S D
Sbjct: 60  DFHPTQPL---FVSAGDDYTIKVWSLDTKKCLFTLNGHLDYVRTVFFHRELPWIISASDD 116

Query: 519 RSCKVWDLQTGKCMHTFVGIHAPVACVGIGDSE 551
           ++ ++W+ Q  K +    G +  V C     +E
Sbjct: 117 QTIRIWNWQNRKEIACLTGHNHFVMCADFHPTE 149

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 31/69 (44%), Gaps = 4/69 (5%)

Query: 472 LLSCSLDNTIKLWNVKTGACI---RTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQT 528
           +L     ++I+LW+ + G  +       G V G+ D        VS   D + KVW L T
Sbjct: 26  VLVALFSSSIQLWDYRMGTLLHKFEDHEGPVRGI-DFHPTQPLFVSAGDDYTIKVWSLDT 84

Query: 529 GKCMHTFVG 537
            KC+ T  G
Sbjct: 85  KKCLFTLNG 93

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 50/104 (48%), Gaps = 6/104 (5%)

Query: 274 TGSYDSTVAIWDLATGKL--IRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTG 329
           +G  D  V +W +++ K   +    GHT+ V ++ F   +  +I+   DKT+RVW+    
Sbjct: 226 SGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPHQNLIISVGEDKTVRVWDLDKR 285

Query: 330 ACVSTYRGHQDSVLSVDSFRKLIVSGSA-DKTVKVWHVE-SRTC 371
             V  ++   D    V +   + + G+A D  + V+ ++  R C
Sbjct: 286 TPVKQFKRENDRFWLVRAHPNINLFGAAHDSGIMVFKLDRERPC 329

>Scas_711.11
          Length = 695

 Score = 85.9 bits (211), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 64/296 (21%), Positives = 117/296 (39%), Gaps = 83/296 (28%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTG----- 329
           G  D  + IWDL+  K I R++GH   V  ++  +  L++G  D  +++WN   G     
Sbjct: 391 GHLDHVIKIWDLSRSKQIGRMTGHVATVNCMQITNNMLVSGGKDALLKLWNLNVGVQSFR 450

Query: 330 -----------------ACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCY 372
                            +C+ T+  H D + SV    + ++SGS D+T++ W + S  C 
Sbjct: 451 NVLPTNNSNLEPISSSASCIHTFDSHVDEITSVTVAGENLISGSQDRTIRQWDIPSGKCL 510

Query: 373 TL--------------RGHTGWVNCVKLHP--KSFTCF-----SGSDDMTIRMWDIRTNT 411
                              + ++   K      +  CF     +G+ D  +R+WD+R   
Sbjct: 511 QTIDLSFVAIASPPIQVTDSPFLTTTKATAIIGALQCFDAALATGTRDGIVRLWDLRAGK 570

Query: 412 CVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTH 471
            VR   GH G                                  S+    FD+      +
Sbjct: 571 VVRALEGHSG----------------------------------SITCLKFDNK-----N 591

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQ 527
           +++ S+D T+++W++++G  +       + V  +  D  +I   +HD +CKV+D Q
Sbjct: 592 IVTGSIDKTVRIWDLRSG-ILSDMLTFEKPVLSVDFDKNKIAIATHDEACKVYDRQ 646

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 57/91 (62%), Gaps = 1/91 (1%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVS 333
           TG+ D  V +WDL  GK++R L GH+  +  L+FD++ ++TGS+DKT+R+W+  +G  +S
Sbjct: 554 TGTRDGIVRLWDLRAGKVVRALEGHSGSITCLKFDNKNIVTGSIDKTVRIWDLRSG-ILS 612

Query: 334 TYRGHQDSVLSVDSFRKLIVSGSADKTVKVW 364
                +  VLSVD  +  I   + D+  KV+
Sbjct: 613 DMLTFEKPVLSVDFDKNKIAIATHDEACKVY 643

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 82/204 (40%), Gaps = 47/204 (23%)

Query: 251 RIQEFKGHMDGVXXXXXXXXXXXTGSYDSTVAIWDLATG--------------------- 289
           +I    GH+  V           +G  D+ + +W+L  G                     
Sbjct: 407 QIGRMTGHVATVNCMQITNNMLVSGGKDALLKLWNLNVGVQSFRNVLPTNNSNLEPISSS 466

Query: 290 -KLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLS---- 344
              I     H D + ++    + LI+GS D+TIR W+  +G C+ T      ++ S    
Sbjct: 467 ASCIHTFDSHVDEITSVTVAGENLISGSQDRTIRQWDIPSGKCLQTIDLSFVAIASPPIQ 526

Query: 345 -VDS-----------------FRKLIVSGSADKTVKVWHVES-RTCYTLRGHTGWVNCVK 385
             DS                 F   + +G+ D  V++W + + +    L GH+G + C+K
Sbjct: 527 VTDSPFLTTTKATAIIGALQCFDAALATGTRDGIVRLWDLRAGKVVRALEGHSGSITCLK 586

Query: 386 LHPKSFTCFSGSDDMTIRMWDIRT 409
              K+    +GS D T+R+WD+R+
Sbjct: 587 FDNKNI--VTGSIDKTVRIWDLRS 608

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 79/191 (41%), Gaps = 36/191 (18%)

Query: 375 RGHTGWVNCVKLH-PKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVG-----QVQKVIP 428
           + H   + C+    P    C +G  D  I++WD+  +  +    GHV      Q+   + 
Sbjct: 369 KAHDDNITCLDFDLPFGTLCTAGHLDHVIKIWDLSRSKQIGRMTGHVATVNCMQITNNML 428

Query: 429 LTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKT 488
           ++ G D +                   +V   +F + LP           N   L  + +
Sbjct: 429 VSGGKDAL-------------LKLWNLNVGVQSFRNVLPT----------NNSNLEPISS 465

Query: 489 GA-CIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHT----FVGIHAPVA 543
            A CI T   HV+ +  +      ++SGS DR+ + WD+ +GKC+ T    FV I +P  
Sbjct: 466 SASCIHTFDSHVDEITSVTVAGENLISGSQDRTIRQWDIPSGKCLQTIDLSFVAIASP-- 523

Query: 544 CVGIGDSEFVS 554
            + + DS F++
Sbjct: 524 PIQVTDSPFLT 534

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 54/258 (20%), Positives = 103/258 (39%), Gaps = 48/258 (18%)

Query: 326 YVTGACVSTY-RGHQDSVLSVD---SFRKLIVSGSADKTVKVWHVE-SRTCYTLRGHTGW 380
           +  G+ ++T  + H D++  +D    F  L  +G  D  +K+W +  S+    + GH   
Sbjct: 358 FEKGSMINTIQKAHDDNITCLDFDLPFGTLCTAGHLDHVIKIWDLSRSKQIGRMTGHVAT 417

Query: 381 VNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXX 440
           VNC+++        SG  D  +++W++  N  V+ F       + V+P T  S+L     
Sbjct: 418 VNCMQITNNML--VSGGKDALLKLWNL--NVGVQSF-------RNVLP-TNNSNLEPISS 465

Query: 441 XXX-XXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRT---QF 496
                           SV  A          +L+S S D TI+ W++ +G C++T    F
Sbjct: 466 SASCIHTFDSHVDEITSVTVAG--------ENLISGSQDRTIRQWDIPSGKCLQTIDLSF 517

Query: 497 GHVEG-------------------VWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVG 537
             +                     +  +   +  + +G+ D   ++WDL+ GK +    G
Sbjct: 518 VAIASPPIQVTDSPFLTTTKATAIIGALQCFDAALATGTRDGIVRLWDLRAGKVVRALEG 577

Query: 538 IHAPVACVGIGDSEFVSG 555
               + C+   +   V+G
Sbjct: 578 HSGSITCLKFDNKNIVTG 595

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 45/118 (38%), Gaps = 22/118 (18%)

Query: 462 FDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFRIVSGSHDRSC 521
            D  LP+ T   +  LD+ IK+W++     I    GHV  V  +   N  +VSG  D   
Sbjct: 378 LDFDLPFGTLCTAGHLDHVIKIWDLSRSKQIGRMTGHVATVNCMQITNNMLVSGGKDALL 437

Query: 522 KVWDLQTG----------------------KCMHTFVGIHAPVACVGIGDSEFVSGDE 557
           K+W+L  G                       C+HTF      +  V +     +SG +
Sbjct: 438 KLWNLNVGVQSFRNVLPTNNSNLEPISSSASCIHTFDSHVDEITSVTVAGENLISGSQ 495

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 56/140 (40%), Gaps = 20/140 (14%)

Query: 246 RKGIYR---------IQEFKGHMDGVXXXXXXXXXXXTGSYDSTVAIWDLATGKLIRRLS 296
           R GI R         ++  +GH   +           TGS D TV IWDL +G L   L+
Sbjct: 557 RDGIVRLWDLRAGKVVRALEGHSGSITCLKFDNKNIVTGSIDKTVRIWDLRSGILSDMLT 616

Query: 297 GHTDGVKALRFDDQKLITGSLDKTIRVWNYVTG---ACVSTYRGH-QDSVLSVDSFRKL- 351
                V ++ FD  K+   + D+  +V++        C ST      D  + V +   + 
Sbjct: 617 -FEKPVLSVDFDKNKIAIATHDEACKVYDRQLNNLQTCTSTDEASTSDPTIPVSTVETMS 675

Query: 352 -----IVSGSADKTVKVWHV 366
                +V G +D T+  W V
Sbjct: 676 YQNGYLVEGRSDGTINSWAV 695

>CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces
           cerevisiae YJL112w MDV1, hypothetical start
          Length = 711

 Score = 85.1 bits (209), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 64/265 (24%), Positives = 114/265 (43%), Gaps = 33/265 (12%)

Query: 297 GHTDGVKALRFDDQ--KLIT-GSLDKTIRVWNYVTGACVSTYRGHQDSV--LSVDSFRKL 351
            H D +  L FD     L T G +D  +++W+Y     +    GH  ++  + VD    +
Sbjct: 402 AHDDAITCLDFDPHFSTLCTAGYMDHIVKLWDYTKKRQIGAMEGHVATISCMQVDKNYNM 461

Query: 352 IVSGSADKTVKVWHVE-----------SRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDM 400
           + +GS D TVK+W+             S   +TL  H   V+   L+       + S D 
Sbjct: 462 VATGSKDATVKLWNANDVIGRYEEGNNSEALHTLDAHLDEVSS--LYIDGANLMTASQDK 519

Query: 401 TIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAA 460
           TIR WD+ +  C++VF  +   +       + S+                     S+Q+ 
Sbjct: 520 TIRRWDLYSGKCIQVFDVNFPSLSAYKSSFMKSN------EDSMILKTVNTPIIGSIQS- 572

Query: 461 NFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFRIVSGSHDRS 520
            FD +L   T       D  I+LW+++TG  +R   GH++ +  +  D   I+SGS D +
Sbjct: 573 -FDAALATGTK------DGLIRLWDMRTGEVVRVLEGHMDAITSLKFDATTIISGSLDGT 625

Query: 521 CKVWDLQTGKCMHTFVGIHAPVACV 545
            ++WDL++   +   +    P++ +
Sbjct: 626 IRLWDLRSNN-LTDIISYEKPISSL 649

 Score = 75.5 bits (184), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 80/179 (44%), Gaps = 38/179 (21%)

Query: 274 TGSYDSTVAIWDLA----------TGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRV 323
           TGS D+TV +W+              + +  L  H D V +L  D   L+T S DKTIR 
Sbjct: 464 TGSKDATVKLWNANDVIGRYEEGNNSEALHTLDAHLDEVSSLYIDGANLMTASQDKTIRR 523

Query: 324 WNYVTGACVSTY---------------RGHQDSVL----------SVDSFRKLIVSGSAD 358
           W+  +G C+  +               + ++DS++          S+ SF   + +G+ D
Sbjct: 524 WDLYSGKCIQVFDVNFPSLSAYKSSFMKSNEDSMILKTVNTPIIGSIQSFDAALATGTKD 583

Query: 359 KTVKVWHVES-RTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVF 416
             +++W + +      L GH   +  +K    + T  SGS D TIR+WD+R+N    + 
Sbjct: 584 GLIRLWDMRTGEVVRVLEGHMDAITSLKFD--ATTIISGSLDGTIRLWDLRSNNLTDII 640

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 52/91 (57%), Gaps = 1/91 (1%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVS 333
           TG+ D  + +WD+ TG+++R L GH D + +L+FD   +I+GSLD TIR+W+  +     
Sbjct: 579 TGTKDGLIRLWDMRTGEVVRVLEGHMDAITSLKFDATTIISGSLDGTIRLWDLRSNNLTD 638

Query: 334 TYRGHQDSVLSVDSFRKLIVSGSADKTVKVW 364
               ++  + S+D   K IV  S +    ++
Sbjct: 639 II-SYEKPISSLDFDAKHIVVASNEHNTHIY 668

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/295 (22%), Positives = 109/295 (36%), Gaps = 84/295 (28%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDD--QKLITGSLDKTIRVWN------- 325
           G  D  V +WD    + I  + GH   +  ++ D     + TGS D T+++WN       
Sbjct: 423 GYMDHIVKLWDYTKKRQIGAMEGHVATISCMQVDKNYNMVATGSKDATVKLWNANDVIGR 482

Query: 326 YVTG---ACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVN 382
           Y  G     + T   H D V S+      +++ S DKT++ W + S  C  +      VN
Sbjct: 483 YEEGNNSEALHTLDAHLDEVSSLYIDGANLMTASQDKTIRRWDLYSGKCIQVFD----VN 538

Query: 383 CVKL--HPKSF--------------------------TCFSGSDDMTIRMWDIRTNTCVR 414
              L  +  SF                             +G+ D  IR+WD+RT   VR
Sbjct: 539 FPSLSAYKSSFMKSNEDSMILKTVNTPIIGSIQSFDAALATGTKDGLIRLWDMRTGEVVR 598

Query: 415 VFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLS 474
           V  GH+                                   ++ +  FD      T ++S
Sbjct: 599 VLEGHMD----------------------------------AITSLKFD-----ATTIIS 619

Query: 475 CSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTG 529
            SLD TI+LW++++         + + +  +  D   IV  S++ +  ++D   G
Sbjct: 620 GSLDGTIRLWDLRSNNLTDI-ISYEKPISSLDFDAKHIVVASNEHNTHIYDRNDG 673

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 66/167 (39%), Gaps = 25/167 (14%)

Query: 255 FKGHMDGVXXXXXXXXXXXTGSYDSTVAIWDLATGKLIR-------RLSGH--------- 298
              H+D V           T S D T+  WDL +GK I+        LS +         
Sbjct: 495 LDAHLDEVSSLYIDGANLMTASQDKTIRRWDLYSGKCIQVFDVNFPSLSAYKSSFMKSNE 554

Query: 299 ---------TDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFR 349
                    T  + +++  D  L TG+ D  IR+W+  TG  V    GH D++ S+    
Sbjct: 555 DSMILKTVNTPIIGSIQSFDAALATGTKDGLIRLWDMRTGEVVRVLEGHMDAITSLKFDA 614

Query: 350 KLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSG 396
             I+SGS D T+++W + S     +  +   ++ +    K     S 
Sbjct: 615 TTIISGSLDGTIRLWDLRSNNLTDIISYEKPISSLDFDAKHIVVASN 661

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 51/260 (19%), Positives = 101/260 (38%), Gaps = 59/260 (22%)

Query: 326 YVTGACVSTY-RGHQDSVLSVD---SFRKLIVSGSADKTVKVW-HVESRTCYTLRGHTGW 380
           Y +G  +ST  + H D++  +D    F  L  +G  D  VK+W + + R    + GH   
Sbjct: 390 YNSGKKLSTIPKAHDDAITCLDFDPHFSTLCTAGYMDHIVKLWDYTKKRQIGAMEGHVAT 449

Query: 381 VNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXX 440
           ++C+++        +GS D T+++W+   +   R   G+  +       TL + L E   
Sbjct: 450 ISCMQVDKNYNMVATGSKDATVKLWNA-NDVIGRYEEGNNSEALH----TLDAHLDEVSS 504

Query: 441 XXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRT---QFG 497
                           +  AN          L++ S D TI+ W++ +G CI+     F 
Sbjct: 505 LY--------------IDGAN----------LMTASQDKTIRRWDLYSGKCIQVFDVNFP 540

Query: 498 HVEG----------------------VWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTF 535
            +                        +  I + +  + +G+ D   ++WD++TG+ +   
Sbjct: 541 SLSAYKSSFMKSNEDSMILKTVNTPIIGSIQSFDAALATGTKDGLIRLWDMRTGEVVRVL 600

Query: 536 VGIHAPVACVGIGDSEFVSG 555
            G    +  +    +  +SG
Sbjct: 601 EGHMDAITSLKFDATTIISG 620

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 25/116 (21%), Positives = 51/116 (43%), Gaps = 2/116 (1%)

Query: 252 IQEFKGHMDGVXXXXXXXXXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK 311
           ++  +GHMD +           +GS D T+ +WDL +  L   +S +   + +L FD + 
Sbjct: 597 VRVLEGHMDAITSLKFDATTIISGSLDGTIRLWDLRSNNLTDIIS-YEKPISSLDFDAKH 655

Query: 312 LITGSLDKTIRVWNYVTGACVSTYRGHQDSV-LSVDSFRKLIVSGSADKTVKVWHV 366
           ++  S +    +++   G         QD+  L V    +  + G ++  + +W V
Sbjct: 656 IVVASNEHNTHIYDRNDGNKWDLQDEEQDTTSLFVKYKERYTMEGRSNGDIGIWIV 711

>AAL009C [178] [Homologous to ScYNL006W (LST8) - SH]
           (325785..326696) [912 bp, 303 aa]
          Length = 303

 Score = 80.9 bits (198), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 76/297 (25%), Positives = 124/297 (41%), Gaps = 22/297 (7%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF-DDQKLITGSLDKTIRVWNYVTGAC- 331
           +  YD T+  W+  TG   R +      V  L    D++ +  +    +R+++  T    
Sbjct: 7   SAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKRYLAAAGHLHVRMYDIRTTNPN 66

Query: 332 -VSTYRGHQDSVLSVDSFR---KLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLH 387
            V+++ GH+ +V S+ +F+   K +VS S D T+KVW V S +      H   VN V +H
Sbjct: 67  PVTSFEGHRGNVTSI-AFQQDNKWMVSSSEDGTIKVWDVRSPSVQRNYKHDAPVNEVVIH 125

Query: 388 PKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQ-VQKVIPLTLGSDLIEXXXXXXXXX 446
           P      S   D  I++WD+  N C           +Q +   + GS L+          
Sbjct: 126 PNQGELISCDQDGNIKIWDLGENQCTNQLALEDNTALQSLSIASDGSMLVAGNNKGNCYV 185

Query: 447 XXXXXXXXXSV--QAANFDHSLPYPT---------HLLSCSLDNTIKLWNVKTGACIRTQ 495
                    +       F     Y T         HL +CS D+T ++W+V+    + T 
Sbjct: 186 WKMPNHTDTASLKPVTKFRSHSKYITRVLLSVDVKHLATCSADHTARVWSVEDNFQLETT 245

Query: 496 F-GHVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGIGD 549
              H   VWD A  AD+  +V+   D   ++WDL T + +  + G H    CV + D
Sbjct: 246 LDAHSRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAVCVALND 302

 Score = 48.1 bits (113), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 88/225 (39%), Gaps = 51/225 (22%)

Query: 312 LITGSLDKTIRVWNYVTGACVSTYRGHQDSV---LSVDSFRKLIVSGSADKTVKVWHVES 368
           L +   D TIR W  +TG C  T + H DS    L + S ++ + + +    V+++ + +
Sbjct: 5   LASAGYDHTIRFWEALTGVCSRTIQ-HADSQVNRLEITSDKRYL-AAAGHLHVRMYDIRT 62

Query: 369 RT---CYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQK 425
                  +  GH G V  +     +    S S+D TI++WD+R+ +  R +  H   V +
Sbjct: 63  TNPNPVTSFEGHRGNVTSIAFQQDNKWMVSSSEDGTIKVWDVRSPSVQRNY-KHDAPVNE 121

Query: 426 VIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWN 485
           V+                                       P    L+SC  D  IK+W+
Sbjct: 122 VVIH-------------------------------------PNQGELISCDQDGNIKIWD 144

Query: 486 VKTGACIRTQFGHVEGV----WDIAADNFRIVSGSHDRSCKVWDL 526
           +    C   Q    +        IA+D   +V+G++  +C VW +
Sbjct: 145 LGENQCT-NQLALEDNTALQSLSIASDGSMLVAGNNKGNCYVWKM 188

>Kwal_27.12667
          Length = 721

 Score = 83.6 bits (205), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 67/283 (23%), Positives = 113/283 (39%), Gaps = 63/283 (22%)

Query: 297 GHTDGVKALRFD---DQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSV--LSVDSFRKL 351
            H D +  L FD         G LD ++++WN      +    GH  SV  + ++    L
Sbjct: 402 AHDDSITCLDFDLPFGTMCTAGKLDHSVKIWNLSKKTQIGALPGHLASVSCMQMEDSHSL 461

Query: 352 IVSGSADKTVKVWHVESRT---------------CYTLRGHTGWVNCVKLHPKSFTCFSG 396
           I +G  D  +K+W +E                   +T   H   +    LH +  +  SG
Sbjct: 462 I-TGGRDALLKLWDIEKAEELYNDGATEGEEELCVHTFDAHVDEITA--LHFEGNSLVSG 518

Query: 397 SDDMTIRMWDIRTNTCVRVF------HGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXX 450
           S D TIR WD+ T  C++         G  G   K+      S ++              
Sbjct: 519 SQDRTIRQWDLTTGKCLQTIDINFANRGTSGGFSKISSNNPRSSIL-------------- 564

Query: 451 XXXXXSVQAANFDHSLP--------YPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGV 502
                        H+ P        Y   + + + D  ++LW++++G  IRT  GH + V
Sbjct: 565 -----------LTHNDPPVIGALQCYDAAMATGTKDGLVRLWDLRSGQVIRTLEGHTDAV 613

Query: 503 WDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACV 545
             +  D+  +V+GS DRS ++WDL+TG     F   ++P++ +
Sbjct: 614 TGLQFDSVNLVTGSLDRSIRIWDLRTGLLADAFA-YNSPISSL 655

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 64/293 (21%), Positives = 119/293 (40%), Gaps = 82/293 (27%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDD-QKLITGSLDKTIRVWN-------Y 326
           G  D +V IW+L+    I  L GH   V  ++ +D   LITG  D  +++W+       Y
Sbjct: 423 GKLDHSVKIWNLSKKTQIGALPGHLASVSCMQMEDSHSLITGGRDALLKLWDIEKAEELY 482

Query: 327 VTGA-------CVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTC-------Y 372
             GA       CV T+  H D + ++      +VSGS D+T++ W + +  C       +
Sbjct: 483 NDGATEGEEELCVHTFDAHVDEITALHFEGNSLVSGSQDRTIRQWDLTTGKCLQTIDINF 542

Query: 373 TLRGHTGWVNCVKL-HPKS--------------FTCF-----SGSDDMTIRMWDIRTNTC 412
             RG +G  + +   +P+S                C+     +G+ D  +R+WD+R+   
Sbjct: 543 ANRGTSGGFSKISSNNPRSSILLTHNDPPVIGALQCYDAAMATGTKDGLVRLWDLRSGQV 602

Query: 413 VRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHL 472
           +R   GH                                    +V    FD       +L
Sbjct: 603 IRTLEGHT----------------------------------DAVTGLQFD-----SVNL 623

Query: 473 LSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWD 525
           ++ SLD +I++W+++TG  +   F +   +  +  D   I+  +++   +V++
Sbjct: 624 VTGSLDRSIRIWDLRTG-LLADAFAYNSPISSLQFDLEHILVSNNESVVQVYN 675

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 42/62 (67%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVS 333
           TG+ D  V +WDL +G++IR L GHTD V  L+FD   L+TGSLD++IR+W+  TG    
Sbjct: 585 TGTKDGLVRLWDLRSGQVIRTLEGHTDAVTGLQFDSVNLVTGSLDRSIRIWDLRTGLLAD 644

Query: 334 TY 335
            +
Sbjct: 645 AF 646

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 78/186 (41%), Gaps = 45/186 (24%)

Query: 274 TGSYDSTVAIWDLATGK--------------LIRRLSGHTDGVKALRFDDQKLITGSLDK 319
           TG  D+ + +WD+   +               +     H D + AL F+   L++GS D+
Sbjct: 463 TGGRDALLKLWDIEKAEELYNDGATEGEEELCVHTFDAHVDEITALHFEGNSLVSGSQDR 522

Query: 320 TIRVWNYVTGACVSTY------RG--------------------HQDS--VLSVDSFRKL 351
           TIR W+  TG C+ T       RG                    H D   + ++  +   
Sbjct: 523 TIRQWDLTTGKCLQTIDINFANRGTSGGFSKISSNNPRSSILLTHNDPPVIGALQCYDAA 582

Query: 352 IVSGSADKTVKVWHVES-RTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTN 410
           + +G+ D  V++W + S +   TL GHT  V  ++    S    +GS D +IR+WD+RT 
Sbjct: 583 MATGTKDGLVRLWDLRSGQVIRTLEGHTDAVTGLQF--DSVNLVTGSLDRSIRIWDLRTG 640

Query: 411 TCVRVF 416
                F
Sbjct: 641 LLADAF 646

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 59/277 (21%), Positives = 106/277 (38%), Gaps = 87/277 (31%)

Query: 326 YVTGACVSTY-RGHQDSVLSVD---SFRKLIVSGSADKTVKVWHVESRT-CYTLRGHTGW 380
           Y  G  +S++ + H DS+  +D    F  +  +G  D +VK+W++  +T    L GH   
Sbjct: 390 YEPGTQISSFPKAHDDSITCLDFDLPFGTMCTAGKLDHSVKIWNLSKKTQIGALPGHLAS 449

Query: 381 VNCVKLHPKSFTCFSGSDDMTIRMWDI--------------RTNTCVRVFHGHVGQVQKV 426
           V+C+++   S +  +G  D  +++WDI                  CV  F  HV +    
Sbjct: 450 VSCMQME-DSHSLITGGRDALLKLWDIEKAEELYNDGATEGEEELCVHTFDAHVDE---- 504

Query: 427 IPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNV 486
                                         + A +F+ +      L+S S D TI+ W++
Sbjct: 505 ------------------------------ITALHFEGN-----SLVSGSQDRTIRQWDL 529

Query: 487 KTGACIRT------QFGHVEGVWDIAADNFR----------------------IVSGSHD 518
            TG C++T        G   G   I+++N R                      + +G+ D
Sbjct: 530 TTGKCLQTIDINFANRGTSGGFSKISSNNPRSSILLTHNDPPVIGALQCYDAAMATGTKD 589

Query: 519 RSCKVWDLQTGKCMHTFVGIHAPVACVGIGDSEFVSG 555
              ++WDL++G+ + T  G    V  +       V+G
Sbjct: 590 GLVRLWDLRSGQVIRTLEGHTDAVTGLQFDSVNLVTG 626

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 65/147 (44%), Gaps = 32/147 (21%)

Query: 252 IQEFKGHMDGVXXXXXXXXXXXTGSYDSTVAIWDLATGKLI---------RRLSG----- 297
           +  F  H+D +           +GS D T+  WDL TGK +         R  SG     
Sbjct: 495 VHTFDAHVDEITALHFEGNSLVSGSQDRTIRQWDLTTGKCLQTIDINFANRGTSGGFSKI 554

Query: 298 ------------HTDG--VKALRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSV- 342
                       H D   + AL+  D  + TG+ D  +R+W+  +G  + T  GH D+V 
Sbjct: 555 SSNNPRSSILLTHNDPPVIGALQCYDAAMATGTKDGLVRLWDLRSGQVIRTLEGHTDAVT 614

Query: 343 -LSVDSFRKLIVSGSADKTVKVWHVES 368
            L  DS    +V+GS D+++++W + +
Sbjct: 615 GLQFDSVN--LVTGSLDRSIRIWDLRT 639

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 1/74 (1%)

Query: 252 IQEFKGHMDGVXXXXXXXXXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK 311
           I+  +GH D V           TGS D ++ IWDL TG L+     +   + +L+FD + 
Sbjct: 603 IRTLEGHTDAVTGLQFDSVNLVTGSLDRSIRIWDLRTG-LLADAFAYNSPISSLQFDLEH 661

Query: 312 LITGSLDKTIRVWN 325
           ++  + +  ++V+N
Sbjct: 662 ILVSNNESVVQVYN 675

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 48/111 (43%), Gaps = 15/111 (13%)

Query: 462 FDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA-ADNFRIVSGSHDRS 520
            D  LP+ T   +  LD+++K+WN+     I    GH+  V  +   D+  +++G  D  
Sbjct: 410 LDFDLPFGTMCTAGKLDHSVKIWNLSKKTQIGALPGHLASVSCMQMEDSHSLITGGRDAL 469

Query: 521 CKVWDLQTGK--------------CMHTFVGIHAPVACVGIGDSEFVSGDE 557
            K+WD++  +              C+HTF      +  +    +  VSG +
Sbjct: 470 LKLWDIEKAEELYNDGATEGEEELCVHTFDAHVDEITALHFEGNSLVSGSQ 520

>KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1 40S
           small subunit ribosomal protein, start by similarity
          Length = 326

 Score = 80.9 bits (198), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 85/182 (46%), Gaps = 23/182 (12%)

Query: 274 TGSYDSTVAIWDLAT-----GKLIRRLSGHTDGVK--ALRFDDQKLITGSLDKTIRVWNY 326
           +GS D T+  W L       G  +R   GH+  V+   +  D    ++ S DKT+R+WN 
Sbjct: 36  SGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIVQDVVVSADGNYAVSASWDKTLRLWNL 95

Query: 327 VTGACVSTYRGHQDSVLSV--DSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCV 384
            TG   + + GH   VLSV  D+    I+S S DKT++VW+      Y L GHT WV  V
Sbjct: 96  ATGNSEARFVGHTGDVLSVAIDANSSKIISASRDKTIRVWNTVGDCAYVLLGHTDWVTKV 155

Query: 385 KLHPKSF----------TCFSGSDDMTIRMWDIRTNTCVRV---FHGHVGQVQKVIPLTL 431
           ++ PK+           T  S   D  +R W +  ++  R+   F GH   +  V P   
Sbjct: 156 RVAPKNLEDGEVDDGRITFVSAGMDKIVRSWSLNEDSY-RIEADFIGHNNYINVVQPSPD 214

Query: 432 GS 433
           GS
Sbjct: 215 GS 216

 Score = 75.5 bits (184), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 78/184 (42%), Gaps = 20/184 (10%)

Query: 252 IQEFKGHMDGVXXXXXXX--XXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFD- 308
           ++ +KGH   V             + S+D T+ +W+LATG    R  GHT  V ++  D 
Sbjct: 59  VRSYKGHSHIVQDVVVSADGNYAVSASWDKTLRLWNLATGNSEARFVGHTGDVLSVAIDA 118

Query: 309 -DQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVL------------SVDSFRKLIVSG 355
              K+I+ S DKTIRVWN V G C     GH D V              VD  R   VS 
Sbjct: 119 NSSKIISASRDKTIRVWNTV-GDCAYVLLGHTDWVTKVRVAPKNLEDGEVDDGRITFVSA 177

Query: 356 SADKTVKVWHVES---RTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTC 412
             DK V+ W +     R      GH  ++N V+  P      S   D  I +W+++  + 
Sbjct: 178 GMDKIVRSWSLNEDSYRIEADFIGHNNYINVVQPSPDGSLAASAGKDGQIYVWNLKHKSA 237

Query: 413 VRVF 416
              F
Sbjct: 238 FMNF 241

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 67/173 (38%), Gaps = 46/173 (26%)

Query: 373 TLRGHTGWVNCVKLHPKSFTCF-SGSDDMTIRMWDIRTN-----TCVRVFHGHVGQVQKV 426
           TL GH GWV  +           SGS D T+  W +  N       VR + GH   VQ V
Sbjct: 13  TLEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIVQDV 72

Query: 427 IPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNV 486
           +    G+                                     + +S S D T++LWN+
Sbjct: 73  VVSADGN-------------------------------------YAVSASWDKTLRLWNL 95

Query: 487 KTGACIRTQFGHVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQTGKCMHTFVG 537
            TG       GH   V  +A  A++ +I+S S D++ +VW+   G C +  +G
Sbjct: 96  ATGNSEARFVGHTGDVLSVAIDANSSKIISASRDKTIRVWN-TVGDCAYVLLG 147

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/215 (25%), Positives = 79/215 (36%), Gaps = 59/215 (27%)

Query: 334 TYRGHQDSVLSVDSFR---KLIVSGSADKTVKVWHVESRT------CYTLRGHTGWVNCV 384
           T  GH   V S+ +      L+VSGS DKT+  W +            + +GH+  V  V
Sbjct: 13  TLEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIVQDV 72

Query: 385 KLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXX 444
            +        S S D T+R+W++ T      F GH G V     L++  D          
Sbjct: 73  VVSADGNYAVSASWDKTLRLWNLATGNSEARFVGHTGDV-----LSVAID---------- 117

Query: 445 XXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVW- 503
                          AN        + ++S S D TI++WN   G C     GH + V  
Sbjct: 118 ---------------AN-------SSKIISASRDKTIRVWNT-VGDCAYVLLGHTDWVTK 154

Query: 504 ---------DIAADNFRI--VSGSHDRSCKVWDLQ 527
                    D   D+ RI  VS   D+  + W L 
Sbjct: 155 VRVAPKNLEDGEVDDGRITFVSAGMDKIVRSWSLN 189

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 43/90 (47%), Gaps = 7/90 (7%)

Query: 465 SLPYPTHLLSCSLDNTIKLWNV-----KTGACIRTQFGHVEGVWDI--AADNFRIVSGSH 517
           S   P  L+S S D T+  W +     + G  +R+  GH   V D+  +AD    VS S 
Sbjct: 27  SAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIVQDVVVSADGNYAVSASW 86

Query: 518 DRSCKVWDLQTGKCMHTFVGIHAPVACVGI 547
           D++ ++W+L TG     FVG    V  V I
Sbjct: 87  DKTLRLWNLATGNSEARFVGHTGDVLSVAI 116

>KLLA0F21406g complement(1996260..1998377) similar to sp|P47025
           Saccharomyces cerevisiae YJL112w MDV1, start by
           similarity
          Length = 705

 Score = 81.3 bits (199), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 58/242 (23%), Positives = 102/242 (42%), Gaps = 43/242 (17%)

Query: 315 GSLDKTIRVWNYVTGACVSTYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWHVESRTC- 371
           GSLD +++VW+      ++T  GH  S+  + +D +  LI +G  D  +K+W ++     
Sbjct: 416 GSLDHSVKVWDLSKKKQIATLHGHLASISCMQIDQYSTLI-TGGRDAVLKLWDIDKAMAD 474

Query: 372 -------------YTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRV--- 415
                        YT   H   +  +     +    SGS D T+R WD+ +  C +    
Sbjct: 475 EASNSSEDNDACLYTFDSHVDEITAISFDGDNLV--SGSQDRTVRQWDLNSGKCTQTIDI 532

Query: 416 -FHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLS 474
            F     + Q+ IPL                          ++Q   FD +L   T    
Sbjct: 533 SFATGPMRSQRNIPL------------RNSVLLTKEPPAIGALQC--FDAALATGTK--- 575

Query: 475 CSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHT 534
              D  ++LW++++G  +R   GH + +  +  D+  +V+G+ DRS ++WDL+TG     
Sbjct: 576 ---DGIVRLWDLRSGKVVRMLEGHTDAITSLQFDSVNLVTGAMDRSIRIWDLRTGILSDV 632

Query: 535 FV 536
           F 
Sbjct: 633 FA 634

 Score = 79.0 bits (193), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 69/303 (22%), Positives = 127/303 (41%), Gaps = 78/303 (25%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDD-QKLITGSLDKTIRVWNYVTG---- 329
           GS D +V +WDL+  K I  L GH   +  ++ D    LITG  D  +++W+        
Sbjct: 416 GSLDHSVKVWDLSKKKQIATLHGHLASISCMQIDQYSTLITGGRDAVLKLWDIDKAMADE 475

Query: 330 ---------ACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTC---YTLRGH 377
                    AC+ T+  H D + ++      +VSGS D+TV+ W + S  C     +   
Sbjct: 476 ASNSSEDNDACLYTFDSHVDEITAISFDGDNLVSGSQDRTVRQWDLNSGKCTQTIDISFA 535

Query: 378 TGWV---------NCVKLHPK-----SFTCF-----SGSDDMTIRMWDIRTNTCVRVFHG 418
           TG +         N V L  +     +  CF     +G+ D  +R+WD+R+   VR+  G
Sbjct: 536 TGPMRSQRNIPLRNSVLLTKEPPAIGALQCFDAALATGTKDGIVRLWDLRSGKVVRMLEG 595

Query: 419 HVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLD 478
           H                                    ++ +  FD       +L++ ++D
Sbjct: 596 HTD----------------------------------AITSLQFD-----SVNLVTGAMD 616

Query: 479 NTIKLWNVKTGACIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGI 538
            +I++W+++TG  +   F + + +  +  D  +IV  +++ + K+++ + G   H F G 
Sbjct: 617 RSIRIWDLRTG-ILSDVFAYEQPITSLHFDLDKIVISNNEPTVKIYNRKDGN--HWFCGE 673

Query: 539 HAP 541
             P
Sbjct: 674 DDP 676

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 33/92 (35%), Positives = 58/92 (63%), Gaps = 1/92 (1%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVS 333
           TG+ D  V +WDL +GK++R L GHTD + +L+FD   L+TG++D++IR+W+  TG    
Sbjct: 572 TGTKDGIVRLWDLRSGKVVRMLEGHTDAITSLQFDSVNLVTGAMDRSIRIWDLRTGILSD 631

Query: 334 TYRGHQDSVLSVDSFRKLIVSGSADKTVKVWH 365
            +  ++  + S+      IV  + + TVK+++
Sbjct: 632 VF-AYEQPITSLHFDLDKIVISNNEPTVKIYN 662

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 77/180 (42%), Gaps = 39/180 (21%)

Query: 274 TGSYDSTVAIWDLATGKL-------------IRRLSGHTDGVKALRFDDQKLITGSLDKT 320
           TG  D+ + +WD+                  +     H D + A+ FD   L++GS D+T
Sbjct: 456 TGGRDAVLKLWDIDKAMADEASNSSEDNDACLYTFDSHVDEITAISFDGDNLVSGSQDRT 515

Query: 321 IRVWNYVTGACVST---------YRGHQD-----SVL---------SVDSFRKLIVSGSA 357
           +R W+  +G C  T          R  ++     SVL         ++  F   + +G+ 
Sbjct: 516 VRQWDLNSGKCTQTIDISFATGPMRSQRNIPLRNSVLLTKEPPAIGALQCFDAALATGTK 575

Query: 358 DKTVKVWHVES-RTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVF 416
           D  V++W + S +    L GHT  +  ++    S    +G+ D +IR+WD+RT     VF
Sbjct: 576 DGIVRLWDLRSGKVVRMLEGHTDAITSLQF--DSVNLVTGAMDRSIRIWDLRTGILSDVF 633

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 59/137 (43%), Gaps = 23/137 (16%)

Query: 255 FKGHMDGVXXXXXXXXXXXTGSYDSTVAIWDLATGKLIRR-------------------- 294
           F  H+D +           +GS D TV  WDL +GK  +                     
Sbjct: 490 FDSHVDEITAISFDGDNLVSGSQDRTVRQWDLNSGKCTQTIDISFATGPMRSQRNIPLRN 549

Query: 295 ---LSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKL 351
              L+     + AL+  D  L TG+ D  +R+W+  +G  V    GH D++ S+      
Sbjct: 550 SVLLTKEPPAIGALQCFDAALATGTKDGIVRLWDLRSGKVVRMLEGHTDAITSLQFDSVN 609

Query: 352 IVSGSADKTVKVWHVES 368
           +V+G+ D+++++W + +
Sbjct: 610 LVTGAMDRSIRIWDLRT 626

 Score = 42.4 bits (98), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 40/78 (51%), Gaps = 1/78 (1%)

Query: 252 IQEFKGHMDGVXXXXXXXXXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK 311
           ++  +GH D +           TG+ D ++ IWDL TG ++  +  +   + +L FD  K
Sbjct: 590 VRMLEGHTDAITSLQFDSVNLVTGAMDRSIRIWDLRTG-ILSDVFAYEQPITSLHFDLDK 648

Query: 312 LITGSLDKTIRVWNYVTG 329
           ++  + + T++++N   G
Sbjct: 649 IVISNNEPTVKIYNRKDG 666

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 20/34 (58%)

Query: 514 SGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGI 547
           +GS D S KVWDL   K + T  G  A ++C+ I
Sbjct: 415 AGSLDHSVKVWDLSKKKQIATLHGHLASISCMQI 448

>CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces
           cerevisiae YCR084c TUP1 general transcription repressor,
           hypothetical start
          Length = 643

 Score = 80.5 bits (197), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 76/313 (24%), Positives = 124/313 (39%), Gaps = 78/313 (24%)

Query: 278 DSTVAIWDLATGKLIRRL-----SGHTDG---------VKALRF--DDQKLITGSLDKTI 321
           + T  I+++ATG L+  L     +G  D          ++++ F  D + L TG+ DK I
Sbjct: 338 NKTTKIFEVATGNLVTELVDDTKTGTEDANSASSADLYIRSVCFSPDGKFLATGAEDKLI 397

Query: 322 RVWNYVTGACVSTYRGHQDSVLSVDSFR--KLIVSGSADKTVKVWHVESRTCYTLRGHTG 379
           R+W+      V   RGH+  + S+D F+    +VSGS D+T+++W + +  C        
Sbjct: 398 RIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSGDRTIRIWDLHTGQCSLTLSIED 457

Query: 380 WVNCVKLHPKSFT-CFSGSDDMTIRMWDIRTNTCVRVFH-------GHVGQVQKVIPLTL 431
            V  V + P +     +GS D T+R+WD  +   V           GH   V  V+    
Sbjct: 458 GVTTVAVSPGNGNYVAAGSLDRTVRVWDSNSGFLVERLDSEGETGVGHKDSVYSVVFTRD 517

Query: 432 GSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKT--- 488
           G +++                                     S SLD ++KLWN++    
Sbjct: 518 GKNIV-------------------------------------SGSLDRSVKLWNLRNING 540

Query: 489 ----------GACIRTQFGHVEGVWDIAA--DNFRIVSGSHDRSCKVWDLQTGKCMHTFV 536
                     G C  T  GH + V  +    ++  I+SGS DR    WD  +G  +    
Sbjct: 541 ASTSPQPKTEGNCEMTYIGHKDFVLSVTTTENDQYILSGSKDRGVIFWDKVSGVPLLMLQ 600

Query: 537 GIHAPVACVGIGD 549
           G    V  V + +
Sbjct: 601 GHRNSVISVAVAN 613

 Score = 71.6 bits (174), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 69/230 (30%), Positives = 96/230 (41%), Gaps = 38/230 (16%)

Query: 223 APQSRMRPWKVVYRERFKVESNWRKGIYRIQEFKGHMDGVXXXXXXXXXXXTGSYDSTVA 282
           A    +R W +  R+   V     + IY +  F+     V           +GS D T+ 
Sbjct: 392 AEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLV-----------SGSGDRTIR 440

Query: 283 IWDLATGKLIRRLSGHTDGVKALRF---DDQKLITGSLDKTIRVWNYVTGACVS------ 333
           IWDL TG+    LS   DGV  +     +   +  GSLD+T+RVW+  +G  V       
Sbjct: 441 IWDLHTGQCSLTLSIE-DGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNSGFLVERLDSEG 499

Query: 334 -TYRGHQDSVLSVDSFR--KLIVSGSADKTVKVWHV--------------ESRTCYTLRG 376
            T  GH+DSV SV   R  K IVSGS D++VK+W++              E     T  G
Sbjct: 500 ETGVGHKDSVYSVVFTRDGKNIVSGSLDRSVKLWNLRNINGASTSPQPKTEGNCEMTYIG 559

Query: 377 HTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKV 426
           H  +V  V          SGS D  +  WD  +   + +  GH   V  V
Sbjct: 560 HKDFVLSVTTTENDQYILSGSKDRGVIFWDKVSGVPLLMLQGHRNSVISV 609

 Score = 71.2 bits (173), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 73/276 (26%), Positives = 110/276 (39%), Gaps = 46/276 (16%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGAC 331
           TG+ D  + IWD+A  K++  L GH   + +L +     KL++GS D+TIR+W+  TG C
Sbjct: 390 TGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSGDRTIRIWDLHTGQC 449

Query: 332 VSTYRGHQDSVLSV---DSFRKLIVSGSADKTVKVWHVES--------RTCYTLRGHTGW 380
             T    +D V +V         + +GS D+TV+VW   S            T  GH   
Sbjct: 450 SLTL-SIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNSGFLVERLDSEGETGVGHKDS 508

Query: 381 VNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXX 440
           V  V          SGS D ++++W++R        +G     Q   P T G+       
Sbjct: 509 VYSVVFTRDGKNIVSGSLDRSVKLWNLRN------INGASTSPQ---PKTEGN------- 552

Query: 441 XXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVE 500
                          SV     D       ++LS S D  +  W+  +G  +    GH  
Sbjct: 553 --CEMTYIGHKDFVLSVTTTENDQ------YILSGSKDRGVIFWDKVSGVPLLMLQGHRN 604

Query: 501 GVWDIAADNFR--------IVSGSHDRSCKVWDLQT 528
            V  +A  N +          +GS D   K+W  QT
Sbjct: 605 SVISVAVANGKPLGANYNVFATGSGDCKAKIWKFQT 640

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 47/96 (48%), Gaps = 5/96 (5%)

Query: 467 PYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVW--DIAADNFRIVSGSHDRSCKVW 524
           P    L + + D  I++W++     +    GH + ++  D      ++VSGS DR+ ++W
Sbjct: 383 PDGKFLATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSGDRTIRIW 442

Query: 525 DLQTGKCMHTFVGIHAPVACVGI--GDSEFVSGDEL 558
           DL TG+C  T   I   V  V +  G+  +V+   L
Sbjct: 443 DLHTGQCSLTL-SIEDGVTTVAVSPGNGNYVAAGSL 477

>Kwal_26.7570
          Length = 218

 Score = 75.9 bits (185), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 66/125 (52%), Gaps = 9/125 (7%)

Query: 274 TGSYDSTVAIWDLA-----TGKLIRRLSGHTDGVK--ALRFDDQKLITGSLDKTIRVWNY 326
           +GS D ++  W L       G  +R   GH+  V+   +  D +  ++ S DKT+R+W  
Sbjct: 35  SGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDCTVTPDGEYALSASWDKTVRLWEL 94

Query: 327 VTGACVSTYRGHQDSVLSVDSFRKL--IVSGSADKTVKVWHVESRTCYTLRGHTGWVNCV 384
            TG C+  + GH+  VLSV   R+   IVS S DKTVKVW+       TL GH  WV+ V
Sbjct: 95  ATGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVWNTLGECMVTLLGHNDWVSQV 154

Query: 385 KLHPK 389
           ++ P 
Sbjct: 155 RVAPN 159

 Score = 59.7 bits (143), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 74/187 (39%), Gaps = 46/187 (24%)

Query: 373 TLRGHTGWVNCVKLHP-KSFTCFSGSDDMTIRMW-----DIRTNTCVRVFHGHVGQVQKV 426
           TL GH GWV  +   P +     SGS D ++  W     D +    VR F GH   VQ  
Sbjct: 12  TLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDC 71

Query: 427 IPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNV 486
                                                   P   + LS S D T++LW +
Sbjct: 72  T-------------------------------------VTPDGEYALSASWDKTVRLWEL 94

Query: 487 KTGACIRTQFGHVEGVWDIAADN--FRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVAC 544
            TG CI+   GH   V  +  D    +IVS S D++ KVW+   G+CM T +G +  V+ 
Sbjct: 95  ATGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVWN-TLGECMVTLLGHNDWVSQ 153

Query: 545 VGIGDSE 551
           V +  +E
Sbjct: 154 VRVAPNE 160

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 77/214 (35%), Gaps = 55/214 (25%)

Query: 334 TYRGHQDSVLSVDSFR---KLIVSGSADKTVKVWHVESR------TCYTLRGHTGWVNCV 384
           T  GH   V S+ +      L++SGS DK++  W +            + RGH+  V   
Sbjct: 12  TLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDC 71

Query: 385 KLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXX 444
            + P      S S D T+R+W++ T  C++ F GH   V  V      S ++        
Sbjct: 72  TVTPDGEYALSASWDKTVRLWELATGKCIQRFVGHKSDVLSVTIDRRASQIV-------- 123

Query: 445 XXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWD 504
                                        S S D T+K+WN   G C+ T  GH + V  
Sbjct: 124 -----------------------------SASRDKTVKVWNT-LGECMVTLLGHNDWVSQ 153

Query: 505 IAA--------DNFRIVSGSHDRSCKVWDLQTGK 530
           +          +   ++S   D+  KV    T K
Sbjct: 154 VRVAPNESPEDETVTVISAGMDKVVKVCSTNTMK 187

>Kwal_23.6429
          Length = 750

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 72/267 (26%), Positives = 104/267 (38%), Gaps = 63/267 (23%)

Query: 308 DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRK--LIVSGSADKTVKVWH 365
           D + L TG+ DK IR+W+  T   V T +GH+  + S+D F     +VSGS D+TV++W 
Sbjct: 481 DGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 540

Query: 366 VESRTCYTLRGHTGWVNCVKLHPKSFTCF-SGSDDMTIRMWDIRTNTCVRVFH------- 417
           + +  C         V  V + P       +GS D T+R+WD  T   V           
Sbjct: 541 LRTGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSENELGT 600

Query: 418 GHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSL 477
           GH   V  V+    G  ++                                     S SL
Sbjct: 601 GHKDSVYSVVFTRDGHGVV-------------------------------------SGSL 623

Query: 478 DNTIKLWNVK------------TGACIRTQFGHVEGVWDIAA---DNFRIVSGSHDRSCK 522
           D ++KLWN++            T A   T  GH + V  +A    D F I+SGS DR   
Sbjct: 624 DRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFVLSVATTQNDEF-ILSGSKDRGVL 682

Query: 523 VWDLQTGKCMHTFVGIHAPVACVGIGD 549
            WD  +G  +    G    V  V + +
Sbjct: 683 FWDTPSGNPLLMLQGHRNSVISVAVAN 709

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 70/274 (25%), Positives = 111/274 (40%), Gaps = 51/274 (18%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGAC 331
           TG+ D  + IWDLAT +++  L GH   + +L +     KL++GS D+T+R+W+  TG C
Sbjct: 487 TGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQC 546

Query: 332 VSTYRGHQDSVLSV---DSFRKLIVSGSADKTVKVWHVESRTCYTLR----------GHT 378
             T    +D V +V       KLI +GS D+TV++W  +S T + +           GH 
Sbjct: 547 SLTL-SIEDGVTTVAVSPGDGKLIAAGSLDRTVRIW--DSETGFLVERLDSENELGTGHK 603

Query: 379 GWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEX 438
             V  V          SGS D ++++W++R+        G        +  T   D +  
Sbjct: 604 DSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANG-GTAEGKANTAASEVTYTGHKDFV-- 660

Query: 439 XXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGH 498
                            SV     D        +LS S D  +  W+  +G  +    GH
Sbjct: 661 ----------------LSVATTQNDE------FILSGSKDRGVLFWDTPSGNPLLMLQGH 698

Query: 499 VEGVWDIAADNFR--------IVSGSHDRSCKVW 524
              V  +A  N            +GS D   ++W
Sbjct: 699 RNSVISVAVANDHPLGPEYGVFATGSGDCKARIW 732

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 54/236 (22%), Positives = 91/236 (38%), Gaps = 52/236 (22%)

Query: 298 HTDGVKALRFD-DQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKLIVSGS 356
           H+  V  +RF  D + +    +KT +V+   TG  ++  R  +D+  +         S +
Sbjct: 399 HSSVVCCVRFSHDGEFLATGCNKTTQVYKVSTGELIA--RLSEDASSAPSGADASATSEN 456

Query: 357 ADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVF 416
           A  +  V    S   Y        +  V   P      +G++D  IR+WD+ T   V   
Sbjct: 457 AKASPAVATSASSDLY--------IRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTL 508

Query: 417 HGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCS 476
            GH   +                                     + D+  P    L+S S
Sbjct: 509 QGHEQDIY------------------------------------SLDY-FPSGDKLVSGS 531

Query: 477 LDNTIKLWNVKTGACIRTQFGHVEGVWDIA---ADNFRIVSGSHDRSCKVWDLQTG 529
            D T+++W+++TG C  T     +GV  +A    D   I +GS DR+ ++WD +TG
Sbjct: 532 GDRTVRIWDLRTGQCSLT-LSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETG 586

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 51/93 (54%), Gaps = 9/93 (9%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNF----RIVSGSHDRSCKVWDLQ 527
           L + + D  I++W++ T   + T  GH + ++ +  D F    ++VSGS DR+ ++WDL+
Sbjct: 485 LATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSL--DYFPSGDKLVSGSGDRTVRIWDLR 542

Query: 528 TGKCMHTFVGIHAPVACVGI--GDSEFVSGDEL 558
           TG+C  T   I   V  V +  GD + ++   L
Sbjct: 543 TGQCSLTL-SIEDGVTTVAVSPGDGKLIAAGSL 574

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 60/168 (35%), Gaps = 71/168 (42%)

Query: 275 GSYDSTVAIWDLATGKLIRRL-------SGHTDGVKALRF--DDQKLITGSLDKTIRVWN 325
           GS D TV IWD  TG L+ RL       +GH D V ++ F  D   +++GSLD+++++WN
Sbjct: 572 GSLDRTVRIWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWN 631

Query: 326 Y------------VTGACVSTYRGHQD--------------------------------- 340
                         T A   TY GH+D                                 
Sbjct: 632 LRSANGGTAEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNP 691

Query: 341 ---------SVLSVDSFRK--------LIVSGSADKTVKVWHVESRTC 371
                    SV+SV             +  +GS D   ++W    +T 
Sbjct: 692 LLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIWKYSKQTS 739

>AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH]
           complement(257969..259858) [1890 bp, 629 aa]
          Length = 629

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 69/259 (26%), Positives = 103/259 (39%), Gaps = 56/259 (21%)

Query: 308 DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRK--LIVSGSADKTVKVWH 365
           D + L TG+ DK IR+W+  T   + T +GH+  + S+D F     +VSGS D+TV++W 
Sbjct: 363 DGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWD 422

Query: 366 VESRTCYTLRGHTGWVNCVKLHPKSFTCF-SGSDDMTIRMWDIRTNTCV-------RVFH 417
           + +  C         V  V + P       +GS D T+R+WD  T   V        +  
Sbjct: 423 LRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETGFLVERLDSENELST 482

Query: 418 GHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSL 477
           GH   V  V+    G  +I                                     S SL
Sbjct: 483 GHKDSVYSVVFTRDGQGVI-------------------------------------SGSL 505

Query: 478 DNTIKLWNVKT-------GACIRTQFGHVEGVWDIAA--DNFRIVSGSHDRSCKVWDLQT 528
           D ++KLW+++          C  T  GH + V  +A   D+  I+SGS DR    WD  +
Sbjct: 506 DRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTAS 565

Query: 529 GKCMHTFVGIHAPVACVGI 547
           G  +    G    V  V +
Sbjct: 566 GNPLLMLQGHRNSVISVAV 584

 Score = 75.9 bits (185), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 81/168 (48%), Gaps = 25/168 (14%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGAC 331
           TG+ D  + IWDL T K++  L GH   + +L +     KL++GS D+T+R+W+  TG C
Sbjct: 369 TGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQC 428

Query: 332 VSTYRGHQDSVLSV---DSFRKLIVSGSADKTVKVWHVESRTCYTLR----------GHT 378
             T    +D V +V       K I +GS D+TV+VW  +S T + +           GH 
Sbjct: 429 SLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRTVRVW--DSETGFLVERLDSENELSTGHK 485

Query: 379 GWVNCVKLHPKSFTCFSGSDDMTIRMWDIRT-------NTCVRVFHGH 419
             V  V          SGS D ++++WD+R         TC   + GH
Sbjct: 486 DSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNGQKSHATCEVTYTGH 533

 Score = 75.1 bits (183), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 64/185 (34%), Positives = 86/185 (46%), Gaps = 24/185 (12%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF---DDQKLITGSLDKTIRVWNYVTGA 330
           +GS D TV IWDL TG+    LS   DGV  +     D + +  GSLD+T+RVW+  TG 
Sbjct: 411 SGSGDRTVRIWDLRTGQCSLTLSIE-DGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETGF 469

Query: 331 CVSTY-------RGHQDSVLSVDSFR--KLIVSGSADKTVKVWHVES-------RTC-YT 373
            V           GH+DSV SV   R  + ++SGS D++VK+W +          TC  T
Sbjct: 470 LVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNGQKSHATCEVT 529

Query: 374 LRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGH---VGQVQKVIPLT 430
             GH  +V  V          SGS D  +  WD  +   + +  GH   V  V  V    
Sbjct: 530 YTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNSVISVAVVNGFP 589

Query: 431 LGSDL 435
           LG D+
Sbjct: 590 LGPDV 594

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 96/238 (40%), Gaps = 50/238 (21%)

Query: 298 HTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKLIVSG 355
           H+  V  +RF  D + L TG  +KT +V+   TG  ++  R   DSV  V++      +G
Sbjct: 275 HSSVVCCVRFSNDGEYLATG-CNKTTQVYKVSTGELLA--RLSDDSVAGVNNEAS---TG 328

Query: 356 SADK-TVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVR 414
            A+  T       S T         ++  V   P      +G++D  IR+WD+ T   + 
Sbjct: 329 PANNGTADNGGENSATIQPASSSDLYIRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILM 388

Query: 415 VFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLS 474
              GH   +                                     + D+  P    L+S
Sbjct: 389 TLQGHEQDIY------------------------------------SLDY-FPAGDKLVS 411

Query: 475 CSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA---ADNFRIVSGSHDRSCKVWDLQTG 529
            S D T+++W+++TG C  T     +GV  +A    D   I +GS DR+ +VWD +TG
Sbjct: 412 GSGDRTVRIWDLRTGQCSLT-LSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETG 468

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 54/98 (55%), Gaps = 9/98 (9%)

Query: 467 PYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNF----RIVSGSHDRSCK 522
           P   +L + + D  I++W++ T   + T  GH + ++ +  D F    ++VSGS DR+ +
Sbjct: 362 PDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSL--DYFPAGDKLVSGSGDRTVR 419

Query: 523 VWDLQTGKCMHTFVGIHAPVACVGI--GDSEFVSGDEL 558
           +WDL+TG+C  T   I   V  V +  GD ++++   L
Sbjct: 420 IWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSL 456

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 60/122 (49%), Gaps = 21/122 (17%)

Query: 274 TGSYDSTVAIWDL---------ATGKLIRRLSGHTDGV--KALRFDDQKLITGSLDKTIR 322
           +GS D +V +WDL         AT ++    +GH D V   A   DD+ +++GS D+ + 
Sbjct: 502 SGSLDRSVKLWDLRGLNGQKSHATCEVT--YTGHKDFVLSVATTQDDEYILSGSKDRGVL 559

Query: 323 VWNYVTGACVSTYRGHQDSVLS---VDSFR-----KLIVSGSADKTVKVWHVESRTCYTL 374
            W+  +G  +   +GH++SV+S   V+ F       +  +GS D   ++W    ++  T 
Sbjct: 560 FWDTASGNPLLMLQGHRNSVISVAVVNGFPLGPDVGVFATGSGDCKARIWKYTKKSNPTA 619

Query: 375 RG 376
            G
Sbjct: 620 TG 621

>KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA
           Kluyveromyces lactis Transcriptional repressor TUP1,
           start by similarity
          Length = 682

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 70/261 (26%), Positives = 104/261 (39%), Gaps = 56/261 (21%)

Query: 308 DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFR--KLIVSGSADKTVKVWH 365
           D + L TG+ DK IR+W+  T   V T +GH+  + S+D F     +VSGS D+TV++W 
Sbjct: 417 DGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWD 476

Query: 366 VESRTCYTLRGHTGWVNCVKLHPKSFTCF-SGSDDMTIRMWDIRTNTCVRVFH------- 417
           + + TC         V  V + P       +GS D T+R+WD  T   V           
Sbjct: 477 LTTGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGT 536

Query: 418 GHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSL 477
           GH   V  V+    G  ++                                     S SL
Sbjct: 537 GHRDSVYSVVFTRDGKGVV-------------------------------------SGSL 559

Query: 478 DNTIKLWNVKT-------GACIRTQFGHVEGVWDIAA--DNFRIVSGSHDRSCKVWDLQT 528
           D ++KLWN+           C  T  GH + V  +A   ++  I+SGS DR    WD ++
Sbjct: 560 DRSVKLWNLNGLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKS 619

Query: 529 GKCMHTFVGIHAPVACVGIGD 549
           G  +    G    V  V + +
Sbjct: 620 GNPLLMLQGHRNSVISVTVAN 640

 Score = 77.8 bits (190), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 82/175 (46%), Gaps = 25/175 (14%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVK--ALRFDDQKLIT-GSLDKTIRVWNYVTGA 330
           +GS D TV IWDL TG     LS   DGV   A+   + K I  GSLD+T+RVW+  TG 
Sbjct: 465 SGSGDRTVRIWDLTTGTCSLTLSIE-DGVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTGF 523

Query: 331 CVSTY-------RGHQDSVLSVDSFR--KLIVSGSADKTVKVW----------HVESRTC 371
            V           GH+DSV SV   R  K +VSGS D++VK+W          H E    
Sbjct: 524 LVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLNGLSGQKSHAECEVT 583

Query: 372 YTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKV 426
           YT  GH  +V  V          SGS D  +  WD ++   + +  GH   V  V
Sbjct: 584 YT--GHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISV 636

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 49/91 (53%), Gaps = 5/91 (5%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVW--DIAADNFRIVSGSHDRSCKVWDLQTG 529
           L + + D  I++W+++T   + T  GH + ++  D      ++VSGS DR+ ++WDL TG
Sbjct: 421 LATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDLTTG 480

Query: 530 KCMHTFVGIHAPVACVGI--GDSEFVSGDEL 558
            C  T   I   V  V +  G+ +F++   L
Sbjct: 481 TCSLTL-SIEDGVTTVAVSPGEGKFIAAGSL 510

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 59/153 (38%), Gaps = 41/153 (26%)

Query: 380 WVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXX 439
           ++  V   P      +G++D  IR+WD+ T   V    GH   +                
Sbjct: 408 YIRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIY--------------- 452

Query: 440 XXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHV 499
                                + D+  P    L+S S D T+++W++ TG C  T     
Sbjct: 453 ---------------------SLDY-FPSGNKLVSGSGDRTVRIWDLTTGTCSLT-LSIE 489

Query: 500 EGVWDIA---ADNFRIVSGSHDRSCKVWDLQTG 529
           +GV  +A    +   I +GS DR+ +VWD  TG
Sbjct: 490 DGVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTG 522

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 61/156 (39%), Gaps = 66/156 (42%)

Query: 275 GSYDSTVAIWDLATGKLIRRL-------SGHTDGVKALRF--DDQKLITGSLDKTIRVWN 325
           GS D TV +WD  TG L+ RL       +GH D V ++ F  D + +++GSLD+++++WN
Sbjct: 508 GSLDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWN 567

Query: 326 Y--VTG-----ACVSTYRGHQD-------------------------------------- 340
              ++G      C  TY GH+D                                      
Sbjct: 568 LNGLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQ 627

Query: 341 ----SVLSVDSFR--------KLIVSGSADKTVKVW 364
               SV+SV             +  +GS D   ++W
Sbjct: 628 GHRNSVISVTVANGHPLGPEYGVFATGSGDCKARIW 663

>KLLA0B01958g join(170646..170663,170896..173550) similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
           coatomer complex beta chain (beta -cop) of secretory
           pathway vesicles, hypothetical start
          Length = 890

 Score = 79.3 bits (194), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 67/242 (27%), Positives = 106/242 (43%), Gaps = 47/242 (19%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTG-AC 331
           GS D  + +++  TG+ +     H D ++++     K  ++TGS D TI++WN+     C
Sbjct: 73  GSDDFKLRVYNYNTGEKVTEFEAHPDYIRSIAVHPTKPFVLTGSDDLTIKLWNWEKNWGC 132

Query: 332 VSTYRGHQDSVLSVDSFRK---LIVSGSADKTVKVWHV-ESRTCYTLRGH-TGWVNCVKL 386
             T+ GH+  V+SV    K      SG  D T+KVW + +    +TL+ H T  VN V  
Sbjct: 133 QQTFTGHEHFVMSVAFNPKDPNQFASGCLDHTIKVWSIGQDVPNFTLKAHETKGVNYVDY 192

Query: 387 HPKSFTCF--SGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXX 444
           +P     +  + SDD TI++WD +T + V    GH+  V   +                 
Sbjct: 193 YPLQDKPYLITTSDDGTIKVWDYQTKSNVATLEGHMANVSYAV----------------- 235

Query: 445 XXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWD 504
                            F  +LP    ++S S D T+K+WN  T    +T    +E  W 
Sbjct: 236 -----------------FHPTLPI---IISGSEDGTLKIWNANTYKLEKTLNIGLERSWC 275

Query: 505 IA 506
           IA
Sbjct: 276 IA 277

 Score = 72.0 bits (175), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 67/262 (25%), Positives = 114/262 (43%), Gaps = 21/262 (8%)

Query: 293 RRLSGHTDGVKALRFDDQK---LITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSF- 348
           ++LS  TD VK + F  ++   LIT      I +WNY T   V +     D+ +    F 
Sbjct: 7   KKLSARTDRVKGIDFHPEEPWVLIT-LYSGRIEIWNYETQTQVRSIP-LCDAPVRAGRFI 64

Query: 349 --RKLIVSGSADKTVKVWHVESRTCYT-LRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMW 405
             +  +V GS D  ++V++  +    T    H  ++  + +HP      +GSDD+TI++W
Sbjct: 65  ARKNWVVVGSDDFKLRVYNYNTGEKVTEFEAHPDYIRSIAVHPTKPFVLTGSDDLTIKLW 124

Query: 406 DIRTN-TCVRVFHGHVGQVQKVI-----PLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQA 459
           +   N  C + F GH   V  V      P    S  ++                  + + 
Sbjct: 125 NWEKNWGCQQTFTGHEHFVMSVAFNPKDPNQFASGCLDHTIKVWSIGQDVPNFTLKAHET 184

Query: 460 ANFDHSLPYP----THLLSCSLDNTIKLWNVKTGACIRTQFGHVEGV-WDIAADNFR-IV 513
              ++   YP     +L++ S D TIK+W+ +T + + T  GH+  V + +       I+
Sbjct: 185 KGVNYVDYYPLQDKPYLITTSDDGTIKVWDYQTKSNVATLEGHMANVSYAVFHPTLPIII 244

Query: 514 SGSHDRSCKVWDLQTGKCMHTF 535
           SGS D + K+W+  T K   T 
Sbjct: 245 SGSEDGTLKIWNANTYKLEKTL 266

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 73/182 (40%), Gaps = 29/182 (15%)

Query: 244 NWRKGIYRIQEFKGH---MDGVXXXXXXXXXXXTGSYDSTVAIWDLATGKLIRRLSGH-T 299
           NW K     Q F GH   +  V           +G  D T+ +W +        L  H T
Sbjct: 125 NWEKNWGCQQTFTGHEHFVMSVAFNPKDPNQFASGCLDHTIKVWSIGQDVPNFTLKAHET 184

Query: 300 DGVKALRF----DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFR---KLI 352
            GV  + +    D   LIT S D TI+VW+Y T + V+T  GH  +V S   F     +I
Sbjct: 185 KGVNYVDYYPLQDKPYLITTSDDGTIKVWDYQTKSNVATLEGHMANV-SYAVFHPTLPII 243

Query: 353 VSGSADKTVKVWHVES---RTCYTLRGHTGWVNCVKLHP------------KSFTCFSGS 397
           +SGS D T+K+W+  +        +     W  C+  HP              FT  S  
Sbjct: 244 ISGSEDGTLKIWNANTYKLEKTLNIGLERSW--CIATHPSGKRNYIASGFDNGFTVLSLG 301

Query: 398 DD 399
           DD
Sbjct: 302 DD 303

>YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein that
           associates with Ccr4p, contains WD (WD-40) repeats [1980
           bp, 659 aa]
          Length = 659

 Score = 78.6 bits (192), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 60/94 (63%), Gaps = 1/94 (1%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVS 333
           TG+ D  V +WDL  GK +R L GHTDG+ +L+FD +KL+TGS+D ++R+W+  T + + 
Sbjct: 520 TGTKDGIVRLWDLRVGKPVRLLEGHTDGITSLKFDSEKLVTGSMDNSVRIWDLRTSSILD 579

Query: 334 TYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVE 367
               +   V S+D   KLI  G+ +  V V+++E
Sbjct: 580 VI-AYDLPVSSLDFDGKLITVGANEGGVNVFNME 612

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 66/272 (24%), Positives = 114/272 (41%), Gaps = 39/272 (14%)

Query: 298 HTDGVKALRFDDQ--KLITGSL-DKTIRVWNYVTGACVSTYRGHQDSV--LSVDSFR-KL 351
           H + + AL FD     L + S  D+ ++VW+   G  V    GH  +V  + +D     +
Sbjct: 334 HGNSITALDFDTPWGTLCSSSYQDRIVKVWDLNHGIQVGELPGHLATVNCMQIDKKNYNM 393

Query: 352 IVSGSADKTVKVWHVE-SRTCY---------TLRGHTGWVNCVKLHPKSFTCFS------ 395
           +++GS D T+K+W +  SR  Y         T    T  ++  +LH    T  S      
Sbjct: 394 LITGSKDATLKLWDLNLSREIYLDHSPLKEKTEEIVTPCIHNFELHKDEITALSFDSEAL 453

Query: 396 --GSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXX 453
             GS D  I  WD+ T  C+        Q   +I     SD+                  
Sbjct: 454 VSGSRDKKIFHWDLTTGKCI--------QQLDLIFTPTHSDI------KMPARSLNNGAC 499

Query: 454 XXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFRIV 513
               +A        Y + L + + D  ++LW+++ G  +R   GH +G+  +  D+ ++V
Sbjct: 500 LLGTEAPMIGALQCYNSALATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSLKFDSEKLV 559

Query: 514 SGSHDRSCKVWDLQTGKCMHTFVGIHAPVACV 545
           +GS D S ++WDL+T   +   +    PV+ +
Sbjct: 560 TGSMDNSVRIWDLRTSSILDV-IAYDLPVSSL 590

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/239 (23%), Positives = 93/239 (38%), Gaps = 55/239 (23%)

Query: 230 PWKVV----YRERFKVESNWRKGIYRIQEFKGHMDGVX---XXXXXXXXXXTGSYDSTVA 282
           PW  +    Y++R     +   GI ++ E  GH+  V              TGS D+T+ 
Sbjct: 346 PWGTLCSSSYQDRIVKVWDLNHGI-QVGELPGHLATVNCMQIDKKNYNMLITGSKDATLK 404

Query: 283 IWDLATGK-------------------LIRRLSGHTDGVKALRFDDQKLITGSLDKTIRV 323
           +WDL   +                    I     H D + AL FD + L++GS DK I  
Sbjct: 405 LWDLNLSREIYLDHSPLKEKTEEIVTPCIHNFELHKDEITALSFDSEALVSGSRDKKIFH 464

Query: 324 WNYVTGACVSTYR-----GHQDSVLSVDS--------------------FRKLIVSGSAD 358
           W+  TG C+          H D  +   S                    +   + +G+ D
Sbjct: 465 WDLTTGKCIQQLDLIFTPTHSDIKMPARSLNNGACLLGTEAPMIGALQCYNSALATGTKD 524

Query: 359 KTVKVWHVE-SRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVF 416
             V++W +   +    L GHT  +  +K   +     +GS D ++R+WD+RT++ + V 
Sbjct: 525 GIVRLWDLRVGKPVRLLEGHTDGITSLKFDSEKLV--TGSMDNSVRIWDLRTSSILDVI 581

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 66/337 (19%), Positives = 128/337 (37%), Gaps = 95/337 (28%)

Query: 274 TGSY-DSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK---LITGSLDKTIRVWNY--- 326
           + SY D  V +WDL  G  +  L GH   V  ++ D +    LITGS D T+++W+    
Sbjct: 352 SSSYQDRIVKVWDLNHGIQVGELPGHLATVNCMQIDKKNYNMLITGSKDATLKLWDLNLS 411

Query: 327 ----------------VTGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRT 370
                           +   C+  +  H+D + ++    + +VSGS DK +  W + +  
Sbjct: 412 REIYLDHSPLKEKTEEIVTPCIHNFELHKDEITALSFDSEALVSGSRDKKIFHWDLTTGK 471

Query: 371 CYTLRG--HTGWVNCVKLHPKSFT-----------------CF-----SGSDDMTIRMWD 406
           C        T   + +K+  +S                   C+     +G+ D  +R+WD
Sbjct: 472 CIQQLDLIFTPTHSDIKMPARSLNNGACLLGTEAPMIGALQCYNSALATGTKDGIVRLWD 531

Query: 407 IRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSL 466
           +R    VR+  GH                                     + +  FD   
Sbjct: 532 LRVGKPVRLLEGHTD----------------------------------GITSLKFDSE- 556

Query: 467 PYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDL 526
                L++ S+DN++++W+++T + +     +   V  +  D   I  G+++    V+++
Sbjct: 557 ----KLVTGSMDNSVRIWDLRTSSILDV-IAYDLPVSSLDFDGKLITVGANEGGVNVFNM 611

Query: 527 Q------TGKCMHTFVG--IHAPVACVGIGDSEFVSG 555
           +      T +  H+  G  +   +A V   D   ++G
Sbjct: 612 ERDEHWMTPEPPHSLDGDELSRRIAIVKYKDGFLING 648

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 69/167 (41%), Gaps = 25/167 (14%)

Query: 252 IQEFKGHMDGVXXXXXXXXXXXTGSYDSTVAIWDLATGKLIRRLS-----GHTD------ 300
           I  F+ H D +           +GS D  +  WDL TGK I++L       H+D      
Sbjct: 433 IHNFELHKDEITALSFDSEALVSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDIKMPAR 492

Query: 301 --------------GVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVD 346
                          + AL+  +  L TG+ D  +R+W+   G  V    GH D + S+ 
Sbjct: 493 SLNNGACLLGTEAPMIGALQCYNSALATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSLK 552

Query: 347 SFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTC 393
              + +V+GS D +V++W + + +   +  +   V+ +    K  T 
Sbjct: 553 FDSEKLVTGSMDNSVRIWDLRTSSILDVIAYDLPVSSLDFDGKLITV 599

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 54/248 (21%), Positives = 91/248 (36%), Gaps = 50/248 (20%)

Query: 338 HQDSVLSVD---SFRKLIVSGSADKTVKVWHVE-SRTCYTLRGHTGWVNCVKLHPKSFTC 393
           H +S+ ++D    +  L  S   D+ VKVW +        L GH   VNC+++  K++  
Sbjct: 334 HGNSITALDFDTPWGTLCSSSYQDRIVKVWDLNHGIQVGELPGHLATVNCMQIDKKNYNM 393

Query: 394 F-SGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXX 452
             +GS D T+++WD+  N    ++  H             S L E               
Sbjct: 394 LITGSKDATLKLWDL--NLSREIYLDH-------------SPLKEKTEEIVTPCIHNFEL 438

Query: 453 XXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQ---FGHVEGVWDIAAD- 508
               + A +FD        L+S S D  I  W++ TG CI+     F        + A  
Sbjct: 439 HKDEITALSFDSEA-----LVSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDIKMPARS 493

Query: 509 ---------------------NFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGI 547
                                N  + +G+ D   ++WDL+ GK +    G    +  +  
Sbjct: 494 LNNGACLLGTEAPMIGALQCYNSALATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSLKF 553

Query: 548 GDSEFVSG 555
              + V+G
Sbjct: 554 DSEKLVTG 561

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 39/74 (52%), Gaps = 1/74 (1%)

Query: 252 IQEFKGHMDGVXXXXXXXXXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK 311
           ++  +GH DG+           TGS D++V IWDL T  ++  ++ +   V +L FD + 
Sbjct: 538 VRLLEGHTDGITSLKFDSEKLVTGSMDNSVRIWDLRTSSILDVIA-YDLPVSSLDFDGKL 596

Query: 312 LITGSLDKTIRVWN 325
           +  G+ +  + V+N
Sbjct: 597 ITVGANEGGVNVFN 610

>Scas_603.5
          Length = 589

 Score = 77.8 bits (190), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 56/247 (22%), Positives = 104/247 (42%), Gaps = 71/247 (28%)

Query: 338 HQDSVLSVD---SFRKLIVSGSADKTVKVWHVESR-TCYTLRGHTGWVNCVKLHPKSFTC 393
           + D+V  +D   S + L  +G  + ++KVW +E+      L  H   V C++LHP S T 
Sbjct: 293 YTDTVTCLDFDLSTKMLYTAGKYNTSIKVWDLETNDQVMDLDDHIASVTCMQLHPDSKTL 352

Query: 394 FSGSDDMTIRMWDI------------RTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXX 441
            +GS D T+++WD+              ++C+  F  H  ++  V               
Sbjct: 353 ITGSKDATLKLWDLGLAPQTSLDSTSNIDSCINTFEAHTAEITSV--------------- 397

Query: 442 XXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRT---QFGH 498
                              ++D+      +LLS S D +I+ W++ TG C++T      H
Sbjct: 398 -------------------SYDNE-----YLLSASRDKSIRQWDLTTGNCVQTLEATLSH 433

Query: 499 ----------VEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGIG 548
                     VE +  + A    + +GS D   ++WDL++GK + T +    P+  +   
Sbjct: 434 NSGTNIKDSTVEALQSVGA---ALATGSKDGIIRLWDLRSGKVVRTLLKHQGPITSLQFD 490

Query: 549 DSEFVSG 555
            ++ ++G
Sbjct: 491 STKIITG 497

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 77/172 (44%), Gaps = 23/172 (13%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNY------ 326
           G Y++++ +WDL T   +  L  H   V  ++   D + LITGS D T+++W+       
Sbjct: 313 GKYNTSIKVWDLETNDQVMDLDDHIASVTCMQLHPDSKTLITGSKDATLKLWDLGLAPQT 372

Query: 327 ------VTGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCY-TLRG--- 376
                    +C++T+  H   + SV    + ++S S DK+++ W + +  C  TL     
Sbjct: 373 SLDSTSNIDSCINTFEAHTAEITSVSYDNEYLLSASRDKSIRQWDLTTGNCVQTLEATLS 432

Query: 377 HTGWVN-----CVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQV 423
           H    N        L        +GS D  IR+WD+R+   VR    H G +
Sbjct: 433 HNSGTNIKDSTVEALQSVGAALATGSKDGIIRLWDLRSGKVVRTLLKHQGPI 484

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 78/167 (46%), Gaps = 25/167 (14%)

Query: 274 TGSYDSTVAIWDL---------ATGKL---IRRLSGHTDGVKALRFDDQKLITGSLDKTI 321
           TGS D+T+ +WDL         +T  +   I     HT  + ++ +D++ L++ S DK+I
Sbjct: 354 TGSKDATLKLWDLGLAPQTSLDSTSNIDSCINTFEAHTAEITSVSYDNEYLLSASRDKSI 413

Query: 322 RVWNYVTGACVSTYRG----------HQDSVLSVDSFRKLIVSGSADKTVKVWHVES-RT 370
           R W+  TG CV T                +V ++ S    + +GS D  +++W + S + 
Sbjct: 414 RQWDLTTGNCVQTLEATLSHNSGTNIKDSTVEALQSVGAALATGSKDGIIRLWDLRSGKV 473

Query: 371 CYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFH 417
             TL  H G +  ++    S    +GS D  I + D+RT   +  +H
Sbjct: 474 VRTLLKHQGPITSLQF--DSTKIITGSTDANISVSDLRTGNILETYH 518

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 53/92 (57%), Gaps = 5/92 (5%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVS 333
           TGS D  + +WDL +GK++R L  H   + +L+FD  K+ITGS D  I V +  TG  + 
Sbjct: 456 TGSKDGIIRLWDLRSGKVVRTLLKHQGPITSLQFDSTKIITGSTDANISVSDLRTGNILE 515

Query: 334 TYRGHQDSVLSVDSFR--KLIVSGSADKTVKV 363
           TY  H D+ ++   F   KL+V+    K V+V
Sbjct: 516 TY--HCDAPINTFDFENDKLVVAADT-KDVRV 544

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 52/122 (42%), Gaps = 10/122 (8%)

Query: 252 IQEFKGHMDGVXXXXXXXXXXXTGSYDSTVAIWDLATGKLIRRLSG---HTDG------- 301
           I  F+ H   +           + S D ++  WDL TG  ++ L     H  G       
Sbjct: 384 INTFEAHTAEITSVSYDNEYLLSASRDKSIRQWDLTTGNCVQTLEATLSHNSGTNIKDST 443

Query: 302 VKALRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTV 361
           V+AL+     L TGS D  IR+W+  +G  V T   HQ  + S+      I++GS D  +
Sbjct: 444 VEALQSVGAALATGSKDGIIRLWDLRSGKVVRTLLKHQGPITSLQFDSTKIITGSTDANI 503

Query: 362 KV 363
            V
Sbjct: 504 SV 505

>Scas_629.12
          Length = 671

 Score = 77.4 bits (189), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 78/319 (24%), Positives = 125/319 (39%), Gaps = 84/319 (26%)

Query: 278 DSTVAIWDLATGKLIRRLS--------------GHTDG----VKALRF--DDQKLITGSL 317
           + T  I+ ++ G+LI +LS              G T      ++++ F  D + L TG+ 
Sbjct: 348 NKTTQIYRVSDGELIAKLSDDSVTSPDTSSATSGSTPSTDLYIRSVCFSPDGEFLATGAE 407

Query: 318 DKTIRVWNYVTGACVSTYRGHQDSVLSVDSFR--KLIVSGSADKTVKVWHVESRTCYTLR 375
           DK IR+W+      V   +GH+  V S+D F   + +VSGS D+TV++W + +  C    
Sbjct: 408 DKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDLRTGQCSLTL 467

Query: 376 GHTGWVNCVKLHPKSFTCFS-GSDDMTIRMWDIRTNTCVRVFH-------GHVGQVQKVI 427
                V  V + P      + GS D  +R+WD  T   V           GH   V  V+
Sbjct: 468 SIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHRDSVYSVV 527

Query: 428 PLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVK 487
               G++++                                     S SLD T+KLWN++
Sbjct: 528 FTRDGNEVV-------------------------------------SGSLDKTVKLWNMR 550

Query: 488 ---------------TGACIRTQFGHVEGVWDI--AADNFRIVSGSHDRSCKVWDLQTGK 530
                          +  C  T  GH + V  +  + D+  I+SGS DR    WD ++G 
Sbjct: 551 HSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGILFWDKESGN 610

Query: 531 CMHTFVGIHAPVACVGIGD 549
            +    G    V  V + +
Sbjct: 611 PLLMLQGHRNSVISVAVAN 629

 Score = 74.7 bits (182), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 82/181 (45%), Gaps = 29/181 (16%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVK--ALRFDDQKLIT-GSLDKTIRVWNYVTGA 330
           +GS D TV IWDL TG+    LS    GV   A+  +D K I  GSLD+ +RVW+  TG 
Sbjct: 446 SGSGDRTVRIWDLRTGQCSLTLSIEY-GVTTVAVSPNDGKFIAAGSLDRAVRVWDSTTGF 504

Query: 331 CVSTY-------RGHQDSVLSVDSFR--KLIVSGSADKTVKVWHVE-------------- 367
            V           GH+DSV SV   R    +VSGS DKTVK+W++               
Sbjct: 505 LVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGSLDKTVKLWNMRHSGNSNNESNDKGS 564

Query: 368 -SRTC-YTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQK 425
            S TC  T  GH  +V  V          SGS D  I  WD  +   + +  GH   V  
Sbjct: 565 ASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGILFWDKESGNPLLMLQGHRNSVIS 624

Query: 426 V 426
           V
Sbjct: 625 V 625

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 76/150 (50%), Gaps = 18/150 (12%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGAC 331
           TG+ D  + IWD+   K++  L GH   V +L +  + +KL++GS D+T+R+W+  TG C
Sbjct: 404 TGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDLRTGQC 463

Query: 332 ---VSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLR----------GHT 378
              +S   G     +S +   K I +GS D+ V+VW  +S T + +           GH 
Sbjct: 464 SLTLSIEYGVTTVAVSPND-GKFIAAGSLDRAVRVW--DSTTGFLVERLDSENELGTGHR 520

Query: 379 GWVNCVKLHPKSFTCFSGSDDMTIRMWDIR 408
             V  V          SGS D T+++W++R
Sbjct: 521 DSVYSVVFTRDGNEVVSGSLDKTVKLWNMR 550

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 49/91 (53%), Gaps = 5/91 (5%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVW--DIAADNFRIVSGSHDRSCKVWDLQTG 529
           L + + D  I++W+++    +    GH + V+  D   +  ++VSGS DR+ ++WDL+TG
Sbjct: 402 LATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDLRTG 461

Query: 530 KCMHTFVGIHAPVACVGI--GDSEFVSGDEL 558
           +C  T   I   V  V +   D +F++   L
Sbjct: 462 QCSLTL-SIEYGVTTVAVSPNDGKFIAAGSL 491

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 58/164 (35%), Gaps = 74/164 (45%)

Query: 275 GSYDSTVAIWDLATGKLIRRL-------SGHTDGVKALRF--DDQKLITGSLDKTIRVWN 325
           GS D  V +WD  TG L+ RL       +GH D V ++ F  D  ++++GSLDKT+++WN
Sbjct: 489 GSLDRAVRVWDSTTGFLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGSLDKTVKLWN 548

Query: 326 Y---------------VTGACVSTYRGHQD------------------------------ 340
                            +  C  TY GH+D                              
Sbjct: 549 MRHSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGILFWDKES 608

Query: 341 ------------SVLSVDSFR--------KLIVSGSADKTVKVW 364
                       SV+SV             +  +GS D   ++W
Sbjct: 609 GNPLLMLQGHRNSVISVAVANGSALGPKYNVFATGSGDCKARIW 652

>CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces
           cerevisiae YOR269w PAC1, hypothetical start
          Length = 467

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 87/186 (46%), Gaps = 45/186 (24%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVS 333
           + S D+TV +W +   + ++  S H++ VK++   D+ +++GSLD T+R+ ++ +G  +S
Sbjct: 240 SSSRDATVKVWRVNDSRCLQSFSPHSEWVKSIDVLDEYILSGSLDSTLRLTHWPSGNGLS 299

Query: 334 TYRGHQ------------DSVLSVDSFR-------------KLIVSGSADKTVKVWHVE- 367
              GH+            DS +    +R             K   S + D T+K+W V  
Sbjct: 300 VGTGHEFPIERVLIIPFSDSKICTSPYRDQNEHSAFAPLRFKYCASAARDNTIKIWEVPL 359

Query: 368 -------------SRTCY----TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTN 410
                        + T +    TLRGHT WV  +KL       FS SDD TI+ WD+ T 
Sbjct: 360 PQLKPNSAPVPSTTNTTFKCVMTLRGHTSWVKDLKLRGDHL--FSCSDDETIKCWDLNTG 417

Query: 411 TCVRVF 416
            CV+ +
Sbjct: 418 NCVKTW 423

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 69/264 (26%), Positives = 107/264 (40%), Gaps = 49/264 (18%)

Query: 314 TGSLDKTIRVWNYVTGA----CVSTYRGHQDSVLSVDSFRK----LIVSGSADKTVKVWH 365
           T S D  I V+++ +       + ++  H  +V S  +++K    L+ S S D TVKVW 
Sbjct: 192 TTSKDAQINVYDHSSNTGELKLIRSFNAHDSTVSSQKTWQKDNDVLLASSSRDATVKVWR 251

Query: 366 V-ESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQ 424
           V +SR   +   H+ WV  + +  +     SGS D T+R+    +   + V  GH   ++
Sbjct: 252 VNDSRCLQSFSPHSEWVKSIDVLDEYI--LSGSLDSTLRLTHWPSGNGLSVGTGHEFPIE 309

Query: 425 KVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCS---LDNTI 481
           +V+ +      I                   S      +HS   P     C+    DNTI
Sbjct: 310 RVLIIPFSDSKI-----------------CTSPYRDQNEHSAFAPLRFKYCASAARDNTI 352

Query: 482 KLWNVK-----------------TGACIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVW 524
           K+W V                  T  C+ T  GH   V D+      + S S D + K W
Sbjct: 353 KIWEVPLPQLKPNSAPVPSTTNTTFKCVMTLRGHTSWVKDLKLRGDHLFSCSDDETIKCW 412

Query: 525 DLQTGKCMHTFVGIHAP-VACVGI 547
           DL TG C+ T+  IH   + C+ I
Sbjct: 413 DLNTGNCVKTWSSIHNNFINCIDI 436

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 72/309 (23%), Positives = 113/309 (36%), Gaps = 90/309 (29%)

Query: 235 YRERFKVESNWRKGIYRIQEFKGHMDGVXXXXXXXXXXXTGSYDSTVAIWDLATG----K 290
           Y     V +   K I  I+  + H               T S D+ + ++D ++     K
Sbjct: 155 YTIPLAVTTAHSKAITSIEVIEAH--NFEEFIDSTTLVSTTSKDAQINVYDHSSNTGELK 212

Query: 291 LIRRLSGHTDGVKALRF----DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVD 346
           LIR  + H   V + +     +D  L + S D T++VW      C+ ++  H + V S+D
Sbjct: 213 LIRSFNAHDSTVSSQKTWQKDNDVLLASSSRDATVKVWRVNDSRCLQSFSPHSEWVKSID 272

Query: 347 SFRKLIVSGSADKTVKVWHVESRTCYTL-RGHTGWVNCVKLHPKSFT------------- 392
              + I+SGS D T+++ H  S    ++  GH   +  V + P S +             
Sbjct: 273 VLDEYILSGSLDSTLRLTHWPSGNGLSVGTGHEFPIERVLIIPFSDSKICTSPYRDQNEH 332

Query: 393 ----------CFSGSDDMTIRMWDI--------------RTNT---CVRVFHGHVGQVQK 425
                     C S + D TI++W++               TNT   CV    GH   V+ 
Sbjct: 333 SAFAPLRFKYCASAARDNTIKIWEVPLPQLKPNSAPVPSTTNTTFKCVMTLRGHTSWVKD 392

Query: 426 VIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWN 485
              L L  D                                    HL SCS D TIK W+
Sbjct: 393 ---LKLRGD------------------------------------HLFSCSDDETIKCWD 413

Query: 486 VKTGACIRT 494
           + TG C++T
Sbjct: 414 LNTGNCVKT 422

>CAGL0E00561g 49750..52260 some similarities with sp|P16649
           Saccharomyces cerevisiae YCR084c TUP1, hypothetical
           start
          Length = 836

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 78/320 (24%), Positives = 123/320 (38%), Gaps = 86/320 (26%)

Query: 278 DSTVAIWDLATGKLIRRLS---GHTDG--------------------VKALRF--DDQKL 312
           + T  I+ ++ G+L+ R S    HTD                     ++++ F  D + L
Sbjct: 511 NKTTQIYRVSDGELVARFSDENAHTDKADGNDNAEAETSAGATTDLYIRSVCFSPDGKFL 570

Query: 313 ITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRK--LIVSGSADKTVKVWHVESRT 370
            TG+ DK IR+W+      V   +GH+  + S+D F     +VSGS D+TV++W +++  
Sbjct: 571 ATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQ 630

Query: 371 CYTLRGHTGWVNCVKLHPKSFTCFS-GSDDMTIRMWDIRTNTCVRVFH-------GHVGQ 422
           C         V  V + P      + GS D  +R+WD  T   V           GH   
Sbjct: 631 CTLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSDTGFLVERLDSENELGTGHKDS 690

Query: 423 VQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIK 482
           V  V+    G+ ++                                     S SLD ++K
Sbjct: 691 VYSVVFTRDGNGVV-------------------------------------SGSLDRSVK 713

Query: 483 LWNVK------------TGACIRTQFGHVEGVWDIAA--DNFRIVSGSHDRSCKVWDLQT 528
           LWN++            +G C  T  GH + V  +A   D+  I+SGS DR    WD  +
Sbjct: 714 LWNLRNVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLFWDKVS 773

Query: 529 GKCMHTFVGIHAPVACVGIG 548
           G  +    G    V  V + 
Sbjct: 774 GNPLLMLQGHRNSVISVAVN 793

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 64/178 (35%), Positives = 82/178 (46%), Gaps = 26/178 (14%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVK--ALRFDDQKLIT-GSLDKTIRVWNYVTGA 330
           +GS D TV IWDL TG+    LS   DGV   A+   D K I  GSLD+ +RVW+  TG 
Sbjct: 614 SGSGDRTVRIWDLKTGQCTLTLSIE-DGVTTVAVSPGDGKFIAAGSLDRAVRVWDSDTGF 672

Query: 331 CVSTY-------RGHQDSVLSVDSFR--KLIVSGSADKTVKVWHVE------------SR 369
            V           GH+DSV SV   R    +VSGS D++VK+W++             S 
Sbjct: 673 LVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVNHNNADGKPTSG 732

Query: 370 TC-YTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKV 426
           TC  T  GH  +V  V          SGS D  +  WD  +   + +  GH   V  V
Sbjct: 733 TCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLFWDKVSGNPLLMLQGHRNSVISV 790

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 80/173 (46%), Gaps = 30/173 (17%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGAC 331
           TG+ D  + IWD+   K++  L GH   + +L +     KL++GS D+T+R+W+  TG C
Sbjct: 572 TGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQC 631

Query: 332 VSTYRGHQDSVLSV---DSFRKLIVSGSADKTVKVWHVESRTCYTLR----------GHT 378
             T    +D V +V       K I +GS D+ V+VW  +S T + +           GH 
Sbjct: 632 TLTL-SIEDGVTTVAVSPGDGKFIAAGSLDRAVRVW--DSDTGFLVERLDSENELGTGHK 688

Query: 379 GWVNCVKLHPKSFTCFSGSDDMTIRMWDIR------------TNTCVRVFHGH 419
             V  V          SGS D ++++W++R            + TC   + GH
Sbjct: 689 DSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGH 741

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 53/236 (22%), Positives = 85/236 (36%), Gaps = 58/236 (24%)

Query: 298 HTDGVKALRF-DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKLIVSGS 356
           HT  V  ++F +D + +    +KT +++    G  V+ +          D         S
Sbjct: 490 HTSVVCCVKFSNDGEFLATGCNKTTQIYRVSDGELVARFSDENAHTDKADGNDNAEAETS 549

Query: 357 ADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVF 416
           A  T  ++                +  V   P      +G++D  IR+WDI     V V 
Sbjct: 550 AGATTDLY----------------IRSVCFSPDGKFLATGAEDKLIRIWDIEQKKIVMVL 593

Query: 417 HGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCS 476
            GH   +                                     + D+  P    L+S S
Sbjct: 594 KGHEQDIY------------------------------------SLDY-FPSGDKLVSGS 616

Query: 477 LDNTIKLWNVKTGACIRTQFGHVEGVWDIA---ADNFRIVSGSHDRSCKVWDLQTG 529
            D T+++W++KTG C  T     +GV  +A    D   I +GS DR+ +VWD  TG
Sbjct: 617 GDRTVRIWDLKTGQCTLT-LSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSDTG 671

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 51/93 (54%), Gaps = 9/93 (9%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNF----RIVSGSHDRSCKVWDLQ 527
           L + + D  I++W+++    +    GH + ++ +  D F    ++VSGS DR+ ++WDL+
Sbjct: 570 LATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSL--DYFPSGDKLVSGSGDRTVRIWDLK 627

Query: 528 TGKCMHTFVGIHAPVACVGI--GDSEFVSGDEL 558
           TG+C  T   I   V  V +  GD +F++   L
Sbjct: 628 TGQCTLTL-SIEDGVTTVAVSPGDGKFIAAGSL 659

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 54/113 (47%), Gaps = 22/113 (19%)

Query: 274 TGSYDSTVAIWDL-------ATGKLIR-----RLSGHTDGV--KALRFDDQKLITGSLDK 319
           +GS D +V +W+L       A GK          +GH D V   A   DD+ +++GS D+
Sbjct: 705 SGSLDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDR 764

Query: 320 TIRVWNYVTGACVSTYRGHQDSVLSV--------DSFRKLIVSGSADKTVKVW 364
            +  W+ V+G  +   +GH++SV+SV             +  +GS D   ++W
Sbjct: 765 GVLFWDKVSGNPLLMLQGHRNSVISVAVNHGHPLGPNYHIFATGSGDCKARIW 817

 Score = 29.6 bits (65), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 27/62 (43%), Gaps = 8/62 (12%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDD--------QKLITGSLDKTIRVWN 325
           +GS D  V  WD  +G  +  L GH + V ++  +             TGS D   R+W 
Sbjct: 759 SGSKDRGVLFWDKVSGNPLLMLQGHRNSVISVAVNHGHPLGPNYHIFATGSGDCKARIWK 818

Query: 326 YV 327
           Y+
Sbjct: 819 YI 820

>YCR084C (TUP1) [608] chr3 complement(260307..262448) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by regulated,
           sequence-specific DNA-binding proteins, exists in a
           complex with Ssn6p that is converted to a
           transcriptional activator in a Hog1p-dependent manner
           [2142 bp, 713 aa]
          Length = 713

 Score = 74.7 bits (182), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 85/178 (47%), Gaps = 26/178 (14%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF---DDQKLITGSLDKTIRVWNYVTGA 330
           +GS D TV IWDL TG+    LS   DGV  +     D + +  GSLD+ +RVW+  TG 
Sbjct: 502 SGSGDRTVRIWDLRTGQCSLTLSIE-DGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGF 560

Query: 331 CVS-------TYRGHQDSVLSVDSFR--KLIVSGSADKTVKVWHVE------------SR 369
            V        +  GH+DSV SV   R  + +VSGS D++VK+W+++            S 
Sbjct: 561 LVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSG 620

Query: 370 TC-YTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKV 426
           TC  T  GH  +V  V          SGS D  +  WD ++   + +  GH   V  V
Sbjct: 621 TCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISV 678

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 66/266 (24%), Positives = 103/266 (38%), Gaps = 61/266 (22%)

Query: 308 DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRK--LIVSGSADKTVKVWH 365
           D + L TG+ D+ IR+W+      V   +GH+  + S+D F     +VSGS D+TV++W 
Sbjct: 454 DGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 513

Query: 366 VESRTCYTLRGHTGWVNCVKLHPKSFTCF-SGSDDMTIRMWDIRTNTCVRVFH------- 417
           + +  C         V  V + P       +GS D  +R+WD  T   V           
Sbjct: 514 LRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGT 573

Query: 418 GHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSL 477
           GH   V  V+    G  ++                                     S SL
Sbjct: 574 GHKDSVYSVVFTRDGQSVV-------------------------------------SGSL 596

Query: 478 DNTIKLWNVK------------TGACIRTQFGHVEGVWDIAA--DNFRIVSGSHDRSCKV 523
           D ++KLWN++            +G C  T  GH + V  +A   ++  I+SGS DR    
Sbjct: 597 DRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLF 656

Query: 524 WDLQTGKCMHTFVGIHAPVACVGIGD 549
           WD ++G  +    G    V  V + +
Sbjct: 657 WDKKSGNPLLMLQGHRNSVISVAVAN 682

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 61/153 (39%), Gaps = 41/153 (26%)

Query: 380 WVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXX 439
           ++  V   P      +G++D  IR+WDI     V +  GH   +                
Sbjct: 445 YIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIY--------------- 489

Query: 440 XXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHV 499
                                + D+  P    L+S S D T+++W+++TG C  T     
Sbjct: 490 ---------------------SLDY-FPSGDKLVSGSGDRTVRIWDLRTGQCSLT-LSIE 526

Query: 500 EGVWDIA---ADNFRIVSGSHDRSCKVWDLQTG 529
           +GV  +A    D   I +GS DR+ +VWD +TG
Sbjct: 527 DGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETG 559

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 49/91 (53%), Gaps = 5/91 (5%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVW--DIAADNFRIVSGSHDRSCKVWDLQTG 529
           L + + D  I++W+++    +    GH + ++  D      ++VSGS DR+ ++WDL+TG
Sbjct: 458 LATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTG 517

Query: 530 KCMHTFVGIHAPVACVGI--GDSEFVSGDEL 558
           +C  T   I   V  V +  GD ++++   L
Sbjct: 518 QCSLTL-SIEDGVTTVAVSPGDGKYIAAGSL 547

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 59/161 (36%), Gaps = 71/161 (44%)

Query: 275 GSYDSTVAIWDLATGKLIRRL-------SGHTDGVKALRF--DDQKLITGSLDKTIRVWN 325
           GS D  V +WD  TG L+ RL       +GH D V ++ F  D Q +++GSLD+++++WN
Sbjct: 545 GSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWN 604

Query: 326 YV------------TGACVSTYRGHQD--------------------------------- 340
                         +G C  TY GH+D                                 
Sbjct: 605 LQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNP 664

Query: 341 ---------SVLSVDSFR--------KLIVSGSADKTVKVW 364
                    SV+SV             +  +GS D   ++W
Sbjct: 665 LLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIW 705

>CAGL0D02090g join(214357..214893,215564..215860) highly similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1
          Length = 277

 Score = 71.6 bits (174), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 76/148 (51%), Gaps = 15/148 (10%)

Query: 274 TGSYDSTVAIWDLAT-----GKLIRRLSGHTDGVK--ALRFDDQKLITGSLDKTIRVWNY 326
           + S D T+  W L       G  ++   GH+  V+   L  +    ++GS DKT+R+W+ 
Sbjct: 35  SASRDKTLISWKLTGDDQKFGVPVKSFKGHSHIVQDCTLTENGAYALSGSWDKTLRLWDV 94

Query: 327 VTGACVSTYRGHQDSVLSV--DSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCV 384
            TG    T+ GH+  V+SV  D    +I+SGS DK++KVW ++     TL GH  WV+ V
Sbjct: 95  ATGETFQTFVGHKGDVMSVAIDKKASMIISGSRDKSIKVWSIKGDCLATLIGHNDWVSQV 154

Query: 385 KLHPKS-----FTCFS-GSDDMTIRMWD 406
           ++   S      T  S G+D M   +W+
Sbjct: 155 RIANSSDDDDKVTVISAGNDKMVKVLWN 182

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 56/220 (25%), Positives = 88/220 (40%), Gaps = 62/220 (28%)

Query: 252 IQEFKGHMDGVX--XXXXXXXXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDD 309
           ++ FKGH   V             +GS+D T+ +WD+ATG+  +   GH   V ++  D 
Sbjct: 58  VKSFKGHSHIVQDCTLTENGAYALSGSWDKTLRLWDVATGETFQTFVGHKGDVMSVAIDK 117

Query: 310 QK--LITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSV-------DSFRKLIVSGSADKT 360
           +   +I+GS DK+I+VW+ + G C++T  GH D V  V       D  +  ++S   DK 
Sbjct: 118 KASMIISGSRDKSIKVWS-IKGDCLATLIGHNDWVSQVRIANSSDDDDKVTVISAGNDKM 176

Query: 361 VKV-WHVESRT-CYTLRG-----------------------------------------H 377
           VKV W+  ++   YTL                                            
Sbjct: 177 VKVLWNSAAKVPMYTLSAGDEVYALSFSPNRYWLCAATASGIKIFSLDPQCLLDDLKPEF 236

Query: 378 TGWVNCVKLHPKSF-------TCFSGSDDMTIRMWDIRTN 410
            G+    + H  S        T F+G  D  IR+W + T+
Sbjct: 237 AGYTQSAEPHAVSLAWSSDGQTLFAGYTDNVIRVWQVMTS 276

 Score = 57.4 bits (137), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 74/187 (39%), Gaps = 46/187 (24%)

Query: 373 TLRGHTGWVNCVKLHP-KSFTCFSGSDDMTIRMW-----DIRTNTCVRVFHGHVGQVQKV 426
           TL GH GWV  +     +     S S D T+  W     D +    V+ F GH   VQ  
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVKSFKGHSHIVQDC 71

Query: 427 IPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNV 486
                G+                                     + LS S D T++LW+V
Sbjct: 72  TLTENGA-------------------------------------YALSGSWDKTLRLWDV 94

Query: 487 KTGACIRTQFGHVEGVWDIAADN--FRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVAC 544
            TG   +T  GH   V  +A D     I+SGS D+S KVW ++ G C+ T +G +  V+ 
Sbjct: 95  ATGETFQTFVGHKGDVMSVAIDKKASMIISGSRDKSIKVWSIK-GDCLATLIGHNDWVSQ 153

Query: 545 VGIGDSE 551
           V I +S 
Sbjct: 154 VRIANSS 160

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 70/145 (48%), Gaps = 16/145 (11%)

Query: 295 LSGHTDGVKALRFDDQK---LITGSLDKTIRVWNYVT-----GACVSTYRGH----QDSV 342
           L GH   V +L     +   L++ S DKT+  W         G  V +++GH    QD  
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVKSFKGHSHIVQDCT 72

Query: 343 LSVDSFRKLIVSGSADKTVKVWHVES-RTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMT 401
           L+ +    L  SGS DKT+++W V +  T  T  GH G V  V +  K+    SGS D +
Sbjct: 73  LTENGAYAL--SGSWDKTLRLWDVATGETFQTFVGHKGDVMSVAIDKKASMIISGSRDKS 130

Query: 402 IRMWDIRTNTCVRVFHGHVGQVQKV 426
           I++W I+ + C+    GH   V +V
Sbjct: 131 IKVWSIKGD-CLATLIGHNDWVSQV 154

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 54/219 (24%), Positives = 84/219 (38%), Gaps = 55/219 (25%)

Query: 334 TYRGHQDSVLSVDSFR---KLIVSGSADKTVKVWHVESR------TCYTLRGHTGWVNCV 384
           T  GH   V S+ +      L++S S DKT+  W +            + +GH+  V   
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVKSFKGHSHIVQDC 71

Query: 385 KLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXX 444
            L        SGS D T+R+WD+ T    + F GH G V  V                  
Sbjct: 72  TLTENGAYALSGSWDKTLRLWDVATGETFQTFVGHKGDVMSV------------------ 113

Query: 445 XXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWD 504
                         A +   S+     ++S S D +IK+W++K G C+ T  GH + V  
Sbjct: 114 --------------AIDKKASM-----IISGSRDKSIKVWSIK-GDCLATLIGHNDWVSQ 153

Query: 505 IAA-------DNFRIVSGSHDRSCKV-WDLQTGKCMHTF 535
           +         D   ++S  +D+  KV W+      M+T 
Sbjct: 154 VRIANSSDDDDKVTVISAGNDKMVKVLWNSAAKVPMYTL 192

>Kwal_23.6240
          Length = 913

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 92/201 (45%), Gaps = 22/201 (10%)

Query: 245 WRKGIYRIQEFKGHMDGVXXXXXXX--XXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGV 302
           W+   Y +++ +GH D               T S D  + IWD+ +G  +     HT  V
Sbjct: 328 WQSESYILKQ-QGHFDATNAVTYSPDGSRVVTASEDGKIKIWDVVSGFCLVTFQEHTAAV 386

Query: 303 KALRFDD--QKLITGSLDKTIRVWNYVTGACVSTYRGH---QDSVLSVDSFRKLIVSGSA 357
            AL F    Q L + SLD T+R W+ V      T+      Q + L+ D   +++ +GS 
Sbjct: 387 SALAFAKRGQVLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAADPSGEVVCAGSV 446

Query: 358 DK-TVKVWHVES-RTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRV 415
           D   V VW V++ +   TL GH G V+C+    ++    S S D TIR+W I        
Sbjct: 447 DSFAVHVWSVQTGQLVETLDGHEGPVSCLSFSQENSVLASASWDKTIRIWSI-------- 498

Query: 416 FHGHVGQVQKVIPLTLGSDLI 436
                G+ Q+V PL + +D++
Sbjct: 499 ----FGRSQQVEPLEVYADVL 515

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 71/149 (47%), Gaps = 9/149 (6%)

Query: 283 IWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQD 340
           +++  +   I +  GH D   A+ +  D  +++T S D  I++W+ V+G C+ T++ H  
Sbjct: 325 VYEWQSESYILKQQGHFDATNAVTYSPDGSRVVTASEDGKIKIWDVVSGFCLVTFQEHTA 384

Query: 341 SVLSVDSFRK---LIVSGSADKTVKVWH-VESRTCYTLRGHTG-WVNCVKLHPKSFTCFS 395
           +V ++ +F K   ++ S S D TV+ W  V  R   T         NC+   P      +
Sbjct: 385 AVSAL-AFAKRGQVLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAADPSGEVVCA 443

Query: 396 GS-DDMTIRMWDIRTNTCVRVFHGHVGQV 423
           GS D   + +W ++T   V    GH G V
Sbjct: 444 GSVDSFAVHVWSVQTGQLVETLDGHEGPV 472

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 105/283 (37%), Gaps = 43/283 (15%)

Query: 296 SGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVT---GACVSTYRGHQDSVL----SVD 346
           +GH   + +L +  D + LI+ S D T R+W+  +   G    T+ GH+D V+    S D
Sbjct: 143 AGHFSNIISLTWSRDSRFLISTSKDLTARIWSLDSQEKGLASVTFAGHRDYVMGAFFSAD 202

Query: 347 SFRKLIVSGSADKTVKVWHVESR----------------TCYTLR--------GHTGWVN 382
             R  I + S D  V  W    R                + Y+ R             V 
Sbjct: 203 QER--IYTVSKDGAVFQWEYTPRPGFESPEQDEETEIDPSLYSWRITKKNYFYASQARVK 260

Query: 383 CVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIP------LTLGSDLI 436
           CV  H  S T   G ++   R++++   T ++        V  V        L  GS  +
Sbjct: 261 CVTFHANSNTLVVGFNNGEFRLYELPEFTLIQQLSMGQNAVNTVCVNDSGEWLAFGSSKL 320

Query: 437 EXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQF 496
                                 A N     P  + +++ S D  IK+W+V +G C+ T  
Sbjct: 321 GQLLVYEWQSESYILKQQGHFDATNAVTYSPDGSRVVTASEDGKIKIWDVVSGFCLVTFQ 380

Query: 497 GHVEGVWDIA-ADNFRIV-SGSHDRSCKVWDLQTGKCMHTFVG 537
            H   V  +A A   +++ S S D + + WDL   +   TF  
Sbjct: 381 EHTAAVSALAFAKRGQVLFSASLDGTVRAWDLVRYRNFRTFTA 423

>YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 snoRNP
           (renamed small subunit processome - SSU processome),
           which is required for 18S rRNA biogenesis [2832 bp, 943
           aa]
          Length = 943

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 53/171 (30%), Positives = 81/171 (47%), Gaps = 21/171 (12%)

Query: 274 TGSYDSTVAIWDLAT---------GKLIRRLSGH-------TDGVKALRF--DDQKLITG 315
           TGS D TV  WD             K +  L  H       TD +  +R   DD+ L   
Sbjct: 490 TGSADKTVKFWDFKVENSLVPGTKNKFLPVLKLHHDTTLELTDDILCVRVSPDDRYLAIS 549

Query: 316 SLDKTIRVWNYVTGACVSTYRGHQDSVLSVD-SF-RKLIVSGSADKTVKVWHVESRTCY- 372
            LD T++V+   +     +  GH+  VLS+D SF  K+I++ SADK +K+W ++   C+ 
Sbjct: 550 LLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHK 609

Query: 373 TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQV 423
           +L  H   +  VK  P+S   FS S D  ++ WD     C++  + H  +V
Sbjct: 610 SLFAHQDSIMNVKFLPQSHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/275 (22%), Positives = 104/275 (37%), Gaps = 61/275 (22%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGV---KALRFDDQKLITGSLDKTIRVWNY----- 326
           G+ +  + ++DLA+  L+  +    D       L  D ++L+TGS DKT++ W++     
Sbjct: 448 GTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVENS 507

Query: 327 ----VTGACVSTYRGHQDSVLS---------VDSFRKLIVSGSADKTVKVWHVESRTCY- 372
                    +   + H D+ L          V    + +     D TVKV+ ++S   Y 
Sbjct: 508 LVPGTKNKFLPVLKLHHDTTLELTDDILCVRVSPDDRYLAISLLDNTVKVFFLDSMKFYL 567

Query: 373 TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLG 432
           +L GH   V  + +   S    + S D  I++W +    C +    H   +  V      
Sbjct: 568 SLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNV------ 621

Query: 433 SDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACI 492
                                            LP   +  SCS D  +K W+ +   CI
Sbjct: 622 -------------------------------KFLPQSHNFFSCSKDAVVKYWDGEKFECI 650

Query: 493 RTQFGHVEGVW--DIAADNFRIVSGSHDRSCKVWD 525
           +  + H   VW   +A D   +VS SHD S ++W+
Sbjct: 651 QKLYAHQSEVWALAVATDGGFVVSSSHDHSIRIWE 685

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 78/176 (44%), Gaps = 23/176 (13%)

Query: 281 VAIWDLATGKLIRRLS-----GHTDGVKA---------LRFDDQKLITGSLDKTIRVWNY 326
           V IWD+ TG L+ +LS     G +D   A            D   L  G  D  I+VW+ 
Sbjct: 49  VNIWDIKTGDLVSKLSDGLPPGASDARGAKPAECTYLEAHKDTDLLAVGYADGVIKVWDL 108

Query: 327 VTGACVSTYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWHVESRT-CYTLRGHTGWVNC 383
           ++   +  + GH+ ++  L  D     ++SGS D  + VW +      Y LR H   +  
Sbjct: 109 MSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITG 168

Query: 384 VKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQ-----VQKVIPLTLGSD 434
                + +   S S D  I++WD++T+ C+     H G+     V+  + +T G+D
Sbjct: 169 FWCQGEDW-LISTSKDGMIKLWDLKTHQCIETHIAHTGECWGLAVKDDLLITTGTD 223

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 64/137 (46%), Gaps = 6/137 (4%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFD--DQKLITGSLDKTIRVWNYVTGACV 332
           G  D  + +WDL +  ++   +GH   +  L+FD    +LI+GS D  I VW+ V    +
Sbjct: 97  GYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGL 156

Query: 333 STYRGHQDSVLSV-DSFRKLIVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHPKS 390
              R H+DS+          ++S S D  +K+W +++  C  T   HTG   C  L  K 
Sbjct: 157 YKLRSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTHQCIETHIAHTG--ECWGLAVKD 214

Query: 391 FTCFSGSDDMTIRMWDI 407
               +   D  +++W +
Sbjct: 215 DLLITTGTDSQVKIWKL 231

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 60/285 (21%), Positives = 115/285 (40%), Gaps = 32/285 (11%)

Query: 278 DSTVAIWDLATGKLIRRLS-GHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTYR 336
           + ++ IW++ T K IR    G+    K L      +I G+ +  +++++  + + + T  
Sbjct: 411 NGSLKIWNIKTHKCIRTFECGYALTCKFLP-GGLLVILGTRNGELQLFDLASSSLLDTIE 469

Query: 337 GHQDSV---LSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTC 393
              D+    L + S  K +V+GSADKTVK W  +            ++  +KLH    T 
Sbjct: 470 DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVENSLVPGTKNKFLPVLKLHHD--TT 527

Query: 394 FSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXX 453
              +DD+           CVRV         + + ++L  + ++                
Sbjct: 528 LELTDDIL----------CVRV-----SPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGH 572

Query: 454 XXSVQAAN--FDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA--ADN 509
              V + +  FD  +     +++ S D  IK+W +  G C ++ F H + + ++     +
Sbjct: 573 KLPVLSIDISFDSKM-----IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPQS 627

Query: 510 FRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGIG-DSEFV 553
               S S D   K WD +  +C+       + V  + +  D  FV
Sbjct: 628 HNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAVATDGGFV 672

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/245 (21%), Positives = 100/245 (40%), Gaps = 30/245 (12%)

Query: 294 RLSGHTDGVKALRF-DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKLI 352
            L G    V+++   DD KL+  + + ++++WN  T  C+ T+               L+
Sbjct: 386 ELQGQRTDVRSIDISDDNKLLATASNGSLKIWNIKTHKCIRTFECGYALTCKFLPGGLLV 445

Query: 353 VSGSADKTVKVWHVESRTCYTL--RGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRT- 409
           + G+ +  ++++ + S +        H   +  + L        +GS D T++ WD +  
Sbjct: 446 ILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVE 505

Query: 410 NTCVRVFHGHVGQVQKVIP-LTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPY 468
           N+ V       G   K +P L L  D                      V+ +      P 
Sbjct: 506 NSLVP------GTKNKFLPVLKLHHD-----------TTLELTDDILCVRVS------PD 542

Query: 469 PTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVW--DIAADNFRIVSGSHDRSCKVWDL 526
             +L    LDNT+K++ + +     + +GH   V   DI+ D+  I++ S D++ K+W L
Sbjct: 543 DRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGL 602

Query: 527 QTGKC 531
             G C
Sbjct: 603 DFGDC 607

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 45/95 (47%), Gaps = 1/95 (1%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK-LITGSLDKTIRVWNYVTGACV 332
           +GS DS + +WDL     + +L  H D +       +  LI+ S D  I++W+  T  C+
Sbjct: 138 SGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTHQCI 197

Query: 333 STYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVE 367
            T+  H      +     L+++   D  VK+W ++
Sbjct: 198 ETHIAHTGECWGLAVKDDLLITTGTDSQVKIWKLD 232

 Score = 36.2 bits (82), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 23/104 (22%), Positives = 40/104 (38%), Gaps = 43/104 (41%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRT------------------------------------- 494
           LL+ + + ++K+WN+KT  CIRT                                     
Sbjct: 405 LLATASNGSLKIWNIKTHKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSL 464

Query: 495 ----QFGHVEGVW--DIAADNFRIVSGSHDRSCKVWDLQTGKCM 532
               +  H   +W  D+ +D  R+V+GS D++ K WD +    +
Sbjct: 465 LDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVENSL 508

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 58/145 (40%), Gaps = 42/145 (28%)

Query: 396 GSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXX 455
           G  D  I++WD+ + T +  F+GH                                    
Sbjct: 97  GYADGVIKVWDLMSKTVLLNFNGH----------------------------------KA 122

Query: 456 SVQAANFDHSLPYPTHLLSCSLDNTIKLWNV--KTGAC-IRTQFGHVEGVWDIAADNFRI 512
           ++    FD +    T L+S S D+ I +W++  + G   +R+    + G W    D   +
Sbjct: 123 AITLLQFDGT---GTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGED--WL 177

Query: 513 VSGSHDRSCKVWDLQTGKCMHTFVG 537
           +S S D   K+WDL+T +C+ T + 
Sbjct: 178 ISTSKDGMIKLWDLKTHQCIETHIA 202

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 24/32 (75%), Gaps = 1/32 (3%)

Query: 504 DIAADNFRIVSGSHDRSCKVWDLQTGKCMHTF 535
           DI+ DN ++++ + + S K+W+++T KC+ TF
Sbjct: 398 DISDDN-KLLATASNGSLKIWNIKTHKCIRTF 428

>YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential
           protein required for cell separation, has eight WD
           (WD-40) repeats, component of U3 snoRNP (also called
           small subunit processome), which is required for 18S
           rRNA biogenesis [2772 bp, 923 aa]
          Length = 923

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 94/201 (46%), Gaps = 22/201 (10%)

Query: 245 WRKGIYRIQEFKGHMDGVXXXXXXX--XXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGV 302
           W+   Y +++ +GH D               T S D  + +WD+ +G  +     HT  V
Sbjct: 332 WQSESYILKQ-QGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITSGFCLATFEEHTSSV 390

Query: 303 KALRFDD--QKLITGSLDKTIRVWNYVTGACVSTYRGH---QDSVLSVDSFRKLIVSGSA 357
            A++F    Q + + SLD T+R W+ +      T+ G    Q + L+VD   +++ +GS 
Sbjct: 391 TAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSL 450

Query: 358 DK-TVKVWHVES-RTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRV 415
           D   + VW V++ +    L GH G V+C+    ++    S S D TIR+W I        
Sbjct: 451 DNFDIHVWSVQTGQLLDALSGHEGPVSCLSFSQENSVLASASWDKTIRIWSI-------- 502

Query: 416 FHGHVGQVQKVIPLTLGSDLI 436
                G+ Q+V P+ + SD++
Sbjct: 503 ----FGRSQQVEPIEVYSDVL 519

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 72/148 (48%), Gaps = 7/148 (4%)

Query: 283 IWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQD 340
           +++  +   I +  GH D   +L +  D  +++T S D  I+VW+  +G C++T+  H  
Sbjct: 329 VYEWQSESYILKQQGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITSGFCLATFEEHTS 388

Query: 341 SVLSVDSFRK--LIVSGSADKTVKVWH-VESRTCYTLRG-HTGWVNCVKLHPKSFTCFSG 396
           SV +V   ++  ++ S S D TV+ W  +  R   T  G      NC+ + P      +G
Sbjct: 389 SVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAG 448

Query: 397 S-DDMTIRMWDIRTNTCVRVFHGHVGQV 423
           S D+  I +W ++T   +    GH G V
Sbjct: 449 SLDNFDIHVWSVQTGQLLDALSGHEGPV 476

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 67/190 (35%), Gaps = 46/190 (24%)

Query: 364 WHVESRTCYTLR--GHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVG 421
           W  ES   Y L+  GH    N +   P      + S+D  I++WDI +  C+  F  H  
Sbjct: 332 WQSES---YILKQQGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITSGFCLATFEEHTS 388

Query: 422 QVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTI 481
            V  V     G                                       + S SLD T+
Sbjct: 389 SVTAVQFAKRGQ-------------------------------------VMFSSSLDGTV 411

Query: 482 KLWNVKTGACIRTQFGHVEGVWD-IAAD--NFRIVSGSHDR-SCKVWDLQTGKCMHTFVG 537
           + W++      RT  G     ++ +A D     + +GS D     VW +QTG+ +    G
Sbjct: 412 RAWDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALSG 471

Query: 538 IHAPVACVGI 547
              PV+C+  
Sbjct: 472 HEGPVSCLSF 481

>AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH]
           (328838..331645) [2808 bp, 935 aa]
          Length = 935

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 64/275 (23%), Positives = 110/275 (40%), Gaps = 61/275 (22%)

Query: 275 GSYDSTVAIWDLATGKLIRRLS-GHTDGVKALRF--DDQKLITGSLDKTIRVWNY----- 326
           G+    + ++DLA+  ++  +   HT  + +L    D ++L+T S DKT++ W++     
Sbjct: 442 GTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQE 501

Query: 327 -VTGAC---VSTYRGHQDSVL---------SVDSFRKLIVSGSADKTVKVWHVESRTCY- 372
            V G     V   +   D+ L          +    + +     D TVKV+ ++S   + 
Sbjct: 502 LVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFL 561

Query: 373 TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLG 432
           +L GH   V  + +   S    + S D  I++W +    C +    H   +  V      
Sbjct: 562 SLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNV------ 615

Query: 433 SDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACI 492
                                            LP   +  SCS D T+K W+  +  CI
Sbjct: 616 -------------------------------KFLPESHNFFSCSKDGTVKYWDGNSFDCI 644

Query: 493 RTQFGHVEGVWDIA--ADNFRIVSGSHDRSCKVWD 525
           +  +GH   VW +A  +D   +VS SHDRS +VW+
Sbjct: 645 QKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWE 679

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 53/171 (30%), Positives = 81/171 (47%), Gaps = 21/171 (12%)

Query: 274 TGSYDSTVAIWD------LATG---KLIRRLSGHTDGVKALRFD---------DQKLITG 315
           T S D TV  WD      L  G   K + ++    D    L  D         D+ L   
Sbjct: 484 TASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVS 543

Query: 316 SLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFR--KLIVSGSADKTVKVWHVESRTCY- 372
            LD T++V+   +     +  GH+  VLS+D     KLI++ SADK +K+W ++   C+ 
Sbjct: 544 LLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHK 603

Query: 373 TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQV 423
           +L  H   +  VK  P+S   FS S D T++ WD  +  C++  +GH G+V
Sbjct: 604 SLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEV 654

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 69/140 (49%), Gaps = 12/140 (8%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDD--QKLITGSLDKTIRVWNYVTGACV 332
           G  D T+ IWD+ T  ++     H+  +  LRFD    +LI+GS D TI +W+ V    +
Sbjct: 93  GYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGL 152

Query: 333 STYRGHQDSVLSV----DSFRKLIVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLH 387
              R H+D++  +    D +   ++S S D  +K+W ++   C  T   HTG   C  L 
Sbjct: 153 CKLRSHKDAITGIWCENDDW---LISVSKDGLIKLWDMKVHQCVETHMAHTG--ECWSLA 207

Query: 388 PKSFTCFSGSDDMTIRMWDI 407
            K     + + +  I++W++
Sbjct: 208 VKDNMVITANAESEIKLWEL 227

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/231 (20%), Positives = 87/231 (37%), Gaps = 54/231 (23%)

Query: 311 KLITGSLDKTIRVWNYVTGACVSTYRG--------------HQDSVLSVDSFRKLIVSGS 356
           ++ITG+L++ ++ W   TG  + T R                + + L       ++  G 
Sbjct: 36  QVITGALEE-VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGY 94

Query: 357 ADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRV 415
           AD T+K+W ++++T       H+  +  ++         SGS D TI +WD+   T +  
Sbjct: 95  ADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCK 154

Query: 416 FHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSC 475
              H   +                                 +   N D        L+S 
Sbjct: 155 LRSHKDAI-------------------------------TGIWCENDDW-------LISV 176

Query: 476 SLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDL 526
           S D  IKLW++K   C+ T   H    W +A  +  +++ + +   K+W+L
Sbjct: 177 SKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWEL 227

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 74/166 (44%), Gaps = 19/166 (11%)

Query: 274 TGSYDSTVAIWDLATGKLIRRL-----SGHTDG-------VKALRFDDQKLI--TGSLDK 319
           TG+ +  V  W++ TG+L++ +      G  D           L++ ++  I   G  D 
Sbjct: 39  TGALEE-VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADG 97

Query: 320 TIRVWNYVTGACVSTYRGHQD--SVLSVDSFRKLIVSGSADKTVKVWHVESRTCY-TLRG 376
           TI++W+  T   +  +  H    ++L  D     ++SGS D T+ +W + + T    LR 
Sbjct: 98  TIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRS 157

Query: 377 HTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQ 422
           H   +  +      +   S S D  I++WD++ + CV     H G+
Sbjct: 158 HKDAITGIWCENDDW-LISVSKDGLIKLWDMKVHQCVETHMAHTGE 202

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 50/95 (52%), Gaps = 1/95 (1%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFD-DQKLITGSLDKTIRVWNYVTGACV 332
           +GS D+T+ +WDL     + +L  H D +  +  + D  LI+ S D  I++W+     CV
Sbjct: 134 SGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISVSKDGLIKLWDMKVHQCV 193

Query: 333 STYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVE 367
            T+  H     S+     ++++ +A+  +K+W ++
Sbjct: 194 ETHMAHTGECWSLAVKDNMVITANAESEIKLWELD 228

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 53/249 (21%), Positives = 94/249 (37%), Gaps = 44/249 (17%)

Query: 297 GHTDGVKALRFD-DQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKLIVSG 355
           GH   ++A     D KL+  + +  ++VWN  T  C+                  L++ G
Sbjct: 383 GHRTDLRAADISSDDKLLATASNGNLKVWNIKTKTCIRNLDCGYALCCKFLPGGALVILG 442

Query: 356 SADKTVKVWHVESRTCY--TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCV 413
           +    ++++ + S T        HT  +  + L        + S D T++ WD +    +
Sbjct: 443 TRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQEL 502

Query: 414 RVFHGHVGQVQKVIP---------LTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDH 464
                  G + K +P         L LG DL                     V+ +    
Sbjct: 503 VA-----GTLDKFVPKMKLIHDTTLDLGEDL-------------------WCVKIS---- 534

Query: 465 SLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGV--WDIAADNFRIVSGSHDRSCK 522
             P    L    LDNT+K++ + +     + +GH   V   DI+ D+  I++ S D++ K
Sbjct: 535 --PEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIK 592

Query: 523 VWDLQTGKC 531
           +W L  G C
Sbjct: 593 IWGLDFGDC 601

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 4/58 (6%)

Query: 478 DNTIKLWNVKTGACIRTQFGHVEGVWDIAADN--FRIVSGSHDRSCKVWDL--QTGKC 531
           D TIK+W+++T   +     H   +  +  D    R++SGS D +  +WDL  +TG C
Sbjct: 96  DGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLC 153

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 37/81 (45%), Gaps = 15/81 (18%)

Query: 469 PTHLLSCSLDNTIKLWNVKTGACIRT-QFGHVEGVWDIAAD-------------NFRIVS 514
           P  +++ +L+  +K W +KTG  ++T + G   G  D  A+              F +  
Sbjct: 34  PGQVITGALEE-VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAV 92

Query: 515 GSHDRSCKVWDLQTGKCMHTF 535
           G  D + K+WD+QT   +  F
Sbjct: 93  GYADGTIKIWDMQTQTVLIVF 113

>CAGL0L03201g complement(366795..368534) some similarities with
           sp|P47025 Saccharomyces cerevisiae YJL112w MDV1 or
           sp|P36130 Saccharomyces cerevisiae YKR036c CAF4 CCR4,
           hypothetical start
          Length = 579

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 91/194 (46%), Gaps = 33/194 (17%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF-DDQKLI-TGSLDKTIRVW------- 324
           T + D+ + +WD++T + +  LSGH   V   RF DD +L+ +   D +++VW       
Sbjct: 298 TANLDNEIKLWDISTTQCLGVLSGHRATVNTTRFIDDTRLLASAGKDASVKVWDVDNIVD 357

Query: 325 ---NYVTGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTC-------YTL 374
              N     C++T+ GH+DSV ++ +    IVSGS DKT++ W + S  C         L
Sbjct: 358 KDGNANDNLCLATFDGHKDSVTALATTGNAIVSGSNDKTLRHWDLGSGKCIQSIDLTIAL 417

Query: 375 RGHTGWVNCVKLHPKSFT------------CFSGSDDMTIRMWDIRTNTCVRVFHGHVGQ 422
           +     V+ + + P   T              +G+ D  + +WD+R    V    GH G 
Sbjct: 418 KMVPQSVSKLDITPSFNTPLIGGADCIDNALVTGTKDGIVYLWDLRIGRVVGSLEGHRGP 477

Query: 423 VQKVIPLTLGSDLI 436
           +  +    +GS+LI
Sbjct: 478 ITSL--KYMGSELI 489

 Score = 68.2 bits (165), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 64/267 (23%), Positives = 111/267 (41%), Gaps = 57/267 (21%)

Query: 289 GKLIRRLSGHTDGVKALRFDDQKLI---TGSLDKTIRVWNYVTGACVSTYRGHQDSVLS- 344
           G+L + L  H D + +L  + Q  +   T +LD  I++W+  T  C+    GH+ +V + 
Sbjct: 270 GQLGKTLKCHDDYINSLAINAQLGVLSSTANLDNEIKLWDISTTQCLGVLSGHRATVNTT 329

Query: 345 --VDSFRKLIVSGSADKTVKVWHVES----------RTCY-TLRGHTGWVNCVKLHPKSF 391
             +D  R L+ S   D +VKVW V++            C  T  GH   V    L     
Sbjct: 330 RFIDDTR-LLASAGKDASVKVWDVDNIVDKDGNANDNLCLATFDGHKDSVTA--LATTGN 386

Query: 392 TCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXX 451
              SGS+D T+R WD+ +  C++            I LT+   ++               
Sbjct: 387 AIVSGSNDKTLRHWDLGSGKCIQS-----------IDLTIALKMVPQ------------- 422

Query: 452 XXXXSVQAANFDHSLPYP---------THLLSCSLDNTIKLWNVKTGACIRTQFGHVEGV 502
               SV   +   S   P           L++ + D  + LW+++ G  + +  GH   +
Sbjct: 423 ----SVSKLDITPSFNTPLIGGADCIDNALVTGTKDGIVYLWDLRIGRVVGSLEGHRGPI 478

Query: 503 WDIAADNFRIVSGSHDRSCKVWDLQTG 529
             +      +++GS D+S ++WDL+ G
Sbjct: 479 TSLKYMGSELITGSMDKSTRIWDLRMG 505

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 57/101 (56%), Gaps = 1/101 (0%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVS 333
           TG+ D  V +WDL  G+++  L GH   + +L++   +LITGS+DK+ R+W+   G+ V+
Sbjct: 450 TGTKDGIVYLWDLRIGRVVGSLEGHRGPITSLKYMGSELITGSMDKSTRIWDLRMGS-VA 508

Query: 334 TYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTL 374
                +  V+SV+  +  +++    + VK++    R   +L
Sbjct: 509 ELLSFEKEVVSVEESQTQLINALEGEPVKIYDRGERQYNSL 549

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 56/132 (42%), Gaps = 20/132 (15%)

Query: 255 FKGHMDGVXXXXXXXXXXXTGSYDSTVAIWDLATGKLIRRL------------------- 295
           F GH D V           +GS D T+  WDL +GK I+ +                   
Sbjct: 371 FDGHKDSVTALATTGNAIVSGSNDKTLRHWDLGSGKCIQSIDLTIALKMVPQSVSKLDIT 430

Query: 296 -SGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKLIVS 354
            S +T  +      D  L+TG+ D  + +W+   G  V +  GH+  + S+      +++
Sbjct: 431 PSFNTPLIGGADCIDNALVTGTKDGIVYLWDLRIGRVVGSLEGHRGPITSLKYMGSELIT 490

Query: 355 GSADKTVKVWHV 366
           GS DK+ ++W +
Sbjct: 491 GSMDKSTRIWDL 502

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 78/181 (43%), Gaps = 35/181 (19%)

Query: 278 DSTVAIWDL---------ATGKL-IRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYV 327
           D++V +WD+         A   L +    GH D V AL      +++GS DKT+R W+  
Sbjct: 344 DASVKVWDVDNIVDKDGNANDNLCLATFDGHKDSVTALATTGNAIVSGSNDKTLRHWDLG 403

Query: 328 TGACVST------YRGHQDSVLSVD---SFR-----------KLIVSGSADKTVKVWHVE 367
           +G C+ +       +    SV  +D   SF              +V+G+ D  V +W + 
Sbjct: 404 SGKCIQSIDLTIALKMVPQSVSKLDITPSFNTPLIGGADCIDNALVTGTKDGIVYLWDLR 463

Query: 368 -SRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRV--FHGHVGQVQ 424
             R   +L GH G +  +K         +GS D + R+WD+R  +   +  F   V  V+
Sbjct: 464 IGRVVGSLEGHRGPITSLKYMGSEL--ITGSMDKSTRIWDLRMGSVAELLSFEKEVVSVE 521

Query: 425 K 425
           +
Sbjct: 522 E 522

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 67/174 (38%), Gaps = 48/174 (27%)

Query: 373 TLRGHTGWVNCVKLHPKSFTCFSGSD-DMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTL 431
           TL+ H  ++N + ++ +     S ++ D  I++WDI T  C+ V  GH   V        
Sbjct: 275 TLKCHDDYINSLAINAQLGVLSSTANLDNEIKLWDISTTQCLGVLSGHRATV-------- 326

Query: 432 GSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLW------- 484
                                        N    +     L S   D ++K+W       
Sbjct: 327 -----------------------------NTTRFIDDTRLLASAGKDASVKVWDVDNIVD 357

Query: 485 ---NVKTGACIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTF 535
              N     C+ T  GH + V  +A     IVSGS+D++ + WDL +GKC+ + 
Sbjct: 358 KDGNANDNLCLATFDGHKDSVTALATTGNAIVSGSNDKTLRHWDLGSGKCIQSI 411

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 38/94 (40%), Gaps = 12/94 (12%)

Query: 474 SCSLDNTIKLWNVKTGACIRTQFGHVEGVWD--IAADNFRIVSGSHDRSCKVWDLQT--- 528
           + +LDN IKLW++ T  C+    GH   V       D   + S   D S KVWD+     
Sbjct: 298 TANLDNEIKLWDISTTQCLGVLSGHRATVNTTRFIDDTRLLASAGKDASVKVWDVDNIVD 357

Query: 529 -------GKCMHTFVGIHAPVACVGIGDSEFVSG 555
                    C+ TF G    V  +    +  VSG
Sbjct: 358 KDGNANDNLCLATFDGHKDSVTALATTGNAIVSG 391

>CAGL0K09284g 914937..917672 highly similar to sp|P25635
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 94/201 (46%), Gaps = 22/201 (10%)

Query: 245 WRKGIYRIQEFKGHMDGVXXXXXX--XXXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGV 302
           W+   Y +++ +GH D               T + D  + +WD+A+G  +     HT  V
Sbjct: 328 WQSESYILKQ-QGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVASGFCLATFEEHTSAV 386

Query: 303 KALRF--DDQKLITGSLDKTIRVWNYVTGACVSTYRGH---QDSVLSVDSFRKLIVSGSA 357
            A++F    Q L + SLD T+R W+ +       +      Q + L+V+   +++ +GS 
Sbjct: 387 TAVQFAKKGQVLFSASLDGTVRAWDLIRYRNFRVFTATERVQFTCLAVEPSGEVVSAGST 446

Query: 358 DK-TVKVWHVES-RTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRV 415
           D   V VW V++ +   TL GH G V+C+    ++    S S D TIR+W I        
Sbjct: 447 DSFDVFVWSVQTGQLLDTLSGHEGPVSCLAFSMENAVLASASWDKTIRIWSI-------- 498

Query: 416 FHGHVGQVQKVIPLTLGSDLI 436
                G+ Q+V PL + +D++
Sbjct: 499 ----FGRSQQVEPLEVFADIL 515

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 71/148 (47%), Gaps = 7/148 (4%)

Query: 283 IWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQD 340
           +++  +   I +  GH D   +L +  D  +++T + D  I+VW+  +G C++T+  H  
Sbjct: 325 VYEWQSESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVASGFCLATFEEHTS 384

Query: 341 SVLSVDSFRK--LIVSGSADKTVKVWHVESRTCYTLRGHTGWV--NCVKLHPKSFTCFSG 396
           +V +V   +K  ++ S S D TV+ W +     + +   T  V   C+ + P      +G
Sbjct: 385 AVTAVQFAKKGQVLFSASLDGTVRAWDLIRYRNFRVFTATERVQFTCLAVEPSGEVVSAG 444

Query: 397 S-DDMTIRMWDIRTNTCVRVFHGHVGQV 423
           S D   + +W ++T   +    GH G V
Sbjct: 445 STDSFDVFVWSVQTGQLLDTLSGHEGPV 472

 Score = 36.6 bits (83), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 67/331 (20%), Positives = 107/331 (32%), Gaps = 73/331 (22%)

Query: 274 TGSYDSTVAIWDLATGK---LIRRLSGHTDGVKALRFDD--QKLITGSLDKTIRVWNYVT 328
           T S D T  +W + +     +   L+GH D V    F+   +K+ T S D  +  W Y++
Sbjct: 163 TTSKDLTSRVWSINSEDKELVATTLAGHRDYVLGAYFNSTQEKIYTISKDGAVFTWEYIS 222

Query: 329 GACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHP 388
            A      G  +  L  +   KL            W +  +  +    +   V C   H 
Sbjct: 223 KA---QKEGLDEEDLEDEDLSKL-----------SWRITKKNFF--YANQAKVKCCTFHI 266

Query: 389 KSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIP------LTLGSDLIEXXXXX 442
            S     G  +   R++++     V+        V  V        L  GS  +      
Sbjct: 267 NSNLLIVGFSNGEFRLYEMPEFVMVQQLSMGQNPVNTVSVNNSGEWLAFGSSKLGQLLVY 326

Query: 443 XXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGV 502
                           A N     P  + +++ + D  IK+W+V +G C+ T   H   V
Sbjct: 327 EWQSESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVASGFCLATFEEHTSAV 386

Query: 503 -----------------------WD-IAADNFRIVS---------------------GSH 517
                                  WD I   NFR+ +                     GS 
Sbjct: 387 TAVQFAKKGQVLFSASLDGTVRAWDLIRYRNFRVFTATERVQFTCLAVEPSGEVVSAGST 446

Query: 518 DR-SCKVWDLQTGKCMHTFVGIHAPVACVGI 547
           D     VW +QTG+ + T  G   PV+C+  
Sbjct: 447 DSFDVFVWSVQTGQLLDTLSGHEGPVSCLAF 477

>CAGL0C00737g complement(75028..77478) similar to tr|Q05946
           Saccharomyces cerevisiae YLR222c, hypothetical start
          Length = 816

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/181 (33%), Positives = 81/181 (44%), Gaps = 20/181 (11%)

Query: 274 TGSYDSTVAIW-------DLATGKLIRRLS-----GHTDGVKALRF--DDQKLITGSLDK 319
           T S D TV  W       DL     I + S      H   + A+    +D    T S DK
Sbjct: 458 TASNDLTVKKWEIPPMKNDLNEVPFIVKSSIYTRHAHEKDINAISMAPNDSIFATASYDK 517

Query: 320 TIRVWNYVTGACVSTYRGHQDSVLSVDSF---RKLIVSGSADKTVKVWHVESRTCY-TLR 375
           T ++WN  TG  V+T   H+  +  V SF    K I + S DKTVK+W +ES T   TL 
Sbjct: 518 TCKLWNVDTGEPVATLANHKRGLWDV-SFCESEKWIATCSGDKTVKIWSLESFTVLKTLE 576

Query: 376 GHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDL 435
           GHT  V       K     S   D  I++WDI +  C++   GH  ++  +  L  G DL
Sbjct: 577 GHTNAVQRCSFMNKQKQLVSAGADGLIKVWDIASGDCIKNLDGHSNRIWALSVLEDG-DL 635

Query: 436 I 436
           I
Sbjct: 636 I 636

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 62/269 (23%), Positives = 105/269 (39%), Gaps = 39/269 (14%)

Query: 292 IRRLSGHTDGVKAL--RFDDQKLITGSLDKTIRVWNYVTGA----CVSTYRGHQDSVLSV 345
           +    GH+D + +L    D Q L T S DKT  +W++   +      +T+ GH  SV +V
Sbjct: 383 VNLYEGHSDLLNSLACTEDGQWLATASKDKTAILWHWNNTSKRFYIYATFVGHAASVSAV 442

Query: 346 -------DSFRKLIVSGSADKTVKVWHVE-------------SRTCYTLRGHTGWVNCVK 385
                   ++ K I++ S D TVK W +                + YT   H   +N + 
Sbjct: 443 CLPNVMEKNYPKYIITASNDLTVKKWEIPPMKNDLNEVPFIVKSSIYTRHAHEKDINAIS 502

Query: 386 LHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGH--------VGQVQKVIPLTLGSDLIE 437
           + P      + S D T ++W++ T   V     H          + +K I    G   ++
Sbjct: 503 MAPNDSIFATASYDKTCKLWNVDTGEPVATLANHKRGLWDVSFCESEKWIATCSGDKTVK 562

Query: 438 XXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFG 497
                             +VQ  +F   +     L+S   D  IK+W++ +G CI+   G
Sbjct: 563 IWSLESFTVLKTLEGHTNAVQRCSF---MNKQKQLVSAGADGLIKVWDIASGDCIKNLDG 619

Query: 498 HVEGVWDIAA--DNFRIVSGSHDRSCKVW 524
           H   +W ++   D   I+S   D   + W
Sbjct: 620 HSNRIWALSVLEDGDLIISADADSVFQFW 648

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 55/222 (24%), Positives = 89/222 (40%), Gaps = 43/222 (19%)

Query: 332 VSTYRGHQD--SVLSVDSFRKLIVSGSADKTVKVWH--VESRTCY---TLRGHTGWVNCV 384
           V+ Y GH D  + L+     + + + S DKT  +WH    S+  Y   T  GH   V+ V
Sbjct: 383 VNLYEGHSDLLNSLACTEDGQWLATASKDKTAILWHWNNTSKRFYIYATFVGHAASVSAV 442

Query: 385 -------KLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIE 437
                  K +PK     + S+D+T++ W+I            + +V    P  + S +  
Sbjct: 443 CLPNVMEKNYPKYI--ITASNDLTVKKWEIPP------MKNDLNEV----PFIVKSSIYT 490

Query: 438 XXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFG 497
                               +  N     P  +   + S D T KLWNV TG  + T   
Sbjct: 491 RHAHE---------------KDINAISMAPNDSIFATASYDKTCKLWNVDTGEPVATLAN 535

Query: 498 HVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQTGKCMHTFVG 537
           H  G+WD++       I + S D++ K+W L++   + T  G
Sbjct: 536 HKRGLWDVSFCESEKWIATCSGDKTVKIWSLESFTVLKTLEG 577

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/179 (18%), Positives = 71/179 (39%), Gaps = 20/179 (11%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQ------KLITGSLDKTIRVWNYVT 328
           G  D ++ + D+  G +     GH   + +L+F  +       L +G  +   +VW+ VT
Sbjct: 121 GGTDGSITVIDIENGYIAHSFKGHGGTISSLKFYGELGTNIWLLGSGDTNGMAKVWDLVT 180

Query: 329 GACVSTYRGHQDSVLSVDSFRK------LIVSGSADKTVKVWHVE-----SRTCYTLRGH 377
             C  T + H  ++  +D  +        +++G  D  + +W        S+   T+  H
Sbjct: 181 RKCKFTVQEHSSAIRGIDFTKNDDKDVLNLITGGRDNVLNLWRFNIKGKSSKLVKTIPAH 240

Query: 378 TGWVNC-VKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQ--VQKVIPLTLGS 433
                C    H      ++   D   ++ D+  ++ V+     + +  +  VIP+  G+
Sbjct: 241 LQIEACGFITHNDETFAYTAGGDAVFQIIDLNESSVVKCTKKPIEELFITGVIPINQGN 299

>Kwal_27.11585
          Length = 823

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 68/145 (46%), Gaps = 5/145 (3%)

Query: 297 GHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVD--SFRKLI 352
            H   + AL    +D    T S DKT ++WN  +G    T   H+  +  V    + KL+
Sbjct: 502 AHEKDINALSISPNDSVFATASYDKTCKIWNVDSGELEGTLANHKRGLWDVTFCQYDKLL 561

Query: 353 VSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNT 411
            + S DKT+KVW +ES +   TL GHT  V       ++    S   D  I++WD+ T  
Sbjct: 562 ATCSGDKTIKVWSLESMSVVKTLEGHTNAVQRCSFINRNKQIVSTGADGLIKVWDLSTGE 621

Query: 412 CVRVFHGHVGQVQKVIPLTLGSDLI 436
           C+R    H  ++  +  L+ G + +
Sbjct: 622 CIRTLDAHSNRIWALSVLSDGKEFV 646

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 65/125 (52%), Gaps = 7/125 (5%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGAC 331
           T SYD T  IW++ +G+L   L+ H  G+  + F   D+ L T S DKTI+VW+  + + 
Sbjct: 521 TASYDKTCKIWNVDSGELEGTLANHKRGLWDVTFCQYDKLLATCSGDKTIKVWSLESMSV 580

Query: 332 VSTYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWHVESRTCY-TLRGHTG--WVNCVKL 386
           V T  GH ++V   S  +  K IVS  AD  +KVW + +  C  TL  H+   W   V  
Sbjct: 581 VKTLEGHTNAVQRCSFINRNKQIVSTGADGLIKVWDLSTGECIRTLDAHSNRIWALSVLS 640

Query: 387 HPKSF 391
             K F
Sbjct: 641 DGKEF 645

 Score = 61.6 bits (148), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 62/266 (23%), Positives = 100/266 (37%), Gaps = 64/266 (24%)

Query: 297 GHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGA----CVSTYRGHQDSVLSV----- 345
           GHTD + +L   +    L T S D T+ +W     +      + + GH   V +V     
Sbjct: 398 GHTDLLNSLDSSENGEWLATCSKDHTVILWKLNADSEKFKPYARFTGHAGPVTAVGLPNV 457

Query: 346 --DSFRKLIVSGSADKTVKVWHVESRTC------------YTLRGHTGWVNCVKLHPKSF 391
             +++ + I++ S D T+K W V   T             YT R H   +N + + P   
Sbjct: 458 MRNTWPEFIITASNDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRAHEKDINALSISPNDS 517

Query: 392 TCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXX 451
              + S D T ++W++ +         H   +  V                         
Sbjct: 518 VFATASYDKTCKIWNVDSGELEGTLANHKRGLWDVT------------------------ 553

Query: 452 XXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVW--DIAADN 509
                           Y   L +CS D TIK+W++++ + ++T  GH   V        N
Sbjct: 554 -------------FCQYDKLLATCSGDKTIKVWSLESMSVVKTLEGHTNAVQRCSFINRN 600

Query: 510 FRIVSGSHDRSCKVWDLQTGKCMHTF 535
            +IVS   D   KVWDL TG+C+ T 
Sbjct: 601 KQIVSTGADGLIKVWDLSTGECIRTL 626

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 79/350 (22%), Positives = 125/350 (35%), Gaps = 84/350 (24%)

Query: 206 RYIKSDKASASKGEGEDAPQSRMRPWKVVYRERFKVESNWRKGIYRIQEFKGHMDGVXXX 265
           R I +     +  E ED P S++     +  E              ++ ++GH D +   
Sbjct: 361 RVITAPVTKHNAAEKEDEPTSKVDIQNCLPLE--------------VELYEGHTDLLNSL 406

Query: 266 XXXXXXX--XTGSYDSTVAIWDLATG----KLIRRLSGHTDGVKALRFDD-------QKL 312
                     T S D TV +W L       K   R +GH   V A+   +       + +
Sbjct: 407 DSSENGEWLATCSKDHTVILWKLNADSEKFKPYARFTGHAGPVTAVGLPNVMRNTWPEFI 466

Query: 313 ITGSLDKTIRVWNY---------VTGACVSTY--RGHQDSV--LSVDSFRKLIVSGSADK 359
           IT S D TI+ W+          +    VS Y  R H+  +  LS+     +  + S DK
Sbjct: 467 ITASNDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRAHEKDINALSISPNDSVFATASYDK 526

Query: 360 TVKVWHVESRTCY-TLRGHTG--WVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVF 416
           T K+W+V+S     TL  H    W      + K     SG  D TI++W + + + V+  
Sbjct: 527 TCKIWNVDSGELEGTLANHKRGLWDVTFCQYDKLLATCSG--DKTIKVWSLESMSVVKTL 584

Query: 417 HGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCS 476
            GH   VQ+   +     ++                                     S  
Sbjct: 585 EGHTNAVQRCSFINRNKQIV-------------------------------------STG 607

Query: 477 LDNTIKLWNVKTGACIRTQFGHVEGVW--DIAADNFRIVSGSHDRSCKVW 524
            D  IK+W++ TG CIRT   H   +W   + +D    V+   D   + W
Sbjct: 608 ADGLIKVWDLSTGECIRTLDAHSNRIWALSVLSDGKEFVTADADGVFQFW 657

 Score = 36.6 bits (83), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 39/88 (44%), Gaps = 5/88 (5%)

Query: 342 VLSVDSFRKLIVSGSADKTVKVWHVES-RTCYTLRGHTGWVNCVKLHPKS----FTCFSG 396
           V+  DS   L+  G  D +V V  +E+    ++ +GH   ++ VK H +     +   SG
Sbjct: 106 VMDCDSSSTLVALGGTDGSVTVVDIENGYVTHSFKGHGATISSVKFHGEQSGSIWRLASG 165

Query: 397 SDDMTIRMWDIRTNTCVRVFHGHVGQVQ 424
                +++WD+    C+     H   V+
Sbjct: 166 DTSGMVKVWDLVRRNCIHTIQEHAAAVR 193

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 38/81 (46%), Gaps = 7/81 (8%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQ------KLITGSLDKTIRVWNYVT 328
           G  D +V + D+  G +     GH   + +++F  +      +L +G     ++VW+ V 
Sbjct: 119 GGTDGSVTVVDIENGYVTHSFKGHGATISSVKFHGEQSGSIWRLASGDTSGMVKVWDLVR 178

Query: 329 GACVSTYRGHQDSVLSVDSFR 349
             C+ T + H  +V  +D FR
Sbjct: 179 RNCIHTIQEHAAAVRGLD-FR 198

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 35/83 (42%), Gaps = 13/83 (15%)

Query: 468 YPTHLLSCSLDNTIKLW-------------NVKTGACIRTQFGHVEGVWDIAADNFRIVS 514
           +P  +++ S D TIK W             N+K     R           I+ ++    +
Sbjct: 462 WPEFIITASNDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRAHEKDINALSISPNDSVFAT 521

Query: 515 GSHDRSCKVWDLQTGKCMHTFVG 537
            S+D++CK+W++ +G+   T   
Sbjct: 522 ASYDKTCKIWNVDSGELEGTLAN 544

>AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH]
           complement(442821..445589) [2769 bp, 922 aa]
          Length = 922

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 96/202 (47%), Gaps = 22/202 (10%)

Query: 245 WRKGIYRIQEFKGHMDGVXXXXXXX--XXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGV 302
           W+   Y +++ +GH D +             T + D  + IWD+ +G  +     HT  V
Sbjct: 343 WQSESYILKQ-QGHFDALNALAYSPDGARIVTAAEDGKIKIWDIVSGFCLATFEEHTSSV 401

Query: 303 KALRF--DDQKLITGSLDKTIRVWNYVTGACVSTYRGH---QDSVLSVDSFRKLIVSGSA 357
            +++F  + Q + + SLD T++ W+ +      T+      Q S L+ D   +++ +GS 
Sbjct: 402 TSVQFAKNGQIMFSSSLDGTVKAWDLMRFRNFRTFTATERIQFSCLAADPTGEVVCAGSL 461

Query: 358 DK-TVKVWHVES-RTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRV 415
           D   ++VW V++ +   TL GH G V+C+    ++    S S D TIR+W I        
Sbjct: 462 DNYDIQVWSVQTGQLLDTLSGHEGPVSCLSFSRENSILASASWDKTIRVWSI-------- 513

Query: 416 FHGHVGQVQKVIPLTLGSDLIE 437
                G+ Q+V P+   SD+++
Sbjct: 514 ----FGRSQQVEPIEAYSDVLD 531

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 74/148 (50%), Gaps = 7/148 (4%)

Query: 283 IWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQD 340
           +++  +   I +  GH D + AL +  D  +++T + D  I++W+ V+G C++T+  H  
Sbjct: 340 VYEWQSESYILKQQGHFDALNALAYSPDGARIVTAAEDGKIKIWDIVSGFCLATFEEHTS 399

Query: 341 SVLSVDSFR--KLIVSGSADKTVKVWHVESRTCYTLRGHTGWV--NCVKLHPKSFTCFSG 396
           SV SV   +  +++ S S D TVK W +     +     T  +  +C+   P      +G
Sbjct: 400 SVTSVQFAKNGQIMFSSSLDGTVKAWDLMRFRNFRTFTATERIQFSCLAADPTGEVVCAG 459

Query: 397 S-DDMTIRMWDIRTNTCVRVFHGHVGQV 423
           S D+  I++W ++T   +    GH G V
Sbjct: 460 SLDNYDIQVWSVQTGQLLDTLSGHEGPV 487

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 74/194 (38%), Gaps = 48/194 (24%)

Query: 361 VKVWHVESRTCYTLR--GHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHG 418
           V  W  ES   Y L+  GH   +N +   P      + ++D  I++WDI +  C+  F  
Sbjct: 340 VYEWQSES---YILKQQGHFDALNALAYSPDGARIVTAAEDGKIKIWDIVSGFCLATFEE 396

Query: 419 HVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLD 478
           H   V                                SVQ A           + S SLD
Sbjct: 397 HTSSV-------------------------------TSVQFAKNGQI------MFSSSLD 419

Query: 479 NTIKLWNVKTGACIRTQFGHVEGVWD--IAAD--NFRIVSGSHDR-SCKVWDLQTGKCMH 533
            T+K W++      RT F   E +    +AAD     + +GS D    +VW +QTG+ + 
Sbjct: 420 GTVKAWDLMRFRNFRT-FTATERIQFSCLAADPTGEVVCAGSLDNYDIQVWSVQTGQLLD 478

Query: 534 TFVGIHAPVACVGI 547
           T  G   PV+C+  
Sbjct: 479 TLSGHEGPVSCLSF 492

>KLLA0C08976g 784536..787271 highly similar to sgd|S0000653
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 84/170 (49%), Gaps = 19/170 (11%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGAC 331
           T S++  + IWD+A+G  +     H  GV A+ F    Q L + SLD T++ W+ +    
Sbjct: 358 TASHEGKIKIWDVASGFCLATFDEHAGGVSAVEFAKKGQVLFSASLDGTVKAWDLIRYRN 417

Query: 332 VSTYRGH---QDSVLSVDSFRKLIVSGSADK-TVKVWHVES-RTCYTLRGHTGWVNCVKL 386
             T+      Q + L+VD   +++ +GS D   + VW V++ +   TL GH G ++C+  
Sbjct: 418 FRTFTATERIQFNSLAVDPSGEVVCAGSEDSFDIFVWSVQTGQLVDTLSGHEGPISCLSF 477

Query: 387 HPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLI 436
             ++    S S D TIR+W +             G+ Q+V P  + SD++
Sbjct: 478 SNENGVLASASWDKTIRVWSL------------FGRSQQVEPFEVFSDVL 515

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 71/148 (47%), Gaps = 7/148 (4%)

Query: 283 IWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQD 340
           +++  +   I +  GH D +  L +  D  K++T S +  I++W+  +G C++T+  H  
Sbjct: 325 VYEWQSESYILKQQGHFDTLNGLCYSPDGSKIVTASHEGKIKIWDVASGFCLATFDEHAG 384

Query: 341 SVLSVDSFRK--LIVSGSADKTVKVWHVESRTCYTLRGHTGWV--NCVKLHPKSFTCFSG 396
            V +V+  +K  ++ S S D TVK W +     +     T  +  N + + P      +G
Sbjct: 385 GVSAVEFAKKGQVLFSASLDGTVKAWDLIRYRNFRTFTATERIQFNSLAVDPSGEVVCAG 444

Query: 397 SDD-MTIRMWDIRTNTCVRVFHGHVGQV 423
           S+D   I +W ++T   V    GH G +
Sbjct: 445 SEDSFDIFVWSVQTGQLVDTLSGHEGPI 472

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 70/199 (35%), Gaps = 54/199 (27%)

Query: 361 VKVWHVESRTCYTLR--GHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHG 418
           V  W  ES   Y L+  GH   +N +   P      + S +  I++WD+ +  C+  F  
Sbjct: 325 VYEWQSES---YILKQQGHFDTLNGLCYSPDGSKIVTASHEGKIKIWDVASGFCLATFDE 381

Query: 419 HVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLD 478
           H G V  V     G                                       L S SLD
Sbjct: 382 HAGGVSAVEFAKKGQ-------------------------------------VLFSASLD 404

Query: 479 NTIKLW------NVKT-GACIRTQFGHVEGVWDIAADNFRIVSGSHDR-SCKVWDLQTGK 530
            T+K W      N +T  A  R QF  +     +      + +GS D     VW +QTG+
Sbjct: 405 GTVKAWDLIRYRNFRTFTATERIQFNSLA----VDPSGEVVCAGSEDSFDIFVWSVQTGQ 460

Query: 531 CMHTFVGIHAPVACVGIGD 549
            + T  G   P++C+   +
Sbjct: 461 LVDTLSGHEGPISCLSFSN 479

 Score = 37.0 bits (84), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 40/98 (40%), Gaps = 14/98 (14%)

Query: 467 PYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGV--WDIAADNFRIVSGSHDRSCKVW 524
           P  + +++ S +  IK+W+V +G C+ T   H  GV   + A     + S S D + K W
Sbjct: 351 PDGSKIVTASHEGKIKIWDVASGFCLATFDEHAGGVSAVEFAKKGQVLFSASLDGTVKAW 410

Query: 525 DLQTGKCMHTFVGIH------------APVACVGIGDS 550
           DL   +   TF                  V C G  DS
Sbjct: 411 DLIRYRNFRTFTATERIQFNSLAVDPSGEVVCAGSEDS 448

>Kwal_56.23920
          Length = 937

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 67/274 (24%), Positives = 110/274 (40%), Gaps = 61/274 (22%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSG-HTDGVKALRF--DDQKLITGSLDKTIRVWNY----- 326
           G+    + ++DLA+  L+  + G H+  + +L    D ++L+TGS DKT+  W++     
Sbjct: 442 GTKTGDLHLYDLASSTLLNTIEGAHSGAIWSLDMTTDGKRLVTGSADKTVCFWDFQVEQE 501

Query: 327 -VTGACVS----------TYRGHQDSVLSV--DSFRKLIVSGSADKTVKVWHVESRTCY- 372
            V G              T     D VL+V      +L+     D TVKV+ ++S   + 
Sbjct: 502 PVPGTTDKFNPKLKMFHDTTLELNDDVLAVKISPDNRLLAVSLLDNTVKVFFMDSMKFFL 561

Query: 373 TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLG 432
           +L GH   V  + +   S    + S D  I++W +    C R    H   + KV+     
Sbjct: 562 SLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHRSLFAHNDSIMKVV----- 616

Query: 433 SDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACI 492
                                            +P   +  SCS D  +K W+     CI
Sbjct: 617 --------------------------------FVPESHNFFSCSKDALVKYWDGDKFECI 644

Query: 493 RTQFGHVEGVWDIA--ADNFRIVSGSHDRSCKVW 524
           +    H + VW +A  +D   +VS SHD+S +VW
Sbjct: 645 QKLAAHQKEVWTLAISSDGRFVVSASHDQSIRVW 678

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 78/171 (45%), Gaps = 21/171 (12%)

Query: 274 TGSYDSTVAIWDL---------ATGKLIRRLSGHTDGVKALRFD--------DQKLITGS 316
           TGS D TV  WD           T K   +L    D    L  D        D +L+  S
Sbjct: 484 TGSADKTVCFWDFQVEQEPVPGTTDKFNPKLKMFHDTTLELNDDVLAVKISPDNRLLAVS 543

Query: 317 L-DKTIRVWNYVTGACVSTYRGHQDSVLSVD-SF-RKLIVSGSADKTVKVWHVESRTCY- 372
           L D T++V+   +     +  GH+  VLS+D SF  KL+++ SADK +K+W ++   C+ 
Sbjct: 544 LLDNTVKVFFMDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHR 603

Query: 373 TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQV 423
           +L  H   +  V   P+S   FS S D  ++ WD     C++    H  +V
Sbjct: 604 SLFAHNDSIMKVVFVPESHNFFSCSKDALVKYWDGDKFECIQKLAAHQKEV 654

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 59/286 (20%), Positives = 109/286 (38%), Gaps = 27/286 (9%)

Query: 295 LSGHTDGVKALRFD-DQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKLIV 353
           + GH   V+A+    D KL+  + + T+++WN  T +C+ T+               L+V
Sbjct: 381 IRGHRSDVRAIDISGDNKLLATASNGTLKIWNIKTNSCIRTFECGYALACKFLPGGALVV 440

Query: 354 SGSADKTVKVWHVESRTCY-TLRG-HTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRT-- 409
            G+    + ++ + S T   T+ G H+G +  + +        +GS D T+  WD +   
Sbjct: 441 LGTKTGDLHLYDLASSTLLNTIEGAHSGAIWSLDMTTDGKRLVTGSADKTVCFWDFQVEQ 500

Query: 410 ----------NTCVRVFHGHVGQVQ-KVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQ 458
                     N  +++FH    ++   V+ + +  D                        
Sbjct: 501 EPVPGTTDKFNPKLKMFHDTTLELNDDVLAVKISPDNRLLAVSLLDNTVKVFFMDSMKFF 560

Query: 459 AANFDHSLPYPT--------HLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDI--AAD 508
            + + H LP  +         L++ S D  IK+W +  G C R+ F H + +  +    +
Sbjct: 561 LSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHRSLFAHNDSIMKVVFVPE 620

Query: 509 NFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGI-GDSEFV 553
           +    S S D   K WD    +C+         V  + I  D  FV
Sbjct: 621 SHNFFSCSKDALVKYWDGDKFECIQKLAAHQKEVWTLAISSDGRFV 666

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 84/186 (45%), Gaps = 30/186 (16%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK-----------------LITGS 316
           TG+ ++ V  W + +G+LI  L   TDG+     D +                  L  G 
Sbjct: 39  TGALEN-VNCWSMKSGELIGTL---TDGLPPGAVDAKSTKPAETSYLQYHPETRLLAVGY 94

Query: 317 LDKTIRVWNYVTGACVSTYRGHQD--SVLSVDSFRKLIVSGSADKTVKVWHVESRT-CYT 373
            D  I++W+ ++ + + ++ GH+   ++L+ D     ++SGS D  + VW +      Y 
Sbjct: 95  NDGAIKIWDLLSKSVLISFNGHKSAITILTFDQTGTRLISGSRDSDIIVWDLVGEVGLYK 154

Query: 374 LRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQ-----VQKVIP 428
           LR H   +  +    + +   S S D  I++WD++   CV     HVG+     V + + 
Sbjct: 155 LRSHKDSITGLWCEGEEW-LISTSKDGLIKVWDLKVQQCVETHVAHVGECWSMGVHEDLV 213

Query: 429 LTLGSD 434
           +T G+D
Sbjct: 214 ITAGAD 219

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 49/94 (52%), Gaps = 1/94 (1%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK-LITGSLDKTIRVWNYVTGACV 332
           +GS DS + +WDL     + +L  H D +  L  + ++ LI+ S D  I+VW+     CV
Sbjct: 134 SGSRDSDIIVWDLVGEVGLYKLRSHKDSITGLWCEGEEWLISTSKDGLIKVWDLKVQQCV 193

Query: 333 STYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHV 366
            T+  H     S+     L+++  AD  +K+W++
Sbjct: 194 ETHVAHVGECWSMGVHEDLVITAGADNQIKLWNL 227

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGAC 331
           T S D  + IW L  G   R L  H D +  + F  +     + S D  ++ W+     C
Sbjct: 584 TSSADKNIKIWGLDFGDCHRSLFAHNDSIMKVVFVPESHNFFSCSKDALVKYWDGDKFEC 643

Query: 332 VSTYRGHQDSV--LSVDSFRKLIVSGSADKTVKVW 364
           +     HQ  V  L++ S  + +VS S D++++VW
Sbjct: 644 IQKLAAHQKEVWTLAISSDGRFVVSASHDQSIRVW 678

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/148 (20%), Positives = 59/148 (39%), Gaps = 4/148 (2%)

Query: 384 VKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXX 443
           ++ HP++     G +D  I++WD+ + + +  F+GH   +  +     G+ LI       
Sbjct: 81  LQYHPETRLLAVGYNDGAIKIWDLLSKSVLISFNGHKSAITILTFDQTGTRLISGSRDSD 140

Query: 444 XXXXXXXXXXXXSVQAANFDHSLPY----PTHLLSCSLDNTIKLWNVKTGACIRTQFGHV 499
                           ++ D            L+S S D  IK+W++K   C+ T   HV
Sbjct: 141 IIVWDLVGEVGLYKLRSHKDSITGLWCEGEEWLISTSKDGLIKVWDLKVQQCVETHVAHV 200

Query: 500 EGVWDIAADNFRIVSGSHDRSCKVWDLQ 527
              W +      +++   D   K+W+L 
Sbjct: 201 GECWSMGVHEDLVITAGADNQIKLWNLN 228

>Scas_713.50
          Length = 983

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 51/171 (29%), Positives = 79/171 (46%), Gaps = 21/171 (12%)

Query: 274 TGSYDSTVAIWDL---------ATGKLIRRLSGHTDGVKALRFD---------DQKLITG 315
           TGS D +V  W+           + K + +L  H D    L  D         D+ L   
Sbjct: 528 TGSADKSVKFWNFQLEQELVPGTSDKFVPKLGLHHDTTLELSDDILSVRVSPEDKFLAVS 587

Query: 316 SLDKTIRVWNYVTGACVSTYRGHQDSVLSVD-SF-RKLIVSGSADKTVKVWHVESRTCY- 372
            LD T++V+   +     +  GH+  VLS+D SF  K+I++ SADK +K+W ++   C+ 
Sbjct: 588 LLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHK 647

Query: 373 TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQV 423
           +L  H   +  VK  P+S   FS S D  I+ WD     C++    H  +V
Sbjct: 648 SLFAHQDSIMNVKFVPESHNFFSCSKDGIIKYWDGDKFECIQKLAAHQSEV 698

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 65/275 (23%), Positives = 104/275 (37%), Gaps = 61/275 (22%)

Query: 275 GSYDSTVAIWDLATGKLIRRLS-GHTDGVKALRF--DDQKLITGSLDKTIRVWNY----- 326
           G+    + ++DLA+   I  +   H   + +L    D ++LITGS DK+++ WN+     
Sbjct: 486 GTRAGELQLFDLASSTQIANIEEAHDAAIWSLDLTSDGKRLITGSADKSVKFWNFQLEQE 545

Query: 327 ----VTGACVSTYRGHQDSVLSVD----SFR-----KLIVSGSADKTVKVWHVESRTCY- 372
                +   V     H D+ L +     S R     K +     D TVKV+ ++S   + 
Sbjct: 546 LVPGTSDKFVPKLGLHHDTTLELSDDILSVRVSPEDKFLAVSLLDNTVKVFFLDSMKFFL 605

Query: 373 TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLG 432
           +L GH   V  + +   S    + S D  I++W +    C +    H   +  V      
Sbjct: 606 SLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNV------ 659

Query: 433 SDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACI 492
                                            +P   +  SCS D  IK W+     CI
Sbjct: 660 -------------------------------KFVPESHNFFSCSKDGIIKYWDGDKFECI 688

Query: 493 RTQFGHVEGVW--DIAADNFRIVSGSHDRSCKVWD 525
           +    H   VW   IA D   +VS SHD S ++W+
Sbjct: 689 QKLAAHQSEVWALAIANDASFVVSSSHDHSIRIWE 723

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 72/147 (48%), Gaps = 16/147 (10%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQ--KLITGSLDKTIRVWNYVTGACV 332
           G  D  V +WDL +  ++  L+GH+  + AL+FD    +LI+GS D  I VW+ V+   +
Sbjct: 124 GYNDGVVKVWDLYSKTVLCNLNGHSSAITALKFDTSGTRLISGSRDSNIIVWDLVSEVGL 183

Query: 333 STYRGHQDSVLSV-----------DSFRKLIVSGSADKTVKVWHVESRTCY-TLRGHTGW 380
              R H+D++  +           ++    ++S S D  +K+W ++ + C  T   HTG 
Sbjct: 184 YKLRSHKDAITGIWCNEVTNNNQEENELDWLISTSKDGLIKIWDLKIQQCVETHIAHTG- 242

Query: 381 VNCVKLHPKSFTCFSGSDDMTIRMWDI 407
             C  L  ++    + S D  ++ W +
Sbjct: 243 -ECWSLAVRNDLVITTSSDSQVKFWQL 268

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 50/233 (21%), Positives = 84/233 (36%), Gaps = 46/233 (19%)

Query: 311 KLITGSLDKTIRVWNYVTGACVS----------------TYRGHQDSVLSVDSFRKLIVS 354
           ++ITG+L+  + +W+  TG   S                + +  + + L       L+  
Sbjct: 65  QIITGALE-NVNIWDLKTGELASFLNDGLVPPPGSVDAKSSKPAETTFLQHHKETNLLAV 123

Query: 355 GSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCV 413
           G  D  VKVW + S+T    L GH+  +  +K         SGS D  I +WD+ +   +
Sbjct: 124 GYNDGVVKVWDLYSKTVLCNLNGHSSAITALKFDTSGTRLISGSRDSNIIVWDLVSEVGL 183

Query: 414 RVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLL 473
                H   +  +                               +  N +        L+
Sbjct: 184 YKLRSHKDAITGI----------------------------WCNEVTNNNQEENELDWLI 215

Query: 474 SCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDL 526
           S S D  IK+W++K   C+ T   H    W +A  N  +++ S D   K W L
Sbjct: 216 STSKDGLIKIWDLKIQQCVETHIAHTGECWSLAVRNDLVITTSSDSQVKFWQL 268

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 75/177 (42%), Gaps = 29/177 (16%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLS-------GHTDGVKA----LRF-----DDQKLITGSL 317
           TG+ ++ V IWDL TG+L   L+       G  D   +      F     +   L  G  
Sbjct: 68  TGALEN-VNIWDLKTGELASFLNDGLVPPPGSVDAKSSKPAETTFLQHHKETNLLAVGYN 126

Query: 318 DKTIRVWNYVTGACVSTYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWHVESRT-CYTL 374
           D  ++VW+  +   +    GH  ++  L  D+    ++SGS D  + VW + S    Y L
Sbjct: 127 DGVVKVWDLYSKTVLCNLNGHSSAITALKFDTSGTRLISGSRDSNIIVWDLVSEVGLYKL 186

Query: 375 RGH----TG-WVNCVKLHPKSFT----CFSGSDDMTIRMWDIRTNTCVRVFHGHVGQ 422
           R H    TG W N V  + +         S S D  I++WD++   CV     H G+
Sbjct: 187 RSHKDAITGIWCNEVTNNNQEENELDWLISTSKDGLIKIWDLKIQQCVETHIAHTGE 243

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 50/104 (48%), Gaps = 11/104 (10%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKAL-----RFDDQK------LITGSLDKTIR 322
           +GS DS + +WDL +   + +L  H D +  +       ++Q+      LI+ S D  I+
Sbjct: 165 SGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIWCNEVTNNNQEENELDWLISTSKDGLIK 224

Query: 323 VWNYVTGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHV 366
           +W+     CV T+  H     S+     L+++ S+D  VK W +
Sbjct: 225 IWDLKIQQCVETHIAHTGECWSLAVRNDLVITTSSDSQVKFWQL 268

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 58/309 (18%), Positives = 110/309 (35%), Gaps = 71/309 (22%)

Query: 294 RLSGHTDGVKALRF-DDQKLITGSLDKTIRVWNYVTGACVSTYR---------------- 336
            L G    ++++   DD KL+  + + ++++WN  T  C+ T+                 
Sbjct: 424 ELQGQRTDIRSIDISDDNKLLATASNGSLKIWNLKTKLCIRTFECGYALTCKFLPGGMLV 483

Query: 337 -------------------------GHQDSVLSVD--SFRKLIVSGSADKTVKVWHVESR 369
                                     H  ++ S+D  S  K +++GSADK+VK W+ +  
Sbjct: 484 IIGTRAGELQLFDLASSTQIANIEEAHDAAIWSLDLTSDGKRLITGSADKSVKFWNFQLE 543

Query: 370 TCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPL 429
                     +V  + LH    T    SDD               +    V    K + +
Sbjct: 544 QELVPGTSDKFVPKLGLHHD--TTLELSDD---------------ILSVRVSPEDKFLAV 586

Query: 430 TLGSDLIEXXXXXXXXXXXXXXXXXXSVQAAN--FDHSLPYPTHLLSCSLDNTIKLWNVK 487
           +L  + ++                   V + +  FD  +     +++ S D  IK+W + 
Sbjct: 587 SLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKM-----IITSSADKNIKIWGLD 641

Query: 488 TGACIRTQFGHVEGVWDI--AADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACV 545
            G C ++ F H + + ++    ++    S S D   K WD    +C+       + V  +
Sbjct: 642 FGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGIIKYWDGDKFECIQKLAAHQSEVWAL 701

Query: 546 GIG-DSEFV 553
            I  D+ FV
Sbjct: 702 AIANDASFV 710

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 32/162 (19%), Positives = 64/162 (39%), Gaps = 48/162 (29%)

Query: 387 HPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXX 446
           H ++     G +D  +++WD+ + T +   +GH                           
Sbjct: 115 HKETNLLAVGYNDGVVKVWDLYSKTVLCNLNGH--------------------------- 147

Query: 447 XXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACI---RTQFGHVEGVW 503
                    ++ A  FD S    T L+S S D+ I +W++ +   +   R+    + G+W
Sbjct: 148 -------SSAITALKFDTS---GTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIW 197

Query: 504 --DIAADNFR------IVSGSHDRSCKVWDLQTGKCMHTFVG 537
             ++  +N        ++S S D   K+WDL+  +C+ T + 
Sbjct: 198 CNEVTNNNQEENELDWLISTSKDGLIKIWDLKIQQCVETHIA 239

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 42/72 (58%), Gaps = 8/72 (11%)

Query: 464 HSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKV 523
           +S+PY     +  + N  KL+NV+    ++ Q   +  + DI+ DN ++++ + + S K+
Sbjct: 403 YSIPYEKREPTQPIAN--KLYNVE----LQGQRTDIRSI-DISDDN-KLLATASNGSLKI 454

Query: 524 WDLQTGKCMHTF 535
           W+L+T  C+ TF
Sbjct: 455 WNLKTKLCIRTF 466

>CAGL0M04279g 469040..471862 highly similar to sp|Q12220
           Saccharomyces cerevisiae YLR129w DIP2 DOM34P-interacting
           protein, start by similarity
          Length = 940

 Score = 68.6 bits (166), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 67/275 (24%), Positives = 105/275 (38%), Gaps = 61/275 (22%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGV---KALRFDDQKLITGSLDKTIRVWNY-VTGA 330
           G+ +  + ++D+A+  ++    G  D       L  D +KL+TGS DKT+R W + V+  
Sbjct: 445 GTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEV 504

Query: 331 CVS---------------TYRGHQDSVLSV--DSFRKLIVSGSADKTVKVWHVESRTCY- 372
            VS               T     D +LSV      K I     D TVKV+ ++S   + 
Sbjct: 505 PVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFL 564

Query: 373 TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLG 432
           +L GH   V  + +   S    + S D  I++W +    C +    H   +  V      
Sbjct: 565 SLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNV------ 618

Query: 433 SDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACI 492
                                            LP   +  SCS D T+K W+ +   CI
Sbjct: 619 -------------------------------KFLPESYNFFSCSKDATVKYWDGQKFECI 647

Query: 493 RTQFGHVEGVWDIAADN--FRIVSGSHDRSCKVWD 525
           +    H   VW I+  N    ++S  HD S +VW+
Sbjct: 648 QKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE 682

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 52/272 (19%), Positives = 107/272 (39%), Gaps = 26/272 (9%)

Query: 308 DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVE 367
           DD KL+  + + ++++WN  T  C+ ++               L+V G+ +  ++++ + 
Sbjct: 398 DDNKLLATASNGSLKIWNIKTKRCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIA 457

Query: 368 SRTCYTLR--GHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDI------------RTNTCV 413
           S T    +   H   +  + L        +GS D T+R W              +T   +
Sbjct: 458 SSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPML 517

Query: 414 RVFHGHVGQVQK-VIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLP----- 467
           ++FH    ++   ++ + +  D                         + + H LP     
Sbjct: 518 QLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMD 577

Query: 468 --YPTHLL-SCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA--ADNFRIVSGSHDRSCK 522
             Y + L+ +CS D  IK+W +  G C ++ F H + + ++    +++   S S D + K
Sbjct: 578 ISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVK 637

Query: 523 VWDLQTGKCMHTFVGIHAPVACVGI-GDSEFV 553
            WD Q  +C+       + V  + +  D  FV
Sbjct: 638 YWDGQKFECIQKLAAHQSEVWSISVSNDGTFV 669

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 65/137 (47%), Gaps = 6/137 (4%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDD--QKLITGSLDKTIRVWNYVTGACV 332
           G  D  + IWDL +  ++   +GH   +  L FD    +LI+ S D  I VW+ V  + +
Sbjct: 97  GYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGL 156

Query: 333 STYRGHQDSVLSV-DSFRKLIVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHPKS 390
              R H+D++  +       ++S S D  VK+W ++S+ C  T   HTG   C  L    
Sbjct: 157 YKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHLAHTG--ECWSLGIIE 214

Query: 391 FTCFSGSDDMTIRMWDI 407
               + S D  +++W +
Sbjct: 215 DMAVTCSADSQVKLWKL 231

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 76/160 (47%), Gaps = 18/160 (11%)

Query: 280 TVAIWDLATGKLIRRLS-----GHTDG-------VKALRF--DDQKLITGSLDKTIRVWN 325
            + +WD+ TG+ I +L+     G +D           L++  +   L  G  D  I++W+
Sbjct: 48  NILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWD 107

Query: 326 YVTGACVSTYRGHQD--SVLSVDSFRKLIVSGSADKTVKVWHVESRT-CYTLRGHTGWVN 382
            ++   + ++ GH+   +VL+ D+    ++S S D  + VW +   +  Y LR H   + 
Sbjct: 108 LISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAIT 167

Query: 383 CVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQ 422
            +    +++   S S D  +++WD+++  CV     H G+
Sbjct: 168 GLWCEDENW-LISTSKDGLVKIWDLKSQQCVETHLAHTGE 206

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 49/95 (51%), Gaps = 1/95 (1%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK-LITGSLDKTIRVWNYVTGACV 332
           + S DS + +WDL     + +L  H D +  L  +D+  LI+ S D  +++W+  +  CV
Sbjct: 138 SASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCV 197

Query: 333 STYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVE 367
            T+  H     S+     + V+ SAD  VK+W ++
Sbjct: 198 ETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLD 232

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 59/147 (40%), Gaps = 4/147 (2%)

Query: 384 VKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXX 443
           +K HP++    +G  D  I++WD+ + T +  F+GH   +  +   T G+ LI       
Sbjct: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144

Query: 444 XXXXXXXXXXXXSVQAANFDHSLPY----PTHLLSCSLDNTIKLWNVKTGACIRTQFGHV 499
                           ++ D            L+S S D  +K+W++K+  C+ T   H 
Sbjct: 145 IIVWDLVGESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHLAHT 204

Query: 500 EGVWDIAADNFRIVSGSHDRSCKVWDL 526
              W +       V+ S D   K+W L
Sbjct: 205 GECWSLGIIEDMAVTCSADSQVKLWKL 231

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 43/96 (44%), Gaps = 4/96 (4%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGAC 331
           T S D  + IW L  G   + L  H D +  ++F  +     + S D T++ W+     C
Sbjct: 587 TCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFEC 646

Query: 332 VSTYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWH 365
           +     HQ  V  +SV +    ++S   D +++VW 
Sbjct: 647 IQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE 682

>Scas_720.83d
          Length = 915

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 92/201 (45%), Gaps = 22/201 (10%)

Query: 245 WRKGIYRIQEFKGHMDGVXXXXXXX--XXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGV 302
           W+   Y +++ +GH D               T + D  + +WD+ +G  +     HT  V
Sbjct: 330 WQSESYILKQ-QGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVVSGFCLATFQEHTSSV 388

Query: 303 KALRFDD--QKLITGSLDKTIRVWNYVTGACVSTYRGH---QDSVLSVDSFRKLIVSGSA 357
             ++F    Q L + SLD T+R W+ +      T+      Q + L+VD   +++ +GS 
Sbjct: 389 TQVQFAKRGQVLFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFNCLAVDPSGEVVCAGSL 448

Query: 358 DK-TVKVWHVES-RTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRV 415
           D   + VW V++ +   TL GH G V+C+    ++    S S D T+R+W I        
Sbjct: 449 DNFDIHVWSVQTGQLLDTLSGHEGPVSCLAFSQENSVLASASWDKTVRVWSI-------- 500

Query: 416 FHGHVGQVQKVIPLTLGSDLI 436
                G+ Q+V P  + SD++
Sbjct: 501 ----FGRSQQVEPFDVYSDVL 517

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 72/148 (48%), Gaps = 7/148 (4%)

Query: 283 IWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQD 340
           +++  +   I +  GH D   +L +  D  +++T + D  I+VW+ V+G C++T++ H  
Sbjct: 327 VYEWQSESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVVSGFCLATFQEHTS 386

Query: 341 SVLSVDSFRK--LIVSGSADKTVKVWH-VESRTCYTLRGHTG-WVNCVKLHPKSFTCFSG 396
           SV  V   ++  ++ S S D TV+ W  +  R   T         NC+ + P      +G
Sbjct: 387 SVTQVQFAKRGQVLFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFNCLAVDPSGEVVCAG 446

Query: 397 S-DDMTIRMWDIRTNTCVRVFHGHVGQV 423
           S D+  I +W ++T   +    GH G V
Sbjct: 447 SLDNFDIHVWSVQTGQLLDTLSGHEGPV 474

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 70/202 (34%), Gaps = 64/202 (31%)

Query: 361 VKVWHVESRTCYTLR--GHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHG 418
           V  W  ES   Y L+  GH    N +   P      + ++D  I++WD+ +  C+  F  
Sbjct: 327 VYEWQSES---YILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVVSGFCLATFQE 383

Query: 419 HVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLD 478
           H   V +V     G                                       L S SLD
Sbjct: 384 HTSSVTQVQFAKRGQ-------------------------------------VLFSSSLD 406

Query: 479 NTIKLW------NVKT-GACIRTQFGHV------EGVWDIAADNFRIVSGSHDRSCKVWD 525
            T++ W      N +T  A  R QF  +      E V   + DNF I          VW 
Sbjct: 407 GTVRAWDLIRYRNFRTFTAAERIQFNCLAVDPSGEVVCAGSLDNFDI---------HVWS 457

Query: 526 LQTGKCMHTFVGIHAPVACVGI 547
           +QTG+ + T  G   PV+C+  
Sbjct: 458 VQTGQLLDTLSGHEGPVSCLAF 479

>ADR176W [1917] [Homologous to ScYOR269W (PAC1) - SH]
           complement(1012413..1013798) [1386 bp, 461 aa]
          Length = 461

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 78/312 (25%), Positives = 125/312 (40%), Gaps = 47/312 (15%)

Query: 281 VAIWDLATGKL-IRRLSGHTDGVKALRFDDQK-----LITGSLDKTIRVWNYVTGACVST 334
           V  +DL    + +     H  GV +L   + +     + T S D   ++W++   A    
Sbjct: 144 VVAYDLFNRSMPLHSTQAHMKGVTSLAVMEAENGSLLISTTSKDLQCKIWSFTDNAAFQL 203

Query: 335 YR--GHQDSVLSVDSFRK-----LIVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKL 386
            R     + ++S   F +     L+ + S D TVKVW  +S  C  + + H  WV  ++L
Sbjct: 204 LRTLSSHEHIVSQSCFLRSGSDLLLATCSRDLTVKVWDTKSGWCIKSFQPHNQWVRTLEL 263

Query: 387 HPKSFTCFSGSDDMTIRM--WDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXX 444
           H       +GS+D TIR+  W       + V H    +   +IP+   +           
Sbjct: 264 HGDYV--ITGSNDATIRLSHWPSGNGLSMAVMHEFPIERVLIIPMRANT---------AQ 312

Query: 445 XXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACI----------RT 494
                        +  + D+S     + +SCS DN I LW +     I          +T
Sbjct: 313 KTEADDDQVELEYRKYDPDYSPLGFKYCISCSRDNLIVLWKIPLPKFIPHRPPQPNLLQT 372

Query: 495 QF-------GHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFV-GIHAPVACVG 546
            F       GH   V DI      + S S DRS + WDL TG+C+  +    H  + C+ 
Sbjct: 373 NFEKVHVFKGHTSWVRDIKVRGRHLFSCSDDRSIRCWDLVTGQCLKVWPEASHGFINCLS 432

Query: 547 IGDSEFVSGDEL 558
           + DS+ VS D+L
Sbjct: 433 V-DSD-VSNDKL 442

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 80/202 (39%), Gaps = 56/202 (27%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVS 333
           T S D TV +WD  +G  I+    H   V+ L      +ITGS D TIR+ ++ +G  +S
Sbjct: 230 TCSRDLTVKVWDTKSGWCIKSFQPHNQWVRTLELHGDYVITGSNDATIRLSHWPSGNGLS 289

Query: 334 TYRGHQ---DSVLSVD------------------SFR-----------KLIVSGSADKTV 361
               H+   + VL +                    +R           K  +S S D  +
Sbjct: 290 MAVMHEFPIERVLIIPMRANTAQKTEADDDQVELEYRKYDPDYSPLGFKYCISCSRDNLI 349

Query: 362 KVWHV------------------ESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIR 403
            +W +                       +  +GHT WV  +K+  +    FS SDD +IR
Sbjct: 350 VLWKIPLPKFIPHRPPQPNLLQTNFEKVHVFKGHTSWVRDIKVRGRHL--FSCSDDRSIR 407

Query: 404 MWDIRTNTCVRVF----HGHVG 421
            WD+ T  C++V+    HG + 
Sbjct: 408 CWDLVTGQCLKVWPEASHGFIN 429

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 55/122 (45%), Gaps = 12/122 (9%)

Query: 256 KGHMDGVXXXXXXXXXX-----XTGSYDSTVAIW---DLATGKLIRRLSGHTDGVKALRF 307
           + HM GV                T S D    IW   D A  +L+R LS H   V    F
Sbjct: 160 QAHMKGVTSLAVMEAENGSLLISTTSKDLQCKIWSFTDNAAFQLLRTLSSHEHIVSQSCF 219

Query: 308 ----DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKV 363
                D  L T S D T++VW+  +G C+ +++ H   V +++     +++GS D T+++
Sbjct: 220 LRSGSDLLLATCSRDLTVKVWDTKSGWCIKSFQPHNQWVRTLELHGDYVITGSNDATIRL 279

Query: 364 WH 365
            H
Sbjct: 280 SH 281

>KLLA0E24508g complement(2175775..2176758) similar to sp|P38123
           Saccharomyces cerevisiae YBR175w, start by similarity
          Length = 327

 Score = 65.5 bits (158), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 82/157 (52%), Gaps = 15/157 (9%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGAC 331
           +GS D TV I  +  G+ IRRL GHT  V ++ ++++   L + S+D++I+ W+ ++G  
Sbjct: 86  SGSEDFTVEITHIIYGR-IRRLMGHTAPVISICYNNKGNILCSSSMDESIKEWHVLSGTA 144

Query: 332 VSTYRGHQDSVLSVDSFR---KLIVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLH 387
           + T   H D+V+S+D  +    ++ SGS D  ++++  ES  C  TL     W+    + 
Sbjct: 145 LKTMSAHSDAVVSIDIPKFDSSILSSGSYDGLIRIFDTESGHCLKTLTYDKDWIAEDGVV 204

Query: 388 PKSFTCFS--------GSDDMTIRMWDIRTNTCVRVF 416
           P S   FS         S D  +++W+    T VR F
Sbjct: 205 PISTVKFSRNGKFLLVKSLDNVVKLWEYTRGTVVRTF 241

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 77/200 (38%), Gaps = 46/200 (23%)

Query: 350 KLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRT 409
           K I SGS D TV++ H+       L GHT  V  +  + K     S S D +I+ W + +
Sbjct: 82  KCIASGSEDFTVEITHIIYGRIRRLMGHTAPVISICYNNKGNILCSSSMDESIKEWHVLS 141

Query: 410 NTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYP 469
            T ++    H   V                                S+    FD S+   
Sbjct: 142 GTALKTMSAHSDAV-------------------------------VSIDIPKFDSSI--- 167

Query: 470 THLLSCSLDNTIKLWNVKTGACIRT-----QFGHVEGVWDIAADNFR-----IVSGSHDR 519
             L S S D  I++++ ++G C++T      +   +GV  I+   F      ++  S D 
Sbjct: 168 --LSSGSYDGLIRIFDTESGHCLKTLTYDKDWIAEDGVVPISTVKFSRNGKFLLVKSLDN 225

Query: 520 SCKVWDLQTGKCMHTFVGIH 539
             K+W+   G  + TF+  H
Sbjct: 226 VVKLWEYTRGTVVRTFLWPH 245

>Kwal_23.5351
          Length = 474

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 59/252 (23%), Positives = 107/252 (42%), Gaps = 51/252 (20%)

Query: 308 DDQKLITGSLDKTIRVWNYVTGACVSTYRG-HQDSVLSV--DSFRKLIVSGSADKTVKVW 364
           D   L  GS +  +++ +  +   V +  G H D +  V   S  +L+ +G AD  VK+W
Sbjct: 193 DGASLAAGSWNGDVKILHPQSLEVVRSLDGAHDDKIGGVAWSSDSQLLATGGADNLVKIW 252

Query: 365 HVESRTC-----YTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGH 419
           + ++++        LRGH   V+ VK HP      S S DMT R+WD+   T +++  GH
Sbjct: 253 NPQAQSHSEASRVVLRGHEARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQLQEGH 312

Query: 420 VGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANF--DHSLPYPTHLLSCSL 477
             +                                  V   +F  D SL     L S  L
Sbjct: 313 AKE----------------------------------VYCLDFQCDGSL-----LCSAGL 333

Query: 478 DNTIKLWNVKTGACIRTQFGHVEGVWDI--AADNFRIVSGSHDRSCKVWDLQTGKCMHTF 535
           D+   +W+++TG  +    GH + ++ +  + +   + +GS D + +VWD++      + 
Sbjct: 334 DSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGSGDGTVQVWDIRKANKPSSI 393

Query: 536 VGIHAPVACVGI 547
           +  ++ V+ V  
Sbjct: 394 LAHNSIVSEVNF 405

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 69/274 (25%), Positives = 110/274 (40%), Gaps = 24/274 (8%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSG-HTDGVKALRF--DDQKLITGSLDKTIRVWNYV--- 327
            GS++  V I    + +++R L G H D +  + +  D Q L TG  D  +++WN     
Sbjct: 199 AGSWNGDVKILHPQSLEVVRSLDGAHDDKIGGVAWSSDSQLLATGGADNLVKIWNPQAQS 258

Query: 328 -TGACVSTYRGHQDSVLSVD--SFRKLIVSGSADKTVKVWHVESRTCYTLR-GHTGWVNC 383
            + A     RGH+  V  V      + + S S D T ++W VE  T   L+ GH   V C
Sbjct: 259 HSEASRVVLRGHEARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQLQEGHAKEVYC 318

Query: 384 VKLH-PKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKV--------IPLTLGSD 434
           +      S  C +G D +   +WD+RT   + V  GH   +  V        +    G  
Sbjct: 319 LDFQCDGSLLCSAGLDSVG-HVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGSGDG 377

Query: 435 LIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRT 494
            ++                   V   NF+        L+S S D TI ++   +   + +
Sbjct: 378 TVQVWDIRKANKPSSILAHNSIVSEVNFEKE--NGNFLVSSSYDRTIGVFATGSWIKLAS 435

Query: 495 QFGHVEGVW--DIAADNFRIVSGSHDRSCKVWDL 526
             GH + +   DI+     + S   DRS K+W L
Sbjct: 436 LQGHTDKILSVDISRGGANLWSSGWDRSVKIWAL 469

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 55/104 (52%), Gaps = 9/104 (8%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK---LITGSLDKTIRVWNYVTGA 330
           TGS D TV +WD+        +  H   V  + F+ +    L++ S D+TI V  + TG+
Sbjct: 372 TGSGDGTVQVWDIRKANKPSSILAHNSIVSEVNFEKENGNFLVSSSYDRTIGV--FATGS 429

Query: 331 CV--STYRGHQDSVLSVDSFR--KLIVSGSADKTVKVWHVESRT 370
            +  ++ +GH D +LSVD  R    + S   D++VK+W +  R+
Sbjct: 430 WIKLASLQGHTDKILSVDISRGGANLWSSGWDRSVKIWALGVRS 473

>AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH]
           complement(1497416..1499560) [2145 bp, 714 aa]
          Length = 714

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 83/181 (45%), Gaps = 19/181 (10%)

Query: 255 FKGHMDGVXXXXXXXXXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGV-KALRFDDQKLI 313
             GH   V           + S+D T  +W   T +  R LSGH   V  AL     + +
Sbjct: 104 LAGHSGNVCALEARDGQLVSSSWDQTARVWREGTEE--RALSGHNATVWHALALGYDRFL 161

Query: 314 TGSLDKTIRVWNYVTGA-CVSTYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWHVESRT 370
           T S DKTI++W+   GA  ++TY  H D V  L++        S S D +VKV  ++ +T
Sbjct: 162 TASADKTIKLWD---GARDLATYNVHTDVVRHLALAPDGHHFASCSNDGSVKVHTLDGKT 218

Query: 371 CYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLT 430
             T  GH  +V CVK  P       G +D T+R+WD+          GHV QV ++   +
Sbjct: 219 VRTFDGHESFVYCVKYLPDGGLVSCG-EDKTVRVWDMS---------GHVRQVIRLCATS 268

Query: 431 L 431
           L
Sbjct: 269 L 269

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 64/253 (25%), Positives = 103/253 (40%), Gaps = 23/253 (9%)

Query: 290 KLIRRLSGHTDGVKAL-RFDDQKLITGSLDKTIRVWNYVT-------GACVSTYRGHQDS 341
           +L   L GH+  VK++    D ++ +GS D T+RVW   T       GA + +   + ++
Sbjct: 9   ELSSSLLGHSMDVKSVVAISDTQIASGSRDGTVRVWTRDTSDSRLWSGAILHSTERYVNA 68

Query: 342 VLSVDSFRKLIVSGSADKTVK-----VWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSG 396
           V   ++  +L+  G  +  +      V  V+  + Y L GH+G  N   L  +     S 
Sbjct: 69  VCYEEN-EQLVFFGGQEAVIGAVSPLVLEVQDAS-YLLAGHSG--NVCALEARDGQLVSS 124

Query: 397 SDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXS 456
           S D T R+W  R  T  R   GH   V   + L     L                    +
Sbjct: 125 SWDQTARVW--REGTEERALSGHNATVWHALALGYDRFLTASADKTIKLWDGARDLATYN 182

Query: 457 VQAANFDHSLPYPT--HLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA-ADNFRIV 513
           V      H    P   H  SCS D ++K+  +  G  +RT  GH   V+ +    +  +V
Sbjct: 183 VHTDVVRHLALAPDGHHFASCSNDGSVKVHTLD-GKTVRTFDGHESFVYCVKYLPDGGLV 241

Query: 514 SGSHDRSCKVWDL 526
           S   D++ +VWD+
Sbjct: 242 SCGEDKTVRVWDM 254

>AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH]
           (134760..136127) [1368 bp, 455 aa]
          Length = 455

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 58/231 (25%), Positives = 97/231 (41%), Gaps = 44/231 (19%)

Query: 304 ALRFDDQKLITGSLDKTIRVWNYVT-GACVSTYRGHQDSVLSVD--SFRKLIVSGSADKT 360
           A+  D Q+L TG    +I+V +  T G   S    H+  +  +D       ++SG  D  
Sbjct: 179 AVHRDGQQLATGCWGGSIKVVSCETLGIAKSIDAAHEGKIGGLDWHPDGNHLLSGGGDNL 238

Query: 361 VKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHV 420
           VK+W + S +   LRGH G V+ VK+HP      S S D+T  +WD+     +++  GH 
Sbjct: 239 VKLWDMTSNSFEELRGHAGRVSRVKVHPSGRLAASASFDLTWILWDLERKVELQLQEGHS 298

Query: 421 GQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNT 480
             V  +                                A   D +L     L S  LD  
Sbjct: 299 KAVYTI--------------------------------AFQSDGAL-----LASAGLDAV 321

Query: 481 IKLWNVKTGACIRTQFGH---VEGVWDIAADNFRIVSGSHDRSCKVWDLQT 528
             +W++++G  I    GH   + GV D + + +++ +   D + +VWD++ 
Sbjct: 322 CAIWDLRSGEPIMKLEGHAGAISGV-DWSPNGYQLATAGADGTVRVWDIRN 371

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 68/139 (48%), Gaps = 8/139 (5%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGAC 331
           +   D+  AIWDL +G+ I +L GH   +  + +  +  +L T   D T+RVW+      
Sbjct: 315 SAGLDAVCAIWDLRSGEPIMKLEGHAGAISGVDWSPNGYQLATAGADGTVRVWDIRNVGT 374

Query: 332 VSTYRGHQDSVLSVDSFRK----LIVSGSADKTVKVWHVES-RTCYTLRGHTGWVNCVKL 386
            S    HQ + L V  F+K     +VS   D+ V +++ ++ +   +L GHT  V  V +
Sbjct: 375 ESALLAHQVAALDV-KFKKNNGTFLVSCGHDRLVNIFNADNWQKLASLEGHTDRVFTVDI 433

Query: 387 HPKSFTCFSGSDDMTIRMW 405
                T +SG  D +++ W
Sbjct: 434 TEDGSTIYSGGKDRSLKQW 452

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 59/258 (22%), Positives = 91/258 (35%), Gaps = 44/258 (17%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLI--TGSLDKTIRVWNYVTGAC 331
           +G  D+ V +WD+ T      L GH   V  ++      +  + S D T  +W+      
Sbjct: 232 SGGGDNLVKLWDM-TSNSFEELRGHAGRVSRVKVHPSGRLAASASFDLTWILWDLERKVE 290

Query: 332 VSTYRGHQDSVLSV--DSFRKLIVSGSADKTVKVWHVES-RTCYTLRGHTGWVNCVKLHP 388
           +    GH  +V ++   S   L+ S   D    +W + S      L GH G ++ V   P
Sbjct: 291 LQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGHAGAISGVDWSP 350

Query: 389 KSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXX 448
             +   +   D T+R+WDIR          H                             
Sbjct: 351 NGYQLATAGADGTVRVWDIRNVGTESALLAH----------------------------- 381

Query: 449 XXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVW--DIA 506
                   V A +        T L+SC  D  + ++N      + +  GH + V+  DI 
Sbjct: 382 -------QVAALDVKFKKNNGTFLVSCGHDRLVNIFNADNWQKLASLEGHTDRVFTVDIT 434

Query: 507 ADNFRIVSGSHDRSCKVW 524
            D   I SG  DRS K W
Sbjct: 435 EDGSTIYSGGKDRSLKQW 452

 Score = 48.9 bits (115), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 64/171 (37%), Gaps = 40/171 (23%)

Query: 377 HTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLI 436
           H G +  +  HP      SG  D  +++WD+ +N+      GH G+V +V          
Sbjct: 214 HEGKIGGLDWHPDGNHLLSGGGDNLVKLWDMTSNS-FEELRGHAGRVSRV---------- 262

Query: 437 EXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQF 496
                                         P      S S D T  LW+++    ++ Q 
Sbjct: 263 ---------------------------KVHPSGRLAASASFDLTWILWDLERKVELQLQE 295

Query: 497 GHVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACV 545
           GH + V+ IA  +D   + S   D  C +WDL++G+ +    G    ++ V
Sbjct: 296 GHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGHAGAISGV 346

>KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces
           cerevisiae YKL021c MAK11 involved in cell growth and
           replication of M1 dsRNA virus singleton, start by
           similarity
          Length = 390

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 65/131 (49%), Gaps = 13/131 (9%)

Query: 292 IRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFR-- 349
           I     H+  VK L    + L++GS D+ IR+++      + T  GHQ S+ ++   R  
Sbjct: 34  IFHFQAHSLSVKCLDISKRYLVSGSNDENIRIYDLQKRKELGTLLGHQGSITNLRFSRGK 93

Query: 350 ----------KLIVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHPKSFTCFSGSD 398
                     K ++S S D  + VW V+    + TL+GHT  +N   +HP +    S S+
Sbjct: 94  DADGQDIQLNKWLLSASEDHKIIVWRVKDWENFGTLKGHTARINDFDIHPSNRVAVSVSE 153

Query: 399 DMTIRMWDIRT 409
           D +IR+W++ T
Sbjct: 154 DHSIRLWNLMT 164

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 64/162 (39%), Gaps = 31/162 (19%)

Query: 371 CYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLT 430
            +  + H+  V C+ +  +     SGS+D  IR++D++    +    GH G +   +  +
Sbjct: 34  IFHFQAHSLSVKCLDISKRYLV--SGSNDENIRIYDLQKRKELGTLLGHQGSITN-LRFS 90

Query: 431 LGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGA 490
            G D                      +Q   +         LLS S D+ I +W VK   
Sbjct: 91  RGKD-----------------ADGQDIQLNKW---------LLSASEDHKIIVWRVKDWE 124

Query: 491 CIRTQFGHVEGV--WDIAADNFRIVSGSHDRSCKVWDLQTGK 530
              T  GH   +  +DI   N   VS S D S ++W+L T K
Sbjct: 125 NFGTLKGHTARINDFDIHPSNRVAVSVSEDHSIRLWNLMTVK 166

>YLR222C (UTP13) [3622] chr12 complement(579320..581773) Component
           of U3 snoRNP (also called small subunit processome),
           which is required for 18S rRNA biogenesis,
           overproduction causes chromosome instability and
           increased mitotic recombination, contains WD (WD-40)
           repeats [2454 bp, 817 aa]
          Length = 817

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 59/262 (22%), Positives = 99/262 (37%), Gaps = 37/262 (14%)

Query: 297 GHTDGVKALRFDDQKL--ITGSLDKTIRVWNYVTGAC----VSTYRGHQDSVLSV----- 345
           GH D + +L   +  L   T S D T  VW Y   +C     + Y GH  +V +V     
Sbjct: 386 GHEDLLNSLDATEDGLWIATASKDNTAIVWRYNENSCKFDIYAKYIGHSAAVTAVGLPNI 445

Query: 346 --DSFRKLIVSGSADKTVKVWHVESRTC-----------YTLRGHTGWVNCVKLHPKSFT 392
               + + +++ S D T+K W +   T            YT   H   +N + + P    
Sbjct: 446 VSKGYPEFLLTASNDLTIKKWIIPKPTASMDVQIIKVSEYTRHAHEKDINALSVSPNDSI 505

Query: 393 CFSGSDDMTIRMWDIRTNTCVRVFHGH--------VGQVQKVIPLTLGSDLIEXXXXXXX 444
             + S D T ++W++           H          Q  K++  + G   ++       
Sbjct: 506 FATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTF 565

Query: 445 XXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWD 504
                      +VQ  +F   +     L+SC  D  IK+W+  +G C++T  GH   +W 
Sbjct: 566 SVMKTLEGHTNAVQRCSF---INKQKQLISCGADGLIKIWDCSSGECLKTLDGHNNRLWA 622

Query: 505 IAA--DNFRIVSGSHDRSCKVW 524
           ++   D   IVS   D   + W
Sbjct: 623 LSTMNDGDMIVSADADGVFQFW 644

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 60/111 (54%), Gaps = 5/111 (4%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGAC 331
           T SYD T  IW+L  G+L   L+ H  G+  + F   D+ L T S DKT+++W+  T + 
Sbjct: 508 TASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSV 567

Query: 332 VSTYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWHVESRTCY-TLRGHTG 379
           + T  GH ++V   S  + +K ++S  AD  +K+W   S  C  TL GH  
Sbjct: 568 MKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIWDCSSGECLKTLDGHNN 618

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 52/95 (54%), Gaps = 4/95 (4%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDD--QKLITGSLDKTIRVWNYVTGAC 331
           T S D TV IW L T  +++ L GHT+ V+   F +  ++LI+   D  I++W+  +G C
Sbjct: 550 TSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIWDCSSGEC 609

Query: 332 VSTYRGHQDSVLSVDSFR--KLIVSGSADKTVKVW 364
           + T  GH + + ++ +     +IVS  AD   + W
Sbjct: 610 LKTLDGHNNRLWALSTMNDGDMIVSADADGVFQFW 644

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 62/143 (43%), Gaps = 16/143 (11%)

Query: 281 VAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGACVSTYRGH 338
           + I+ L TGK++R +   +     L  D     L  G  D +I V +   G    +++GH
Sbjct: 85  LKIFHLKTGKVVRSMKISSPSY-ILDADSTSTLLAVGGTDGSIIVVDIENGYITHSFKGH 143

Query: 339 QDSVLSVDSFRKL------IVSGSADKTVKVWHVESRTC-YTLRGHTGWVNCVKL----- 386
             ++ S+  + +L      + SG  +  VKVW +  R C +TL+ HT  V  + +     
Sbjct: 144 GGTISSLKFYGQLNSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDIIEVPD 203

Query: 387 -HPKSFTCFSGSDDMTIRMWDIR 408
               S    SG  D  I +WD  
Sbjct: 204 NDEPSLNLLSGGRDDIINLWDFN 226

 Score = 37.4 bits (85), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 23/104 (22%), Positives = 44/104 (42%), Gaps = 14/104 (13%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQ------KLITGSLDKTIRVWNYVT 328
           G  D ++ + D+  G +     GH   + +L+F  Q       L +G  +  ++VW+ V 
Sbjct: 120 GGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWDLVK 179

Query: 329 GACVSTYRGHQDSVLSVDSFRKL--------IVSGSADKTVKVW 364
             C+ T + H  +V  +D             ++SG  D  + +W
Sbjct: 180 RKCLHTLQEHTSAVRGLDIIEVPDNDEPSLNLLSGGRDDIINLW 223

 Score = 37.0 bits (84), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 37/80 (46%), Gaps = 12/80 (15%)

Query: 468 YPTHLLSCSLDNTIKLWNV-KTGACIRTQFGHVE-----------GVWDIAADNFRIVSG 515
           YP  LL+ S D TIK W + K  A +  Q   V                ++ ++    + 
Sbjct: 450 YPEFLLTASNDLTIKKWIIPKPTASMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATA 509

Query: 516 SHDRSCKVWDLQTGKCMHTF 535
           S+D++CK+W+L+ G+   T 
Sbjct: 510 SYDKTCKIWNLENGELEATL 529

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 8/61 (13%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF-----DDQ---KLITGSLDKTIRVWN 325
           +G  +  V +WDL   K +  L  HT  V+ L       +D+    L++G  D  I +W+
Sbjct: 165 SGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDIIEVPDNDEPSLNLLSGGRDDIINLWD 224

Query: 326 Y 326
           +
Sbjct: 225 F 225

>YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in
           the absence of Cin8p, contains WD (WD-40) repeats [1485
           bp, 494 aa]
          Length = 494

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 83/191 (43%), Gaps = 44/191 (23%)

Query: 276 SYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTY 335
           S D TV IWD   G  ++    H+  V+++      +I+GS D T+R+ ++ +G  +S  
Sbjct: 274 SRDQTVKIWDFHNGWSLKTFQPHSQWVRSIDVLGDYIISGSHDTTLRLTHWPSGNGLSVG 333

Query: 336 RGHQDSVLSV-------DS----FR------------KLIVSGSADKTVKVWHV------ 366
            GH+  +  V       DS    FR            +  VS S D+T+K+W +      
Sbjct: 334 TGHEFPIEKVKFIHFIEDSPEIRFRTPSTDRYKNWGMQYCVSASRDRTIKIWEIPLPTLM 393

Query: 367 ------------ESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVR 414
                         R   TL+GH  WV  + +  +    FS +DD ++R WD+ T  C+ 
Sbjct: 394 AHRAPIPNPTDSNFRCVLTLKGHLSWVRDISIRGQYL--FSCADDKSVRCWDLNTGQCLH 451

Query: 415 VFHG-HVGQVQ 424
           V+   H G V 
Sbjct: 452 VWEKLHTGFVN 462

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 68/271 (25%), Positives = 113/271 (41%), Gaps = 46/271 (16%)

Query: 312 LITGSLDKTIRVWNYVTGAC----VSTYRGHQDSVLSVDSFRK----LIVSGSADKTVKV 363
           ++T S D  I V+ +V+  C    + +  GH+  V +V  ++K     I S S D+TVK+
Sbjct: 222 IVTASKDLQIHVFKWVSEECKFQQIRSLLGHEHIVSAVKIWQKNNDVHIASCSRDQTVKI 281

Query: 364 WHVESR-TCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQ 422
           W   +  +  T + H+ WV  + +        SGS D T+R+    +   + V  GH   
Sbjct: 282 WDFHNGWSLKTFQPHSQWVRSIDVLGDYI--ISGSHDTTLRLTHWPSGNGLSVGTGHEFP 339

Query: 423 VQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIK 482
           ++KV  +      IE                   +Q            + +S S D TIK
Sbjct: 340 IEKVKFI----HFIEDSPEIRFRTPSTDRYKNWGMQ------------YCVSASRDRTIK 383

Query: 483 LWNVKTGA-----------------CIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWD 525
           +W +                     C+ T  GH+  V DI+     + S + D+S + WD
Sbjct: 384 IWEIPLPTLMAHRAPIPNPTDSNFRCVLTLKGHLSWVRDISIRGQYLFSCADDKSVRCWD 443

Query: 526 LQTGKCMHTFVGIHAP-VACVGIGDSEFVSG 555
           L TG+C+H +  +H   V C+ + D +F S 
Sbjct: 444 LNTGQCLHVWEKLHTGFVNCLDL-DVDFDSN 473

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 54/244 (22%), Positives = 93/244 (38%), Gaps = 82/244 (33%)

Query: 292 IRRLSGHTDGVKALRF----DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDS 347
           IR L GH   V A++     +D  + + S D+T+++W++  G  + T++ H   V S+D 
Sbjct: 246 IRSLLGHEHIVSAVKIWQKNNDVHIASCSRDQTVKIWDFHNGWSLKTFQPHSQWVRSIDV 305

Query: 348 FRKLIVSGSADKTVKVWHVESRTCYTL-RGHTGWVNCVKL-------------HPKS--- 390
               I+SGS D T+++ H  S    ++  GH   +  VK               P +   
Sbjct: 306 LGDYIISGSHDTTLRLTHWPSGNGLSVGTGHEFPIEKVKFIHFIEDSPEIRFRTPSTDRY 365

Query: 391 -----FTCFSGSDDMTIRMWDIRTNT-----------------CVRVFHGHVGQVQKVIP 428
                  C S S D TI++W+I   T                 CV    GH+  V+ +  
Sbjct: 366 KNWGMQYCVSASRDRTIKIWEIPLPTLMAHRAPIPNPTDSNFRCVLTLKGHLSWVRDI-- 423

Query: 429 LTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKT 488
                                      S++            +L SC+ D +++ W++ T
Sbjct: 424 ---------------------------SIRGQ----------YLFSCADDKSVRCWDLNT 446

Query: 489 GACI 492
           G C+
Sbjct: 447 GQCL 450

>KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces
           cerevisiae YLR129w DIP2 DOM34P-interacting protein,
           start by similarity
          Length = 936

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 64/133 (48%), Gaps = 5/133 (3%)

Query: 278 DSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGACVSTY 335
           D+TV ++   + K    L GH   V ++ F  D + LIT S DK I++W    G C  + 
Sbjct: 543 DNTVKVFFFDSLKFYLSLYGHKLPVLSIDFSVDSKMLITSSADKNIKIWGVDFGDCHKSI 602

Query: 336 RGHQDSVLSV--DSFRKLIVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHPKSFT 392
             HQDS++SV  ++      S   D  VK W  +   C   L GH   V C+ + P   T
Sbjct: 603 FAHQDSIMSVRFEADTHNFFSCGKDGAVKRWDGDKFDCIQKLNGHQSEVWCIAVSPDGRT 662

Query: 393 CFSGSDDMTIRMW 405
             S S D +IR+W
Sbjct: 663 VVSTSHDHSIRVW 675

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 55/235 (23%), Positives = 90/235 (38%), Gaps = 53/235 (22%)

Query: 311 KLITGSLDKTIRVWNYVTGACVSTYRG----------HQDSVLSVDSFRK---LIVSGSA 357
           KLITG+L+  I++W   T        G           + SV++   F K   L+  G  
Sbjct: 35  KLITGALE-NIQIWTLKTNEVEVLTDGLPIGAVETNISKPSVVTAMCFHKETELLCVGYE 93

Query: 358 DKTVKVWHVESRTCYT-LRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVF 416
           D  +KVW + S++      GH   V  ++L  +     SGS D  + +WD+     +   
Sbjct: 94  DGVIKVWDLLSKSVLMQFNGHKSGVTVLRLDSEGTRLVSGSKDSDLIIWDLVGEVGLMKL 153

Query: 417 HGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCS 476
             H                                    ++     DH++ +   L+S +
Sbjct: 154 RSH----------------------------------KDAITGIWIDHNMDW---LISVA 176

Query: 477 LDNTIKLWNVKTGA-CIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGK 530
            D  IK+W++K G  C+ T   H    W +A D   I++ S D   K+W+L   K
Sbjct: 177 KDGLIKVWDLKAGGQCVETHMAHTGQCWSMAIDEEVIITTSMDSQAKIWELDLEK 231

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 62/281 (22%), Positives = 110/281 (39%), Gaps = 29/281 (10%)

Query: 294 RLSGHTDGVKALRF-DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKLI 352
            L GH   ++++   DD KL++ + +  ++VWN  T  C+ T+         +     L+
Sbjct: 378 ELQGHRTDIRSMDISDDGKLLSTASNGELKVWNLTTKKCIRTFSCGYALCSQMLPGGLLV 437

Query: 353 VSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNT 411
           V G+    ++++ + S T   T   HT  +  + L        +GS D + + WD     
Sbjct: 438 VVGTRQGELQLFDLASSTLLSTTEAHTAAIWSLDLTSNGKRLVTGSADKSCKFWDFEV-- 495

Query: 412 CVRVFHG----HVGQVQKVIPLTLG-SDLIEXXXXXXXXXXXXXXXXXXSVQAANFD--- 463
             ++  G    ++ Q++ V   TL  +D I                   +V+   FD   
Sbjct: 496 VEQLVPGTKDKYIPQLKLVHDTTLELTDDILAVKISSEDRYLAVSLLDNTVKVFFFDSLK 555

Query: 464 -------HSLPYPT--------HLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDI--A 506
                  H LP  +         L++ S D  IK+W V  G C ++ F H + +  +   
Sbjct: 556 FYLSLYGHKLPVLSIDFSVDSKMLITSSADKNIKIWGVDFGDCHKSIFAHQDSIMSVRFE 615

Query: 507 ADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGI 547
           AD     S   D + K WD     C+    G  + V C+ +
Sbjct: 616 ADTHNFFSCGKDGAVKRWDGDKFDCIQKLNGHQSEVWCIAV 656

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 66/274 (24%), Positives = 103/274 (37%), Gaps = 62/274 (22%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNY-VTGAC 331
           G+    + ++DLA+  L+     HT  + +L    + ++L+TGS DK+ + W++ V    
Sbjct: 440 GTRQGELQLFDLASSTLLSTTEAHTAAIWSLDLTSNGKRLVTGSADKSCKFWDFEVVEQL 499

Query: 332 V---------------STYRGHQDSVLSV--DSFRKLIVSGSADKTVKVWHVESRTCY-T 373
           V                T     D +L+V   S  + +     D TVKV+  +S   Y +
Sbjct: 500 VPGTKDKYIPQLKLVHDTTLELTDDILAVKISSEDRYLAVSLLDNTVKVFFFDSLKFYLS 559

Query: 374 LRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGS 433
           L GH   V  +     S    + S D  I++W +    C +    H              
Sbjct: 560 LYGHKLPVLSIDFSVDSKMLITSSADKNIKIWGVDFGDCHKSIFAH-------------- 605

Query: 434 DLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTH-LLSCSLDNTIKLWNVKTGACI 492
                                 S+ +  F+      TH   SC  D  +K W+     CI
Sbjct: 606 --------------------QDSIMSVRFEAD----THNFFSCGKDGAVKRWDGDKFDCI 641

Query: 493 RTQFGHVEGVWDIAA--DNFRIVSGSHDRSCKVW 524
           +   GH   VW IA   D   +VS SHD S +VW
Sbjct: 642 QKLNGHQSEVWCIAVSPDGRTVVSTSHDHSIRVW 675

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 68/139 (48%), Gaps = 8/139 (5%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQ--KLITGSLDKTIRVWNYVTGACV 332
           G  D  + +WDL +  ++ + +GH  GV  LR D +  +L++GS D  + +W+ V    +
Sbjct: 91  GYEDGVIKVWDLLSKSVLMQFNGHKSGVTVLRLDSEGTRLVSGSKDSDLIIWDLVGEVGL 150

Query: 333 STYRGHQDSVLS--VDSFRKLIVSGSADKTVKVWHVES--RTCYTLRGHTGWVNCVKLHP 388
              R H+D++    +D     ++S + D  +KVW +++  +   T   HTG   C  +  
Sbjct: 151 MKLRSHKDAITGIWIDHNMDWLISVAKDGLIKVWDLKAGGQCVETHMAHTG--QCWSMAI 208

Query: 389 KSFTCFSGSDDMTIRMWDI 407
                 + S D   ++W++
Sbjct: 209 DEEVIITTSMDSQAKIWEL 227

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 78/171 (45%), Gaps = 21/171 (12%)

Query: 274 TGSYDSTVAIWDLAT---------GKLIRRLS-------GHTDGVKALRF--DDQKLITG 315
           TGS D +   WD             K I +L          TD + A++   +D+ L   
Sbjct: 481 TGSADKSCKFWDFEVVEQLVPGTKDKYIPQLKLVHDTTLELTDDILAVKISSEDRYLAVS 540

Query: 316 SLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSF--RKLIVSGSADKTVKVWHVESRTCY- 372
            LD T++V+ + +     +  GH+  VLS+D     K++++ SADK +K+W V+   C+ 
Sbjct: 541 LLDNTVKVFFFDSLKFYLSLYGHKLPVLSIDFSVDSKMLITSSADKNIKIWGVDFGDCHK 600

Query: 373 TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQV 423
           ++  H   +  V+    +   FS   D  ++ WD     C++  +GH  +V
Sbjct: 601 SIFAHQDSIMSVRFEADTHNFFSCGKDGAVKRWDGDKFDCIQKLNGHQSEV 651

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 55/121 (45%), Gaps = 5/121 (4%)

Query: 252 IQEFKGHMDGVXXXXXXX--XXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDD 309
           + +F GH  GV             +GS DS + IWDL     + +L  H D +  +  D 
Sbjct: 108 LMQFNGHKSGVTVLRLDSEGTRLVSGSKDSDLIIWDLVGEVGLMKLRSHKDAITGIWIDH 167

Query: 310 QK--LITGSLDKTIRVWNYVTGA-CVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHV 366
               LI+ + D  I+VW+   G  CV T+  H     S+    ++I++ S D   K+W +
Sbjct: 168 NMDWLISVAKDGLIKVWDLKAGGQCVETHMAHTGQCWSMAIDEEVIITTSMDSQAKIWEL 227

Query: 367 E 367
           +
Sbjct: 228 D 228

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 44/96 (45%), Gaps = 4/96 (4%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGAC 331
           T S D  + IW +  G   + +  H D + ++RF  D     +   D  ++ W+     C
Sbjct: 581 TSSADKNIKIWGVDFGDCHKSIFAHQDSIMSVRFEADTHNFFSCGKDGAVKRWDGDKFDC 640

Query: 332 VSTYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWH 365
           +    GHQ  V  ++V    + +VS S D +++VW 
Sbjct: 641 IQKLNGHQSEVWCIAVSPDGRTVVSTSHDHSIRVWQ 676

>Scas_679.28
          Length = 815

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 61/110 (55%), Gaps = 7/110 (6%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGAC 331
           T SYD T  IWDL  G+L   LS H  G+  + F   D+ + T S DKTI++W+  T + 
Sbjct: 508 TASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDKLIATCSGDKTIKIWSLDTFSV 567

Query: 332 VSTYRGHQDSV---LSVDSFRKLIVSGSADKTVKVWHVESRTCY-TLRGH 377
           + T  GH ++V   + ++   +L+ SG AD  +K+W   +  C  TL GH
Sbjct: 568 MKTLEGHTNAVQRCMFINKQLQLVSSG-ADGLIKIWDCSTGDCLKTLDGH 616

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 61/271 (22%), Positives = 98/271 (36%), Gaps = 43/271 (15%)

Query: 292 IRRLSGHTDGVKALRFDDQKL--ITGSLDKTIRVWNYVTGACVSTYR------GHQDSVL 343
           +    GH D + +L   D  L   T S D T  VW Y   + ++ ++      GH  +V 
Sbjct: 379 VEMYEGHEDLLNSLDTTDDGLWMATASKDHTAIVWKY--NSIINKFQPYVKFIGHSATVT 436

Query: 344 SVD-------SFRKLIVSGSADKTVKVWHVESRTC-------------YTLRGHTGWVNC 383
           +V         + + +++ S D T+K W +   +              YT R H   +N 
Sbjct: 437 AVGLPNVMLRGYPEFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINA 496

Query: 384 VKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGH--------VGQVQKVIPLTLGSDL 435
           + + P      + S D T ++WD+           H          Q  K+I    G   
Sbjct: 497 LAISPNDSIFATASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDKLIATCSGDKT 556

Query: 436 IEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQ 495
           I+                  +VQ   F   +     L+S   D  IK+W+  TG C++T 
Sbjct: 557 IKIWSLDTFSVMKTLEGHTNAVQRCMF---INKQLQLVSSGADGLIKIWDCSTGDCLKTL 613

Query: 496 FGHVEGVWDIAA--DNFRIVSGSHDRSCKVW 524
            GH   +W +    D   IVS   D   + W
Sbjct: 614 DGHDNRIWALTEINDGDMIVSADADGVFQFW 644

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 59/130 (45%), Gaps = 18/130 (13%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK------LITGSLDKTIRVWNYVT 328
           G  D ++ + D+  G +   L GH   + AL+F  Q       L +G  +  ++VW+ V 
Sbjct: 124 GGTDGSITVVDIENGFITHSLKGHGATISALKFFGQANSNVWLLCSGDTNGMVKVWDLVK 183

Query: 329 GACVSTYRGHQDSVLSVDSFRKL-----IVSGSADKTVKVWHVESRTCYTLRGHTGWVNC 383
             C+ T + H ++V  +D  R++     ++SG  D    +W+      + L+     +  
Sbjct: 184 RKCLHTMQEHSNAVRGLD-VREVGDEWQLISGGRDNVCTLWN------FNLKKKCTLLKT 236

Query: 384 VKLHPKSFTC 393
           + +H +  +C
Sbjct: 237 IPVHQQVESC 246

 Score = 37.0 bits (84), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 34/82 (41%), Gaps = 14/82 (17%)

Query: 468 YPTHLLSCSLDNTIKLWN--------------VKTGACIRTQFGHVEGVWDIAADNFRIV 513
           YP  LL+ S D TIK W               VK     R           I+ ++    
Sbjct: 448 YPEFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINALAISPNDSIFA 507

Query: 514 SGSHDRSCKVWDLQTGKCMHTF 535
           + S+D++CK+WDL+ G+   T 
Sbjct: 508 TASYDKTCKIWDLENGELTATL 529

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 37/87 (42%), Gaps = 8/87 (9%)

Query: 473 LSCSLDNT--IKLWNVKTGACIRTQFGHVEGVWDI----AADNFRIVSGSHDRSCKVWDL 526
           L CS D    +K+W++    C+ T   H   V  +      D ++++SG  D  C +W+ 
Sbjct: 166 LLCSGDTNGMVKVWDLVKRKCLHTMQEHSNAVRGLDVREVGDEWQLISGGRDNVCTLWNF 225

Query: 527 QTGK--CMHTFVGIHAPVACVGIGDSE 551
              K   +   + +H  V   G  + E
Sbjct: 226 NLKKKCTLLKTIPVHQQVESCGFINHE 252

>CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP, hypothetical start
          Length = 500

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 64/268 (23%), Positives = 111/268 (41%), Gaps = 19/268 (7%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGAC 331
           +GS++  V+I D  T ++ + L  H   V  + +  +D  LITG  D  I V N   G  
Sbjct: 229 SGSWNGEVSIIDSNTLEVTQTLQNHDGKVGGIAWTSNDSVLITGGEDHLITVSNRSDGEF 288

Query: 332 VSTYR--GHQDSV--LSVDSFRKLIVSGSADKTVKVWHVESRTCYTLR-GHTGWVNCVKL 386
           +++    GH+  +  L V    K I + S D T ++W +E +    L+ GH+  + C+  
Sbjct: 289 ITSNSIGGHEGRITDLQVHPSGKFIGTSSFDSTWRLWDIEKQKQLLLQEGHSKELYCLAF 348

Query: 387 HPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQ--------KVIPLTLGSDLIEX 438
                   +   D T  +WD+R+   V    GH   +           +    G  +I  
Sbjct: 349 QADGALVSTAGTDKTAIIWDLRSGKAVSQLQGHAKTIYCMDWSIDGHTLATGGGDGVITI 408

Query: 439 XXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGH 498
                             V +  FD +  +  +L+S   D +I +++      + +  GH
Sbjct: 409 WDLRKSDKLTKITEHKSIVTSLKFDKANDH--NLISSGYDRSIFVYSKDNYLKVSSLIGH 466

Query: 499 VEGV--WDIAADNFRIVSGSHDRSCKVW 524
            + V  +DI  +N  ++SG  DRS K W
Sbjct: 467 ADKVLTFDIDKNNKNLISGGWDRSVKHW 494

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 53/100 (53%), Gaps = 5/100 (5%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFD---DQKLITGSLDKTIRVWNYVTGA 330
           TG  D  + IWDL     + +++ H   V +L+FD   D  LI+   D++I V++     
Sbjct: 399 TGGGDGVITIWDLRKSDKLTKITEHKSIVTSLKFDKANDHNLISSGYDRSIFVYSKDNYL 458

Query: 331 CVSTYRGHQDSVLS--VDSFRKLIVSGSADKTVKVWHVES 368
            VS+  GH D VL+  +D   K ++SG  D++VK W   S
Sbjct: 459 KVSSLIGHADKVLTFDIDKNNKNLISGGWDRSVKHWSTVS 498

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 42/81 (51%), Gaps = 2/81 (2%)

Query: 467 PYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA--ADNFRIVSGSHDRSCKVW 524
           P    + + S D+T +LW+++    +  Q GH + ++ +A  AD   + +   D++  +W
Sbjct: 308 PSGKFIGTSSFDSTWRLWDIEKQKQLLLQEGHSKELYCLAFQADGALVSTAGTDKTAIIW 367

Query: 525 DLQTGKCMHTFVGIHAPVACV 545
           DL++GK +    G    + C+
Sbjct: 368 DLRSGKAVSQLQGHAKTIYCM 388

>Scas_558.3
          Length = 725

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 73/147 (49%), Gaps = 10/147 (6%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGV---KALRFDDQKLITGSLDKTIRVWNYVTGA 330
           +GS+D+T  +W    G L   L GH   V   K +  ++   IT S D+T+++W      
Sbjct: 118 SGSWDTTAKVW--INGALQWSLEGHQASVWDAKIISVEENTFITASADRTVKLWK--ENK 173

Query: 331 CVSTYRG-HQDSVLSVD--SFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLH 387
            + T+ G H D + +++  S  K I + S D T+K+  ++      L GH  +V  VKL 
Sbjct: 174 LLKTFSGIHSDVIRNIEVLSSGKEIATCSNDGTIKISDLDGNIKQVLSGHESFVYNVKLS 233

Query: 388 PKSFTCFSGSDDMTIRMWDIRTNTCVR 414
            +     S  +D ++R+WDI  N  ++
Sbjct: 234 KQGDKLVSCGEDRSLRIWDINNNFNIK 260

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/213 (22%), Positives = 90/213 (42%), Gaps = 48/213 (22%)

Query: 334 TYRGHQDSVLSVDSFRKL--IVSGSADKTVKVWHVESRTCYTLRGHTGWV-NCVKLHPKS 390
           T  GH  +V ++ S++ +  I+SGS D T KVW +     ++L GH   V +   +  + 
Sbjct: 97  TLIGHHSNVCAL-SYKHMSAIISGSWDTTAKVW-INGALQWSLEGHQASVWDAKIISVEE 154

Query: 391 FTCFSGSDDMTIRMWDIRTNTCVRVFHG-HVGQVQKVIPLTLGSDLIEXXXXXXXXXXXX 449
            T  + S D T+++W  + N  ++ F G H   ++ +  L+ G +               
Sbjct: 155 NTFITASADRTVKLW--KENKLLKTFSGIHSDVIRNIEVLSSGKE--------------- 197

Query: 450 XXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDI--AA 507
                                 + +CS D TIK+ ++  G   +   GH   V+++  + 
Sbjct: 198 ----------------------IATCSNDGTIKISDLD-GNIKQVLSGHESFVYNVKLSK 234

Query: 508 DNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHA 540
              ++VS   DRS ++WD+     +   + + A
Sbjct: 235 QGDKLVSCGEDRSLRIWDINNNFNIKQVIKLPA 267

>Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement
          Length = 760

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 71/159 (44%), Gaps = 17/159 (10%)

Query: 244 NWRKGIYRIQEFKGHMDGVXXXXXXXXXXXTGS---YDSTVAIWDLATGKLIRRLSGH-T 299
           NW K     Q F+GH   V           T +    D TV IW L        ++ H T
Sbjct: 7   NWEKNWALEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQQSPNFTMTAHET 66

Query: 300 DGVKALRF----DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFR---KLI 352
            GV  + +    D   LIT S D+++++W+Y T +CV+T  GH  +V S   F     +I
Sbjct: 67  RGVNFVDYYPLQDKPYLITSSDDRSVKIWDYQTKSCVATLEGHMANV-SYAIFHPSLPII 125

Query: 353 VSGSADKTVKVWHVES---RTCYTLRGHTGWVNCVKLHP 388
           +SGS D TVK+W+  +        L     W  CV  HP
Sbjct: 126 ISGSEDGTVKIWNANTYKLEKTLNLGLERSW--CVAAHP 162

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 81/196 (41%), Gaps = 45/196 (22%)

Query: 320 TIRVWNYVTG-ACVSTYRGHQDSVLSVDSFRK---LIVSGSADKTVKVWHV-ESRTCYTL 374
           TI++WN+    A   T+ GH+  V+ V    K      S   D TVK+W + +    +T+
Sbjct: 2   TIKLWNWEKNWALEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQQSPNFTM 61

Query: 375 RGH-TGWVNCVKLHPKSFTCF--SGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTL 431
             H T  VN V  +P     +  + SDD ++++WD +T +CV    GH+  V   I    
Sbjct: 62  TAHETRGVNFVDYYPLQDKPYLITSSDDRSVKIWDYQTKSCVATLEGHMANVSYAI---- 117

Query: 432 GSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGAC 491
                                         F  SLP    ++S S D T+K+WN  T   
Sbjct: 118 ------------------------------FHPSLPI---IISGSEDGTVKIWNANTYKL 144

Query: 492 IRTQFGHVEGVWDIAA 507
            +T    +E  W +AA
Sbjct: 145 EKTLNLGLERSWCVAA 160

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 67/140 (47%), Gaps = 10/140 (7%)

Query: 280 TVAIWDLATG-KLIRRLSGHTDGVKALRF---DDQKLITGSLDKTIRVWNYVTGACVSTY 335
           T+ +W+      L +   GH   V  + F   D     +  LD T+++W+    +   T 
Sbjct: 2   TIKLWNWEKNWALEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQQSPNFTM 61

Query: 336 RGHQD-SVLSVDSF----RKLIVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHPK 389
             H+   V  VD +    +  +++ S D++VK+W  ++++C  TL GH   V+    HP 
Sbjct: 62  TAHETRGVNFVDYYPLQDKPYLITSSDDRSVKIWDYQTKSCVATLEGHMANVSYAIFHPS 121

Query: 390 SFTCFSGSDDMTIRMWDIRT 409
                SGS+D T+++W+  T
Sbjct: 122 LPIIISGSEDGTVKIWNANT 141

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 74/181 (40%), Gaps = 39/181 (21%)

Query: 360 TVKVWHVESRTCY--TLRGHTGWVNCVKLHPKSFTCF-SGSDDMTIRMWDIRTNTCVRVF 416
           T+K+W+ E       T  GH  +V CV  +PK    F S   D T+++W +   +     
Sbjct: 2   TIKLWNWEKNWALEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQQSPNFTM 61

Query: 417 HGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCS 476
             H          T G + ++                          + L    +L++ S
Sbjct: 62  TAHE---------TRGVNFVDY-------------------------YPLQDKPYLITSS 87

Query: 477 LDNTIKLWNVKTGACIRTQFGHVEGV-WDIAADNFRIV-SGSHDRSCKVWDLQTGKCMHT 534
            D ++K+W+ +T +C+ T  GH+  V + I   +  I+ SGS D + K+W+  T K   T
Sbjct: 88  DDRSVKIWDYQTKSCVATLEGHMANVSYAIFHPSLPIIISGSEDGTVKIWNANTYKLEKT 147

Query: 535 F 535
            
Sbjct: 148 L 148

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 5/80 (6%)

Query: 469 PTHLLSCSLDNTIKLWNVKTGACIRTQFGH-VEGV----WDIAADNFRIVSGSHDRSCKV 523
           P    S  LD+T+K+W++   +   T   H   GV    +    D   +++ S DRS K+
Sbjct: 35  PNTFASACLDHTVKIWSLGQQSPNFTMTAHETRGVNFVDYYPLQDKPYLITSSDDRSVKI 94

Query: 524 WDLQTGKCMHTFVGIHAPVA 543
           WD QT  C+ T  G  A V+
Sbjct: 95  WDYQTKSCVATLEGHMANVS 114

>Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement
          Length = 263

 Score = 60.8 bits (146), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 67/137 (48%), Gaps = 6/137 (4%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFD--DQKLITGSLDKTIRVWNYVTGACV 332
           G  D  + IWDL +  ++   +GH   +  LRFD    +LI+GS D  I +W+ V    +
Sbjct: 93  GYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGL 152

Query: 333 STYRGHQDSVLSV-DSFRKLIVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHPKS 390
              R H+DS+  +       ++S S D  +K+W ++++ C  T   HT    C  L   +
Sbjct: 153 YKLRSHKDSITGIWCENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTS--ECWGLAIHN 210

Query: 391 FTCFSGSDDMTIRMWDI 407
               + S +  I++W++
Sbjct: 211 DLVITTSTESQIKIWNL 227

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/260 (22%), Positives = 93/260 (35%), Gaps = 66/260 (25%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVS 333
           TG+ ++ V  WD+ TG+L + L   TDG+     D +                 T    S
Sbjct: 39  TGALEN-VNCWDIKTGELSKIL---TDGLPPGAVDAKS----------------TKLAES 78

Query: 334 TYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHPKSFT 392
           TY  +            L+  G AD  +K+W + S+T      GH   +  ++  P    
Sbjct: 79  TYLQYHPET-------NLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTR 131

Query: 393 CFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXX 452
             SGS D  I +WD+     +     H   +                             
Sbjct: 132 LISGSKDSDIIIWDLVGEVGLYKLRSHKDSI----------------------------- 162

Query: 453 XXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFRI 512
               +   N D        L+S S D  IK+W++KT  C+ T   H    W +A  N  +
Sbjct: 163 --TGIWCENEDW-------LISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHNDLV 213

Query: 513 VSGSHDRSCKVWDLQTGKCM 532
           ++ S +   K+W+L   K M
Sbjct: 214 ITTSTESQIKIWNLDLDKDM 233

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/154 (22%), Positives = 64/154 (41%), Gaps = 42/154 (27%)

Query: 384 VKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXX 443
           ++ HP++     G  D  I++WD+ + T +  F+GH                        
Sbjct: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGH------------------------ 116

Query: 444 XXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNV--KTGAC-IRTQFGHVE 500
                       ++    FD   P  T L+S S D+ I +W++  + G   +R+    + 
Sbjct: 117 ----------KSAITVLRFD---PTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSIT 163

Query: 501 GVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHT 534
           G+W    +   ++S S D   K+WDL+T +C+ T
Sbjct: 164 GIW--CENEDWLISTSKDGLIKIWDLKTQQCVET 195

>AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH]
           complement(1256750..1258087) [1338 bp, 445 aa]
          Length = 445

 Score = 61.6 bits (148), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 76/342 (22%), Positives = 127/342 (37%), Gaps = 107/342 (31%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF-DDQKLITGSLDKTIRVW-------- 324
           +GSYD  V  W+L +GK+ ++ SGHT  V+A++F    +L++G  D+T+R+W        
Sbjct: 118 SGSYDGVVRTWNL-SGKIEKQYSGHTGAVRAVKFISSTRLVSGGNDRTLRLWKTKNDDVK 176

Query: 325 --NYVTGA----CVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHT 378
             + + G      ++   GHQ  V+SVD     I+S S D ++  W    +        T
Sbjct: 177 HVDELEGTEEAHTLAILEGHQAPVVSVDVQGDRILSASYDNSIGFWSTNHKDM------T 230

Query: 379 GWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEX 438
                  L  K+ +       +T++   +R    + +   H   V++VI           
Sbjct: 231 AVDPMDSLGDKASSAAKKRRKLTMKDGSVRRRAPLSLLESHKAPVEQVI----------- 279

Query: 439 XXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQ--- 495
                                A+ D ++ Y     S S D+TIK W++ T  C+ T+   
Sbjct: 280 --------------------FASNDSTVAY-----SVSQDHTIKTWDLVTSRCVDTKSTS 314

Query: 496 ------------------------------------------FGHVEGV--WDIAADN-F 510
                                                      GH   V   D   +N +
Sbjct: 315 YSLLSMVELPKLRLLACGSSARHITLHDPRADSSAKITQQQLLGHKNFVVALDTCPENEY 374

Query: 511 RIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGIGDSEF 552
            + S SHD + KVWD+++   ++T       V   GI D  F
Sbjct: 375 MLCSASHDGTVKVWDIRSSSSIYTITREDQSVEK-GINDKVF 415

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 39/73 (53%), Gaps = 1/73 (1%)

Query: 338 HQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGS 397
           ++D V ++D   + IVSGS D  V+ W++  +      GHTG V  VK    S    SG 
Sbjct: 102 NEDWVSALDVGAERIVSGSYDGVVRTWNLSGKIEKQYSGHTGAVRAVKF-ISSTRLVSGG 160

Query: 398 DDMTIRMWDIRTN 410
           +D T+R+W  + +
Sbjct: 161 NDRTLRLWKTKND 173

 Score = 32.7 bits (73), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 44/99 (44%), Gaps = 16/99 (16%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA-ADNFRIVSGSHDRSCKVW------ 524
           ++S S D  ++ WN+ +G   +   GH   V  +    + R+VSG +DR+ ++W      
Sbjct: 116 IVSGSYDGVVRTWNL-SGKIEKQYSGHTGAVRAVKFISSTRLVSGGNDRTLRLWKTKNDD 174

Query: 525 -----DLQTGKCMHTFV---GIHAPVACVGIGDSEFVSG 555
                +L+  +  HT     G  APV  V +     +S 
Sbjct: 175 VKHVDELEGTEEAHTLAILEGHQAPVVSVDVQGDRILSA 213

>YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein
           essential for replication of M double-stranded RNA
           (dsRNA) virus, member of the WD (WD-40) repeat family
           [1407 bp, 468 aa]
          Length = 468

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 64/136 (47%), Gaps = 18/136 (13%)

Query: 292 IRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSV------ 345
           I     H+  +K L    + L++GS D+ IR+++      + T   HQ S+ ++      
Sbjct: 99  IFHFQAHSLSIKCLAVSRRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALQFSHPA 158

Query: 346 -----------DSFRKLIVSGSADKTVKVWHVES-RTCYTLRGHTGWVNCVKLHPKSFTC 393
                          K ++S S D  + VW V+   T  TL+GHT  VN V +HP +   
Sbjct: 159 SSSEDAAVSKGSKNSKWLLSASEDHKIMVWRVKDWETVGTLKGHTARVNDVDIHPTNRIA 218

Query: 394 FSGSDDMTIRMWDIRT 409
            S SDD +IR+W++ T
Sbjct: 219 ISVSDDHSIRLWNLMT 234

 Score = 37.0 bits (84), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 48/108 (44%), Gaps = 16/108 (14%)

Query: 335 YRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKL-HPKSFT 392
           ++ H  S+  +   R+ +VSGS D+ ++++ ++ R    TL  H G +  ++  HP S +
Sbjct: 102 FQAHSLSIKCLAVSRRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALQFSHPASSS 161

Query: 393 --------------CFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKV 426
                           S S+D  I +W ++    V    GH  +V  V
Sbjct: 162 EDAAVSKGSKNSKWLLSASEDHKIMVWRVKDWETVGTLKGHTARVNDV 209

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGV--WDIAADNFRIVSGSHDRSCKVWDLQT 528
           LLS S D+ I +W VK    + T  GH   V   DI   N   +S S D S ++W+L T
Sbjct: 176 LLSASEDHKIMVWRVKDWETVGTLKGHTARVNDVDIHPTNRIAISVSDDHSIRLWNLMT 234

>Scas_631.17
          Length = 474

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 61/233 (26%), Positives = 95/233 (40%), Gaps = 47/233 (20%)

Query: 305 LRFDDQKLITGSLDKTIRVWNYVTGACVS-TYRGHQDSV--LSVDSFRKLIVSGSADKTV 361
           L  D+    TGS    I++ +  T   +S    GH   +  L+ +S    +VSG+ D  V
Sbjct: 194 LMSDNALCATGSWAGDIKILDTKTLDVISGIENGHDGKIGGLAWNSTNTHLVSGADDCLV 253

Query: 362 KVWHVES-----RTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVF 416
           K+   +      +    L+GHTG V  V  HP      S S DMT R+WDI + T ++  
Sbjct: 254 KIHSFDPDVKIIKELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQ 313

Query: 417 HGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCS 476
            GH    ++V  L+  +D                                     L S  
Sbjct: 314 EGH---GKEVYSLSFQND----------------------------------GALLCSGG 336

Query: 477 LDNTIKLWNVKTGACIRTQFGHVEGVW--DIAADNFRIVSGSHDRSCKVWDLQ 527
           LDN   +W+V+TG  I    GH + ++  D + D + I +G  D    +WD++
Sbjct: 337 LDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGGGDGVINIWDIR 389

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 64/271 (23%), Positives = 110/271 (40%), Gaps = 22/271 (8%)

Query: 274 TGSYDSTVAIWDLATGKLIRRL-SGHTDGVKALRFD--DQKLITGSLDKTIRVWNYVTGA 330
           TGS+   + I D  T  +I  + +GH   +  L ++  +  L++G+ D  +++ ++    
Sbjct: 203 TGSWAGDIKILDTKTLDVISGIENGHDGKIGGLAWNSTNTHLVSGADDCLVKIHSFDPDV 262

Query: 331 CV----STYRGHQDSVLSVD--SFRKLIVSGSADKTVKVWHVESRTCYTLR-GHTGWVNC 383
            +    +  +GH   V++VD     + + S S D T ++W +ES T    + GH   V  
Sbjct: 263 KIIKELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQEGHGKEVYS 322

Query: 384 VKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKV--------IPLTLGSDL 435
           +          SG  D    +WD+RT   +    GH   +  V        I    G  +
Sbjct: 323 LSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGGGDGV 382

Query: 436 IEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQ 495
           I                    V    F  S  +   L+SC  D  I++++      ++T 
Sbjct: 383 INIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHC--LVSCGYDKQIRIYSSDNWIQVKTL 440

Query: 496 FGHVEGVW--DIAADNFRIVSGSHDRSCKVW 524
            GH + +   DI+ D   IVS   DRS K+W
Sbjct: 441 EGHTDKILDVDISEDAQLIVSSGWDRSLKLW 471

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 48/99 (48%), Gaps = 5/99 (5%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK---LITGSLDKTIRVWNYVTGA 330
           TG  D  + IWD+       RL  H + V  +RF       L++   DK IR+++     
Sbjct: 376 TGGGDGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSDNWI 435

Query: 331 CVSTYRGHQDSVLSVDSFR--KLIVSGSADKTVKVWHVE 367
            V T  GH D +L VD     +LIVS   D+++K+W  E
Sbjct: 436 QVKTLEGHTDKILDVDISEDAQLIVSSGWDRSLKLWKQE 474

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 42/81 (51%), Gaps = 2/81 (2%)

Query: 467 PYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA--ADNFRIVSGSHDRSCKVW 524
           P    + S S D T +LW++++   ++ Q GH + V+ ++   D   + SG  D +  VW
Sbjct: 285 PSGRFVASASFDMTWRLWDIESETELQFQEGHGKEVYSLSFQNDGALLCSGGLDNAAIVW 344

Query: 525 DLQTGKCMHTFVGIHAPVACV 545
           D++TGK +    G   P+  V
Sbjct: 345 DVRTGKSIMNLQGHAKPIYSV 365

>CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein, start by similarity
          Length = 457

 Score = 61.6 bits (148), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 77/350 (22%), Positives = 130/350 (37%), Gaps = 113/350 (32%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF-DDQKLITGSLDKTIRVW-------- 324
           +GSYD  V  W+++ GK+ ++ SGHT  VKA+++  + ++++   D+++R+W        
Sbjct: 120 SGSYDGVVRTWNMS-GKVEKQYSGHTGAVKAVKYISNTRIVSAGNDRSLRLWKTKNDDGS 178

Query: 325 ------------NYVTGACVSTYRGHQDSVLSVD-SFRKLIVSGSADKTVKVWHVESRTC 371
                       N   G  ++   GH+  V+S+D +    I+S S D TV +W     T 
Sbjct: 179 VSNNTGDENDEENIEDGKTLAILEGHKAPVVSLDVASNSRILSASYDNTVALW----STI 234

Query: 372 YTLRGHTGWVNCVK-LHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLT 430
           Y        +  ++  + K  T       +T++   IR    + +   H G V++VI   
Sbjct: 235 YKEMTAIDHLEEIQNPNNKISTAAKKRRKLTLKDGTIRRRAPLSLLESHTGPVEQVI--- 291

Query: 431 LGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGA 490
                                          FDH     T   S S D+TIK W++ T  
Sbjct: 292 -------------------------------FDHG--DNTVGYSVSQDHTIKTWDLVTAR 318

Query: 491 CIRTQ---------------------------------------------FGH---VEGV 502
           CI T+                                              GH   V G+
Sbjct: 319 CIDTKTTSYPLLSIAQMPTLNLLACGSSVRHITLHDPRVSSSAKITQKQLVGHKNFVVGL 378

Query: 503 WDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGIGDSEF 552
              + + + + S SHD + KVWD+++   M+T      P    G+ D  F
Sbjct: 379 DTCSENEYLLCSASHDGTVKVWDVRSTSPMYTITR-QDPTVEKGVNDKVF 427

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 50/217 (23%), Positives = 79/217 (36%), Gaps = 35/217 (16%)

Query: 346 DSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMW 405
           D FR  I SGS D  V+ W++  +      GHTG V  VK +  +    S  +D ++R+W
Sbjct: 113 DDFRH-IYSGSYDGVVRTWNMSGKVEKQYSGHTGAVKAVK-YISNTRIVSAGNDRSLRLW 170

Query: 406 --------------------DIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXX 445
                               +I     + +  GH      V+ L + S+           
Sbjct: 171 KTKNDDGSVSNNTGDENDEENIEDGKTLAILEGHKA---PVVSLDVASNS-RILSASYDN 226

Query: 446 XXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTG--------ACIRTQFG 497
                      + A +    +  P + +S +     KL  +K G        + + +  G
Sbjct: 227 TVALWSTIYKEMTAIDHLEEIQNPNNKISTAAKKRRKL-TLKDGTIRRRAPLSLLESHTG 285

Query: 498 HVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHT 534
            VE V     DN    S S D + K WDL T +C+ T
Sbjct: 286 PVEQVIFDHGDNTVGYSVSQDHTIKTWDLVTARCIDT 322

>Kwal_26.8953
          Length = 458

 Score = 61.2 bits (147), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 74/301 (24%), Positives = 119/301 (39%), Gaps = 54/301 (17%)

Query: 292 IRRLSGHTDGVKAL--RFDDQK---LITGSLDKTIRVWNYVTGAC--VSTYRGHQDSVLS 344
           +  +  H  G+ ++    DD     + T S D   +V+  +      V T+ GH+  V  
Sbjct: 164 VASVQAHMRGITSIDVHIDDDSQCFVATASKDLHCKVFRLINSELQLVRTFSGHEHIVSH 223

Query: 345 VDSFRK----LIVSGSADKTVKVWHVES-RTCYTLRGHTGWVNCVKLHPKSFTCFSGSDD 399
           +  ++     L+ S S D T K+  V +     + + H  WV  + +  +     +GS+D
Sbjct: 224 IKIWKNATDTLVASCSRDLTCKIGDVSNGYFLKSFQPHAEWVRSLDIMGEYI--ITGSND 281

Query: 400 MTIRMWDIRTNTCVRVFHGHVGQVQ--KVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSV 457
            T+R+    T   +    GH   V+  K+IP+ L                        + 
Sbjct: 282 CTVRVSHWPTGRALSFGIGHDFPVEQVKIIPMELSE---------------SDDPQNNTY 326

Query: 458 QAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACI-----------------RTQFGHVE 500
            A N D+     +H++SCS DNT+++W V     I                 +T  GH  
Sbjct: 327 SAFNKDYLPLGFSHVVSCSRDNTLRIWQVPIPRLIAHRAPQPNPARAHFTLVKTLKGHSS 386

Query: 501 GVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVA------CVGIGDSEFVS 554
            V DI      I+S S DRS +VWDL+TG+ +      H   A      C G+     VS
Sbjct: 387 WVRDIRVRGNFIISCSDDRSVRVWDLETGETVREITDSHTGFANCIDTDCGGLNRQLLVS 446

Query: 555 G 555
           G
Sbjct: 447 G 447

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 83/191 (43%), Gaps = 47/191 (24%)

Query: 276 SYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTY 335
           S D T  I D++ G  ++    H + V++L    + +ITGS D T+RV ++ TG  +S  
Sbjct: 239 SRDLTCKIGDVSNGYFLKSFQPHAEWVRSLDIMGEYIITGSNDCTVRVSHWPTGRALSFG 298

Query: 336 RGHQDSVLSV------------------DSFRK--------LIVSGSADKTVKVWHV--- 366
            GH   V  V                   +F K         +VS S D T+++W V   
Sbjct: 299 IGHDFPVEQVKIIPMELSESDDPQNNTYSAFNKDYLPLGFSHVVSCSRDNTLRIWQVPIP 358

Query: 367 -----------ESRTCY----TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNT 411
                       +R  +    TL+GH+ WV  +++  +     S SDD ++R+WD+ T  
Sbjct: 359 RLIAHRAPQPNPARAHFTLVKTLKGHSSWVRDIRV--RGNFIISCSDDRSVRVWDLETGE 416

Query: 412 CVR-VFHGHVG 421
            VR +   H G
Sbjct: 417 TVREITDSHTG 427

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 51/112 (45%), Gaps = 23/112 (20%)

Query: 276 SYDSTVAIWDLATGKLI-----------------RRLSGHTDGVKALRFDDQKLITGSLD 318
           S D+T+ IW +   +LI                 + L GH+  V+ +R     +I+ S D
Sbjct: 345 SRDNTLRIWQVPIPRLIAHRAPQPNPARAHFTLVKTLKGHSSWVRDIRVRGNFIISCSDD 404

Query: 319 KTIRVWNYVTGACV-STYRGHQDSVLSVDS-----FRKLIVSGSADKTVKVW 364
           +++RVW+  TG  V      H      +D+      R+L+VSG AD  V V+
Sbjct: 405 RSVRVWDLETGETVREITDSHTGFANCIDTDCGGLNRQLLVSGGADGKVIVY 456

 Score = 35.8 bits (81), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 42/88 (47%)

Query: 470 THLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTG 529
           T + SCS D T K+ +V  G  +++   H E V  +      I++GS+D + +V    TG
Sbjct: 233 TLVASCSRDLTCKIGDVSNGYFLKSFQPHAEWVRSLDIMGEYIITGSNDCTVRVSHWPTG 292

Query: 530 KCMHTFVGIHAPVACVGIGDSEFVSGDE 557
           + +   +G   PV  V I   E    D+
Sbjct: 293 RALSFGIGHDFPVEQVKIIPMELSESDD 320

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 44/107 (41%), Gaps = 10/107 (9%)

Query: 228 MRPWKV----VYRERFKVESNWRKGIYRIQEFKGHMDGVXXXXXXXXXXXTGSYDSTVAI 283
           +R W+V    +   R    +  R     ++  KGH   V           + S D +V +
Sbjct: 350 LRIWQVPIPRLIAHRAPQPNPARAHFTLVKTLKGHSSWVRDIRVRGNFIISCSDDRSVRV 409

Query: 284 WDLATGKLIRRLS-GHTDGVKALRFD-----DQKLITGSLDKTIRVW 324
           WDL TG+ +R ++  HT     +  D      Q L++G  D  + V+
Sbjct: 410 WDLETGETVREITDSHTGFANCIDTDCGGLNRQLLVSGGADGKVIVY 456

>YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein
           required in ubiquitin proteolysis and found complexed
           with Cdc48p, has WD (WD-40) repeats [2148 bp, 715 aa]
          Length = 715

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 67/231 (29%), Positives = 95/231 (41%), Gaps = 47/231 (20%)

Query: 334 TYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTC 393
           T  GHQ +V S+     +++SGS DKT KVW  E    Y L+ H   V   K+   S   
Sbjct: 94  TLIGHQGNVCSLSFQDGVVISGSWDKTAKVWK-EGSLVYNLQAHNASVWDAKVVSFSENK 152

Query: 394 F-SGSDDMTIRMWDIRTNTCVRVFHG-HVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXX 451
           F + S D TI++W  + +  ++ F G H   V+ +  +  G                   
Sbjct: 153 FLTASADKTIKLW--QNDKVIKTFSGIHNDVVRHLAVVDDG------------------- 191

Query: 452 XXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA-ADNF 510
                              H +SCS D  IKL ++ TG  +RT  GH   V+ I    N 
Sbjct: 192 -------------------HFISCSNDGLIKLVDMHTGDVLRTYEGHESFVYCIKLLPNG 232

Query: 511 RIVSGSHDRSCKVWDLQTG--KCMHTFVGIHA-PVACVGIGDSEFVSGDEL 558
            IVS   DR+ ++W  + G  K + T   I    V C+  GD    S D L
Sbjct: 233 DIVSCGEDRTVRIWSKENGSLKQVITLPAISIWSVDCMSNGDIIVGSSDNL 283

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 71/158 (44%), Gaps = 17/158 (10%)

Query: 257 GHMDGVXXXXXXXXXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGV---KALRFDDQKLI 313
           GH   V           +GS+D T  +W    G L+  L  H   V   K + F + K +
Sbjct: 97  GHQGNVCSLSFQDGVVISGSWDKTAKVW--KEGSLVYNLQAHNASVWDAKVVSFSENKFL 154

Query: 314 TGSLDKTIRVWNYVTGACVSTYRG-HQDSV--LSVDSFRKLIVSGSADKTVKVWHVESRT 370
           T S DKTI++W       + T+ G H D V  L+V      I S S D  +K+  V+  T
Sbjct: 155 TASADKTIKLWQ--NDKVIKTFSGIHNDVVRHLAVVDDGHFI-SCSNDGLIKL--VDMHT 209

Query: 371 CYTLR---GHTGWVNCVKLHPKSFTCFSGSDDMTIRMW 405
              LR   GH  +V C+KL P      S  +D T+R+W
Sbjct: 210 GDVLRTYEGHESFVYCIKLLPNG-DIVSCGEDRTVRIW 246

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 63/131 (48%), Gaps = 12/131 (9%)

Query: 295 LSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSV--LSVDSF-RKL 351
           L GH   V +L F D  +I+GS DKT +VW    G+ V   + H  SV    V SF    
Sbjct: 95  LIGHQGNVCSLSFQDGVVISGSWDKTAKVWK--EGSLVYNLQAHNASVWDAKVVSFSENK 152

Query: 352 IVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFT---CFSGSDDMTIRMWDIR 408
            ++ SADKT+K+W  +      ++  +G  N V  H          S S+D  I++ D+ 
Sbjct: 153 FLTASADKTIKLWQNDK----VIKTFSGIHNDVVRHLAVVDDGHFISCSNDGLIKLVDMH 208

Query: 409 TNTCVRVFHGH 419
           T   +R + GH
Sbjct: 209 TGDVLRTYEGH 219

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 76/170 (44%), Gaps = 15/170 (8%)

Query: 245 WRKG--IYRIQEFKGHMDGVXXXXXXXXXXXTGSYDSTVAIWDLATGKLIRRLSG-HTDG 301
           W++G  +Y +Q     +              T S D T+ +W     K+I+  SG H D 
Sbjct: 124 WKEGSLVYNLQAHNASVWDAKVVSFSENKFLTASADKTIKLW--QNDKVIKTFSGIHNDV 181

Query: 302 VKALRF-DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSF-RKLIVSGSADK 359
           V+ L   DD   I+ S D  I++ +  TG  + TY GH+  V  +       IVS   D+
Sbjct: 182 VRHLAVVDDGHFISCSNDGLIKLVDMHTGDVLRTYEGHESFVYCIKLLPNGDIVSCGEDR 241

Query: 360 TVKVWHVES---RTCYTLRGHTGW-VNCVKLHPKSFTCFSGSDDMTIRMW 405
           TV++W  E+   +   TL   + W V+C+     +     GS D  +R++
Sbjct: 242 TVRIWSKENGSLKQVITLPAISIWSVDCM----SNGDIIVGSSDNLVRIF 287

>KLLA0C07425g complement(647673..649007) highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein singleton, start by
           similarity
          Length = 444

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 75/319 (23%), Positives = 124/319 (38%), Gaps = 70/319 (21%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF-DDQKLITGSLDKTIRVWNYVT---- 328
           +GSYD  V  ++L+ GK+ ++ SGH+  ++A+ +    +L++   D+T+R+W        
Sbjct: 118 SGSYDGIVRTYNLS-GKVEKQYSGHSGPIRAVHYISSTRLVSAGNDRTLRLWKTKNDDLK 176

Query: 329 ---------GACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHV------------- 366
                    G  ++   GH+  V+S+D  +  I+S S D TV +W               
Sbjct: 177 SIDEEEIEDGKTLAILEGHKAPVVSIDVSKDRILSASCDNTVSLWSTNYKEMTVIDPMED 236

Query: 367 ---------ESRTCYTLR--------------GHTGWVNCVKLHPKSFTC-FSGSDDMTI 402
                    + R   TL+               H+  V  V       T  +S S D TI
Sbjct: 237 LGGNVSTAAKKRRKLTLKDGSIRRRAPLALFESHSAPVEAVIFDKSDDTVGYSVSQDHTI 296

Query: 403 RMWDIRTNTCVRVFHG-----HVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSV 457
           + WD+ T  CV           V Q+ K+  L  GS                       V
Sbjct: 297 KTWDLITAKCVDTKTTSYSLLSVAQLPKLNLLACGSSARHITLHDPRVNSSSKITQQQLV 356

Query: 458 QAANFDHSL---PYPTHLL-SCSLDNTIKLWNVKTGACI----RTQFGHVEGVWDIA--- 506
              NF  +L   P   +++ S S D T+K+W+V++   +    R     V+GV D     
Sbjct: 357 GHKNFVVALDTCPENEYMICSASHDGTVKVWDVRSNTAMYTITREDKNVVKGVNDKVFAV 416

Query: 507 --ADNFRIVSGSHDRSCKV 523
             A    I+SG  D+  ++
Sbjct: 417 KWAKGVGIISGGQDKKIQI 435

 Score = 37.4 bits (85), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 52/235 (22%), Positives = 81/235 (34%), Gaps = 65/235 (27%)

Query: 338 HQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGS 397
           ++D V S+D     I SGS D  V+ +++  +      GH+G +  V  +  S    S  
Sbjct: 102 NEDWVSSLDVGSNYIYSGSYDGIVRTYNLSGKVEKQYSGHSGPIRAVH-YISSTRLVSAG 160

Query: 398 DDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSV 457
           +D T+R+W  + +    +    + +  K + +  G                         
Sbjct: 161 NDRTLRLWKTKNDDLKSIDEEEI-EDGKTLAILEG----------------------HKA 197

Query: 458 QAANFDHSLPYPTHLLSCSLDNTIKLW------------------NVKTGACIRTQF--- 496
              + D S      +LS S DNT+ LW                  NV T A  R +    
Sbjct: 198 PVVSIDVS---KDRILSASCDNTVSLWSTNYKEMTVIDPMEDLGGNVSTAAKKRRKLTLK 254

Query: 497 -----------------GHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHT 534
                              VE V    +D+    S S D + K WDL T KC+ T
Sbjct: 255 DGSIRRRAPLALFESHSAPVEAVIFDKSDDTVGYSVSQDHTIKTWDLITAKCVDT 309

>Scas_692.29
          Length = 456

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 76/313 (24%), Positives = 128/313 (40%), Gaps = 40/313 (12%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF-DDQKLITGSLDKTIRVW-------- 324
           T SYD  +  W+L+ GK+ ++ SGH+  ++A++F  D +L++   D+T+R+W        
Sbjct: 120 TASYDGVIRTWNLS-GKVQKQYSGHSGPIRAVKFISDTRLVSAGNDRTLRLWKTKNNDSV 178

Query: 325 -----------NYVTGACVSTYRGHQDSVLSVD-SFRKLIVSGSADKTVKVWHVESRTCY 372
                      N   G  ++   GH+  V+S+D S    I+S S D ++ +W    +   
Sbjct: 179 VQHFDEEDEEANIEDGKTLAILEGHKAPVVSLDVSNTSRILSSSYDNSIGLWSTIYKEMT 238

Query: 373 TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLG 432
            +       N      K  T       +T++   IR    + +   H   V++     + 
Sbjct: 239 VVDPMEEINNA---DNKISTAARKRRKLTLKDGTIRRRAPLSLLESHTAPVEQA-SFDIN 294

Query: 433 SDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSL----PYPT-HLLSC-SLDNTIKLWNV 486
            D +                    +      +SL      PT +LL+C S    I L + 
Sbjct: 295 DDTVGYSVSQDHTIKTWDLVTARCIDTKTTSYSLLSLTQLPTLNLLACGSSARHITLHDP 354

Query: 487 KTGACIR-TQ---FGHVEGV--WDIAADNFRIV-SGSHDRSCKVWDLQTGKCMHTFVGIH 539
           + GA  + TQ    GH   V   D   +N  I+ SGSHD + KVWD+++   M+T     
Sbjct: 355 RMGASSKVTQHQLIGHKNFVVSLDTCPENEYILCSGSHDGTVKVWDVRSTAPMYTITRED 414

Query: 540 APVACVGIGDSEF 552
             V   G+ D  F
Sbjct: 415 KNVEK-GVNDKVF 426

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 1/73 (1%)

Query: 341 SVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDM 400
           S + V   +K I++ S D  ++ W++  +      GH+G +  VK    +    S  +D 
Sbjct: 107 SSIDVSQDKKAIITASYDGVIRTWNLSGKVQKQYSGHSGPIRAVKFISDT-RLVSAGNDR 165

Query: 401 TIRMWDIRTNTCV 413
           T+R+W  + N  V
Sbjct: 166 TLRLWKTKNNDSV 178

>Scas_685.11
          Length = 384

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 63/132 (47%), Gaps = 14/132 (10%)

Query: 292 IRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVD----- 346
           I     H   VK L    + L++GS D+ IR+++      + T   HQ S+ ++      
Sbjct: 34  IFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSK 93

Query: 347 --------SFRKLIVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHPKSFTCFSGS 397
                   S  K ++S S D  + +W V+    + TL+GH   +N V +HP +    S S
Sbjct: 94  TENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVS 153

Query: 398 DDMTIRMWDIRT 409
           +D +IR+W++ T
Sbjct: 154 EDHSIRLWNLMT 165

 Score = 38.5 bits (88), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 59/161 (36%), Gaps = 30/161 (18%)

Query: 372 YTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTL 431
           +  + H   V C+ +  +     SGS+D  IR++D++    +     H G +  +     
Sbjct: 35  FHFQAHALSVKCLDVSKRYLV--SGSNDEHIRIYDLQKRKELGTLLAHQGSITNL----- 87

Query: 432 GSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGAC 491
                                     +  N D        LLS S DN I +W VK    
Sbjct: 88  ---------------------KFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKDWEN 126

Query: 492 IRTQFGHVEGV--WDIAADNFRIVSGSHDRSCKVWDLQTGK 530
             T  GH+  +   DI   N   +S S D S ++W+L T K
Sbjct: 127 FGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVK 167

>KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomyces
           cerevisiae YLR222c, start by similarity
          Length = 814

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 72/157 (45%), Gaps = 9/157 (5%)

Query: 286 LATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVL 343
           + T +  RR   H   + A+    +D    T S DKT ++WN   G   +T   H+  + 
Sbjct: 484 VKTSEYTRR--AHEKDINAISISPNDSLFATASYDKTCKIWNLDDGEFQATLANHKRGLW 541

Query: 344 SVD--SFRKLIVSGSADKTVKVWHVESRTCY-TLRGHTGWVN-CVKLHPKSFTCFSGSDD 399
            V    + KL+ + S DKT+K+W +ES     TL GHT  V  C  ++       +G+D 
Sbjct: 542 DVAFCQYDKLLATCSGDKTIKIWSLESYAVVKTLEGHTNAVQRCSFINKNKQLISTGADG 601

Query: 400 MTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLI 436
           + I +WD+ T   V+    H  ++  +  +  G   +
Sbjct: 602 LVI-IWDLSTGESVKTLDAHNNRIWALAVMNDGESFV 637

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 69/301 (22%), Positives = 113/301 (37%), Gaps = 79/301 (26%)

Query: 292 IRRLSGHTDGVKAL--RFDDQKLITGSLDKTIRVWNYVTGA----CVSTYRGHQDSVLSV 345
           ++   GHTD + +L    D   + T S D ++ +W Y          + + GH  SV +V
Sbjct: 383 VKMYEGHTDLLNSLDATADGLWVATASKDHSVILWRYHAKYEDFYPYTKFVGHVGSVNAV 442

Query: 346 D-------SFRKLIVSGSADKTVKVWHVESRTC-------------YTLRGHTGWVNCVK 385
                   S+ + I++ S D T+K W V   T              YT R H   +N + 
Sbjct: 443 GLPNVMPRSWPEFIITASNDLTIKKWKVPKVTSDEPEDLILVKTSEYTRRAHEKDINAIS 502

Query: 386 LHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXX 445
           + P      + S D T ++W++             G+ Q  +                  
Sbjct: 503 ISPNDSLFATASYDKTCKIWNLDD-----------GEFQATL------------------ 533

Query: 446 XXXXXXXXXXSVQAANFDHSL------PYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHV 499
                         AN    L       Y   L +CS D TIK+W++++ A ++T  GH 
Sbjct: 534 --------------ANHKRGLWDVAFCQYDKLLATCSGDKTIKIWSLESYAVVKTLEGHT 579

Query: 500 EGVW--DIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPV-ACVGIGDSE-FVSG 555
             V        N +++S   D    +WDL TG+ + T    +  + A   + D E FV+ 
Sbjct: 580 NAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAHNNRIWALAVMNDGESFVTA 639

Query: 556 D 556
           D
Sbjct: 640 D 640

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 62/125 (49%), Gaps = 7/125 (5%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGAC 331
           T SYD T  IW+L  G+    L+ H  G+  + F   D+ L T S DKTI++W+  + A 
Sbjct: 512 TASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSGDKTIKIWSLESYAV 571

Query: 332 VSTYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWHVES-RTCYTLRGHTG--WVNCVKL 386
           V T  GH ++V   S  +  K ++S  AD  V +W + +  +  TL  H    W   V  
Sbjct: 572 VKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAHNNRIWALAVMN 631

Query: 387 HPKSF 391
             +SF
Sbjct: 632 DGESF 636

 Score = 30.0 bits (66), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 35/77 (45%), Gaps = 7/77 (9%)

Query: 312 LITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKL------IVSGSADKTVKVWH 365
           L  G  D ++ V +   G    + +GH  ++ SV    +L      + SG  +  +KVW 
Sbjct: 116 LAIGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFHGELNSEIWKLASGDTNGMIKVWD 175

Query: 366 VESRTCY-TLRGHTGWV 381
           +  R C  T++ HT  V
Sbjct: 176 LVKRNCQCTIQEHTTAV 192

>AGR180W [4491] [Homologous to ScYLR222C - SH]
           complement(1090647..1093067) [2421 bp, 806 aa]
          Length = 806

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 60/132 (45%), Gaps = 5/132 (3%)

Query: 297 GHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVD--SFRKLI 352
            H   + A+    +D    T S DKT ++WN  TG   +T   H+  +  V    +  L+
Sbjct: 486 AHEKDINAISMSPNDSIFATASYDKTCKIWNVDTGEVEATLANHKRGLWGVAFCEYDWLL 545

Query: 353 VSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNT 411
            + S D+++ +W +ES T   TL GHT  V  V     +    S   D  +++WD  T  
Sbjct: 546 ATCSGDRSINLWSLESFTVLKTLEGHTNAVQRVSFINGNKQLVSTGADGLVKIWDCSTGE 605

Query: 412 CVRVFHGHVGQV 423
           CVR    H  ++
Sbjct: 606 CVRTLDAHNNRI 617

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/274 (21%), Positives = 105/274 (38%), Gaps = 78/274 (28%)

Query: 297 GHTDGVKAL--RFDDQKLITGSLDKTIRVWNYVTGAC----VSTYRGHQDSVLSVD---- 346
           GHTD + +L    D   L T S D ++ +W Y   +      + + GH   V ++     
Sbjct: 380 GHTDLLNSLDATSDGLWLATASKDHSVILWRYNEASSSFEPFTKFLGHAGPVTAIALPNV 439

Query: 347 ---SFRKLIVSGSADKTVKVW--------------HVESRTCYTLRGHTGWVNCVKLHPK 389
              ++ + +++ S D T+K W              H+   + YT R H   +N + + P 
Sbjct: 440 MNRNWPEFLLTASNDLTIKRWKVPNPNDRKAIELPHIVKASEYTRRAHEKDINAISMSPN 499

Query: 390 SFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXX 449
                + S D T ++W++ T           G+V+  +                      
Sbjct: 500 DSIFATASYDKTCKIWNVDT-----------GEVEATL---------------------- 526

Query: 450 XXXXXXSVQAANFDHSL------PYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVW 503
                     AN    L       Y   L +CS D +I LW++++   ++T  GH   V 
Sbjct: 527 ----------ANHKRGLWGVAFCEYDWLLATCSGDRSINLWSLESFTVLKTLEGHTNAVQ 576

Query: 504 DIA--ADNFRIVSGSHDRSCKVWDLQTGKCMHTF 535
            ++    N ++VS   D   K+WD  TG+C+ T 
Sbjct: 577 RVSFINGNKQLVSTGADGLVKIWDCSTGECVRTL 610

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 61/281 (21%), Positives = 105/281 (37%), Gaps = 66/281 (23%)

Query: 274 TGSYDSTVAIWDL----ATGKLIRRLSGHTDGVKALRFDD-------QKLITGSLDKTIR 322
           T S D +V +W      ++ +   +  GH   V A+   +       + L+T S D TI+
Sbjct: 399 TASKDHSVILWRYNEASSSFEPFTKFLGHAGPVTAIALPNVMNRNWPEFLLTASNDLTIK 458

Query: 323 VWN-------------YVTGACVSTYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWHVE 367
            W              ++  A   T R H+  +  +S+     +  + S DKT K+W+V+
Sbjct: 459 RWKVPNPNDRKAIELPHIVKASEYTRRAHEKDINAISMSPNDSIFATASYDKTCKIWNVD 518

Query: 368 S-RTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKV 426
           +     TL  H   +  V      +   + S D +I +W + + T ++   GH   VQ+V
Sbjct: 519 TGEVEATLANHKRGLWGVAFCEYDWLLATCSGDRSINLWSLESFTVLKTLEGHTNAVQRV 578

Query: 427 IPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNV 486
                                        S    N          L+S   D  +K+W+ 
Sbjct: 579 -----------------------------SFINGN--------KQLVSTGADGLVKIWDC 601

Query: 487 KTGACIRTQFGHVEGVWDIAA--DNFRIVSGSHDRSCKVWD 525
            TG C+RT   H   +W +A   D   I++   D   + W+
Sbjct: 602 STGECVRTLDAHNNRIWALAVANDGQLIITADADGVFQFWE 642

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/238 (22%), Positives = 91/238 (38%), Gaps = 44/238 (18%)

Query: 335 YRGHQDSVLSVDSFRK--LIVSGSADKTVKVW-HVESRTCYT----LRGHTGWVNCVKLH 387
           Y GH D + S+D+      + + S D +V +W + E+ + +       GH G V  + L 
Sbjct: 378 YEGHTDLLNSLDATSDGLWLATASKDHSVILWRYNEASSSFEPFTKFLGHAGPVTAIAL- 436

Query: 388 PKSFT------CFSGSDDMTIRMWDI-RTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXX 440
           P            + S+D+TI+ W +   N    +   H+ +  +        D+     
Sbjct: 437 PNVMNRNWPEFLLTASNDLTIKRWKVPNPNDRKAIELPHIVKASEYTRRAHEKDI----- 491

Query: 441 XXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVE 500
                               N     P  +   + S D T K+WNV TG    T   H  
Sbjct: 492 --------------------NAISMSPNDSIFATASYDKTCKIWNVDTGEVEATLANHKR 531

Query: 501 GVWDIA--ADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGI--GDSEFVS 554
           G+W +A    ++ + + S DRS  +W L++   + T  G    V  V    G+ + VS
Sbjct: 532 GLWGVAFCEYDWLLATCSGDRSINLWSLESFTVLKTLEGHTNAVQRVSFINGNKQLVS 589

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 50/106 (47%), Gaps = 11/106 (10%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK------LITGSLDKTIRVWNYVT 328
           G  D +V ++D+A G +   L GH   + +++F  +       L +G  +  +++W+ V 
Sbjct: 119 GGTDGSVNVFDIANGYVTHSLKGHGATISSVKFYGEVDSGMWLLASGDTNGMVKIWDLVK 178

Query: 329 GACVSTYRGHQDSVLSVD-----SFRKLIVSGSADKTVKVWHVESR 369
             C+ T + H  +V  +D         L++SG  D  V V H + +
Sbjct: 179 RRCIHTVQEHTAAVRGLDIRVQEGAESLLLSGGRDDVVHVHHFDMK 224

 Score = 37.7 bits (86), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 46/100 (46%), Gaps = 11/100 (11%)

Query: 312 LITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSV------DSFRKLIVSGSADKTVKVWH 365
           L  G  D ++ V++   G    + +GH  ++ SV      DS   L+ SG  +  VK+W 
Sbjct: 116 LAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVKFYGEVDSGMWLLASGDTNGMVKIWD 175

Query: 366 VESRTC-YTLRGHTGWVNCVKLH----PKSFTCFSGSDDM 400
           +  R C +T++ HT  V  + +      +S     G DD+
Sbjct: 176 LVKRRCIHTVQEHTAAVRGLDIRVQEGAESLLLSGGRDDV 215

 Score = 37.0 bits (84), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 29/131 (22%), Positives = 58/131 (44%), Gaps = 8/131 (6%)

Query: 302 VKALRF--DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDS-VLSVDSFRKLIVSGSAD 358
           V ALR   D + L   S ++ +R ++  T     + +    + VL  D    L+  G  D
Sbjct: 63  VTALRLTPDGRYLCYASQNQLLRFYDLETKRTTRSMKISSPAYVLDCDESSTLLAVGGTD 122

Query: 359 KTVKVWHVES-RTCYTLRGHTGWVNCVKLHPK----SFTCFSGSDDMTIRMWDIRTNTCV 413
            +V V+ + +    ++L+GH   ++ VK + +     +   SG  +  +++WD+    C+
Sbjct: 123 GSVNVFDIANGYVTHSLKGHGATISSVKFYGEVDSGMWLLASGDTNGMVKIWDLVKRRCI 182

Query: 414 RVFHGHVGQVQ 424
                H   V+
Sbjct: 183 HTVQEHTAAVR 193

>CAGL0F06853g 671942..673108 highly similar to sp|P20484
           Saccharomyces cerevisiae YKL021c MAK11 involved in cell
           growth and replication of M1 dsRNA virus, hypothetical
           start
          Length = 388

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 66/131 (50%), Gaps = 14/131 (10%)

Query: 292 IRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKL 351
           I     H+  VK L    + L++GS D+ IR+++      + T   HQ S+ ++  F K+
Sbjct: 34  IFHFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNL-KFSKV 92

Query: 352 ------------IVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHPKSFTCFSGSD 398
                       ++S S D  + VW V+    + TL+GHT  +N + +HP +    S S+
Sbjct: 93  SDQEPKSTSGKWLLSASEDNKIIVWRVKDWENFGTLKGHTARINDMDIHPSNRVVASVSE 152

Query: 399 DMTIRMWDIRT 409
           D +IR+W++ T
Sbjct: 153 DHSIRLWNLMT 163

 Score = 36.6 bits (83), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 60/163 (36%), Gaps = 38/163 (23%)

Query: 371 CYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLT 430
            +  + H+  V C+ +  +     SGS+D  IR++D++    +     H G +       
Sbjct: 34  IFHFQAHSLSVKCLDISKRYLV--SGSNDEHIRIYDLQKRKELGTLLAHQGSI------- 84

Query: 431 LGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTH---LLSCSLDNTIKLWNVK 487
                                    +++ +      P  T    LLS S DN I +W VK
Sbjct: 85  ------------------------TNLKFSKVSDQEPKSTSGKWLLSASEDNKIIVWRVK 120

Query: 488 TGACIRTQFGHVEGV--WDIAADNFRIVSGSHDRSCKVWDLQT 528
                 T  GH   +   DI   N  + S S D S ++W+L T
Sbjct: 121 DWENFGTLKGHTARINDMDIHPSNRVVASVSEDHSIRLWNLMT 163

 Score = 36.2 bits (82), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 53/128 (41%), Gaps = 13/128 (10%)

Query: 252 IQEFKGHMDGVXXXXXXXXXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF---D 308
           I  F+ H   V           +GS D  + I+DL   K +  L  H   +  L+F    
Sbjct: 34  IFHFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKVS 93

Query: 309 DQK--------LITGSLDKTIRVWNYVTGACVSTYRGHQDSV--LSVDSFRKLIVSGSAD 358
           DQ+        L++ S D  I VW         T +GH   +  + +    +++ S S D
Sbjct: 94  DQEPKSTSGKWLLSASEDNKIIVWRVKDWENFGTLKGHTARINDMDIHPSNRVVASVSED 153

Query: 359 KTVKVWHV 366
            ++++W++
Sbjct: 154 HSIRLWNL 161

>Scas_721.7
          Length = 325

 Score = 58.9 bits (141), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 76/164 (46%), Gaps = 16/164 (9%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGAC 331
           + S D T+ I  L  G L  RL GHT  V +L ++D    L T S+D++I++W+   GA 
Sbjct: 74  SASDDFTIEITHLTHGCL-HRLMGHTAPVISLTYNDSGNLLFTSSMDESIKIWDTFHGAI 132

Query: 332 VSTYRGHQDSVLSV----DSFRKLIVSGSADKTVKVWHVESRTCY-TLRGHTGW------ 380
           + T   H +SV+S+    D    ++ SGS D  ++++   +  C  TL     W      
Sbjct: 133 LKTISAHSESVVSLSICPDRDSSVLASGSFDGLIRLFDTRTGHCLKTLTYDKDWKSDDGV 192

Query: 381 --VNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQ 422
             ++ V+  P        S D  +++WD      VR F    G+
Sbjct: 193 VPISQVRFSPNGKFLLVSSFDGIVKIWDCVRGYVVRTFKPSDGE 236

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 38/68 (55%), Gaps = 4/68 (5%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAA----DNFRIVSGSHDRSCKVWDLQ 527
           L + S+D +IK+W+   GA ++T   H E V  ++     D+  + SGS D   +++D +
Sbjct: 113 LFTSSMDESIKIWDTFHGAILKTISAHSESVVSLSICPDRDSSVLASGSFDGLIRLFDTR 172

Query: 528 TGKCMHTF 535
           TG C+ T 
Sbjct: 173 TGHCLKTL 180

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 44/197 (22%), Positives = 77/197 (39%), Gaps = 45/197 (22%)

Query: 349 RKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIR 408
            + + S S D T+++ H+     + L GHT  V  +  +      F+ S D +I++WD  
Sbjct: 69  NQCLASASDDFTIEITHLTHGCLHRLMGHTAPVISLTYNDSGNLLFTSSMDESIKIWDTF 128

Query: 409 TNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPY 468
               ++    H    + V+ L++  D                            D S+  
Sbjct: 129 HGAILKTISAH---SESVVSLSICPDR---------------------------DSSV-- 156

Query: 469 PTHLLSCSLDNTIKLWNVKTGACIRT-----QFGHVEGVWDIAADNFR-----IVSGSHD 518
              L S S D  I+L++ +TG C++T      +   +GV  I+   F      ++  S D
Sbjct: 157 ---LASGSFDGLIRLFDTRTGHCLKTLTYDKDWKSDDGVVPISQVRFSPNGKFLLVSSFD 213

Query: 519 RSCKVWDLQTGKCMHTF 535
              K+WD   G  + TF
Sbjct: 214 GIVKIWDCVRGYVVRTF 230

>Kwal_26.8975
          Length = 445

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 67/311 (21%), Positives = 126/311 (40%), Gaps = 44/311 (14%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF-DDQKLITGSLDKTIRVW-------- 324
           +GSYD  V  W+L +GK+ ++ +GH+  V+A+++    +L++G+ D+T+R+W        
Sbjct: 117 SGSYDGIVRTWNL-SGKVEKQYAGHSGAVRAVKYISSTRLVSGANDRTLRLWKTKNDELK 175

Query: 325 --------NYVTGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVW---HVESRTCYT 373
                   +   G  ++    H+  V++VD     I+SGS D ++  W   H E      
Sbjct: 176 NNLAAEEDDVEEGKTLAILEAHKAPVVTVDVSGDRIISGSYDNSIGFWSTNHKEMTAVDP 235

Query: 374 LRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVI----PL 429
           +      V+      +      GS         +R  + + +   H   V++V+      
Sbjct: 236 MDALGSNVSSAAKKRRRLALKDGS---------VRRRSPLALLESHTAPVEEVLFDFADK 286

Query: 430 TLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSC-SLDNTIKLWNVKT 488
           T+G  + +                  S   +    +     +LL+C S    I L + + 
Sbjct: 287 TVGYSVSQDHTIKTWDLVTARCVDTKSTSYSLLSLAQLPQLNLLACGSSARHITLHDPRV 346

Query: 489 GACIRTQFGHVEG--VWDIAADN-----FRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAP 541
           G+  +     + G   + +A D      + + SGSHD + KVWD+++   M+T       
Sbjct: 347 GSSTKITQQQLNGHKNFVVALDTCPEMEYMLCSGSHDGTVKVWDVRSSAPMYTIT--REA 404

Query: 542 VACVGIGDSEF 552
               GI D  F
Sbjct: 405 EVVKGINDKVF 415

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/221 (22%), Positives = 84/221 (38%), Gaps = 32/221 (14%)

Query: 337 GHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSG 396
            ++D V ++D     IVSGS D  V+ W++  +      GH+G V  VK +  S    SG
Sbjct: 100 NNEDWVSALDVGGDKIVSGSYDGIVRTWNLSGKVEKQYAGHSGAVRAVK-YISSTRLVSG 158

Query: 397 SDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXS 456
           ++D T+R+W  + +            V++   L +                         
Sbjct: 159 ANDRTLRLWKTKNDELKNNLAAEEDDVEEGKTLAI--------LEAHKAPVVTVDVSGDR 210

Query: 457 VQAANFDHSLPY------------PTHLLSCSLDNTIK---LWNVKTG--------ACIR 493
           + + ++D+S+ +            P   L  ++ +  K      +K G        A + 
Sbjct: 211 IISGSYDNSIGFWSTNHKEMTAVDPMDALGSNVSSAAKKRRRLALKDGSVRRRSPLALLE 270

Query: 494 TQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHT 534
           +    VE V    AD     S S D + K WDL T +C+ T
Sbjct: 271 SHTAPVEEVLFDFADKTVGYSVSQDHTIKTWDLVTARCVDT 311

 Score = 38.1 bits (87), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 45/101 (44%), Gaps = 18/101 (17%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA-ADNFRIVSGSHDRSCKVW------ 524
           ++S S D  ++ WN+ +G   +   GH   V  +    + R+VSG++DR+ ++W      
Sbjct: 115 IVSGSYDGIVRTWNL-SGKVEKQYAGHSGAVRAVKYISSTRLVSGANDRTLRLWKTKNDE 173

Query: 525 ----------DLQTGKCMHTFVGIHAPVACVGIGDSEFVSG 555
                     D++ GK +       APV  V +     +SG
Sbjct: 174 LKNNLAAEEDDVEEGKTLAILEAHKAPVVTVDVSGDRIISG 214

>Kwal_33.15591
          Length = 714

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 72/154 (46%), Gaps = 10/154 (6%)

Query: 257 GHMDGVXXXXXXXXXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LIT 314
           GH + V           +GS+D+T  +W    G L   L GHT  V  ++   +    +T
Sbjct: 103 GHENNVCVLNSSQGYVLSGSWDTTAKVW--FQGALKHELKGHTASVWDVKMLPEVGFYMT 160

Query: 315 GSLDKTIRVWNYVTGACVSTYRG-HQDSV--LSVDSFRKLIVSGSADKTVKVWHVESRTC 371
            S D TI++W       + T+ G H D +  + +D+  +   S S D TVK+  +E +T 
Sbjct: 161 ASADGTIKLWE--GEKVLKTFTGLHTDVIRHIDIDASGEKFASCSNDGTVKINDMEGKTL 218

Query: 372 YTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMW 405
            TL GH  +V  VK  P      S  +D T+R+W
Sbjct: 219 KTLVGHESFVYSVKFAPNG-DVISCGEDRTVRIW 251

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 84/189 (44%), Gaps = 41/189 (21%)

Query: 337 GHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSG 396
           GH+++V  ++S +  ++SGS D T KVW  +    + L+GHT  V  VK+ P+     + 
Sbjct: 103 GHENNVCVLNSSQGYVLSGSWDTTAKVWF-QGALKHELKGHTASVWDVKMLPEVGFYMTA 161

Query: 397 SDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXS 456
           S D TI++W+      ++ F G            L +D+I                    
Sbjct: 162 SADGTIKLWE--GEKVLKTFTG------------LHTDVI-------------------- 187

Query: 457 VQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA-ADNFRIVSG 515
            +  + D S        SCS D T+K+ N   G  ++T  GH   V+ +  A N  ++S 
Sbjct: 188 -RHIDIDAS---GEKFASCSNDGTVKI-NDMEGKTLKTLVGHESFVYSVKFAPNGDVISC 242

Query: 516 SHDRSCKVW 524
             DR+ ++W
Sbjct: 243 GEDRTVRIW 251

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 62/135 (45%), Gaps = 7/135 (5%)

Query: 295 LSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKL--I 352
           L GH + V  L      +++GS D T +VW    GA     +GH  SV  V    ++   
Sbjct: 101 LIGHENNVCVLNSSQGYVLSGSWDTTAKVW--FQGALKHELKGHTASVWDVKMLPEVGFY 158

Query: 353 VSGSADKTVKVWHVESRTCYTLRG-HTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNT 411
           ++ SAD T+K+W  E +   T  G HT  +  + +        S S+D T+++ D+   T
Sbjct: 159 MTASADGTIKLWEGE-KVLKTFTGLHTDVIRHIDIDASGEKFASCSNDGTVKINDMEGKT 217

Query: 412 CVRVFHGHVGQVQKV 426
            ++   GH   V  V
Sbjct: 218 -LKTLVGHESFVYSV 231

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 64/137 (46%), Gaps = 10/137 (7%)

Query: 245 WRKGIYRIQEFKGHMDGV--XXXXXXXXXXXTGSYDSTVAIWDLATGKLIRRLSG-HTDG 301
           W +G  +  E KGH   V             T S D T+ +W+    K+++  +G HTD 
Sbjct: 130 WFQGALK-HELKGHTASVWDVKMLPEVGFYMTASADGTIKLWE--GEKVLKTFTGLHTDV 186

Query: 302 VKALRFD--DQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVD-SFRKLIVSGSAD 358
           ++ +  D   +K  + S D T+++ N + G  + T  GH+  V SV  +    ++S   D
Sbjct: 187 IRHIDIDASGEKFASCSNDGTVKI-NDMEGKTLKTLVGHESFVYSVKFAPNGDVISCGED 245

Query: 359 KTVKVWHVESRTCYTLR 375
           +TV++W  +      +R
Sbjct: 246 RTVRIWKADGTVKQVIR 262

 Score = 32.7 bits (73), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 10/77 (12%)

Query: 466 LPYPTHLLSCSLDNTIKLWN----VKTGACIRTQ-FGHVEGVWDIAADNFRIVSGSHDRS 520
           LP     ++ S D TIKLW     +KT   + T    H+    DI A   +  S S+D +
Sbjct: 152 LPEVGFYMTASADGTIKLWEGEKVLKTFTGLHTDVIRHI----DIDASGEKFASCSNDGT 207

Query: 521 CKVWDLQTGKCMHTFVG 537
            K+ D++ GK + T VG
Sbjct: 208 VKINDME-GKTLKTLVG 223

>YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and
           COMPASS complex, has several WD (WD-40) repeats and may
           be involved in chromatin remodeling [948 bp, 315 aa]
          Length = 315

 Score = 58.2 bits (139), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 77/158 (48%), Gaps = 15/158 (9%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGAC 331
           T S D +V I  L+ G L+    GHT  V +L F+ +   L T S+D++I++W+ + G+ 
Sbjct: 72  TASDDFSVEIIHLSYG-LLHTFIGHTAPVISLTFNRKGNLLFTSSMDESIKIWDTLNGSL 130

Query: 332 VSTYRGHQDSVLSVD---SFRKLIVSGSADKTVKVWHVESRTCY-TLRGHTGW------- 380
           + T   H ++V+SVD   +   ++ SGS D  ++++  E+  C  TL     W       
Sbjct: 131 MKTISAHSEAVVSVDVPMNDSSILSSGSYDGLIRIFDAETGHCLKTLTYDKDWKRENGVV 190

Query: 381 -VNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFH 417
            ++ VK    +      S D  +++WD      VR F 
Sbjct: 191 PISQVKFSENARYLLVKSLDGVVKIWDCIGGCVVRTFQ 228

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 38/67 (56%), Gaps = 3/67 (4%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAA---DNFRIVSGSHDRSCKVWDLQT 528
           L + S+D +IK+W+   G+ ++T   H E V  +     D+  + SGS+D   +++D +T
Sbjct: 111 LFTSSMDESIKIWDTLNGSLMKTISAHSEAVVSVDVPMNDSSILSSGSYDGLIRIFDAET 170

Query: 529 GKCMHTF 535
           G C+ T 
Sbjct: 171 GHCLKTL 177

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 75/195 (38%), Gaps = 48/195 (24%)

Query: 352 IVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNT 411
           I + S D +V++ H+     +T  GHT  V  +  + K    F+ S D +I++WD    +
Sbjct: 70  IATASDDFSVEIIHLSYGLLHTFIGHTAPVISLTFNRKGNLLFTSSMDESIKIWDTLNGS 129

Query: 412 CVRVFHGHVGQVQKV-IPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPT 470
            ++    H   V  V +P+                                 D S+    
Sbjct: 130 LMKTISAHSEAVVSVDVPMN--------------------------------DSSI---- 153

Query: 471 HLLSCSLDNTIKLWNVKTGACIRT-----QFGHVEGVWDIAADNFR-----IVSGSHDRS 520
            L S S D  I++++ +TG C++T      +    GV  I+   F      ++  S D  
Sbjct: 154 -LSSGSYDGLIRIFDAETGHCLKTLTYDKDWKRENGVVPISQVKFSENARYLLVKSLDGV 212

Query: 521 CKVWDLQTGKCMHTF 535
            K+WD   G  + TF
Sbjct: 213 VKIWDCIGGCVVRTF 227

 Score = 37.7 bits (86), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 26/123 (21%), Positives = 54/123 (43%), Gaps = 22/123 (17%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTD--------GVKALRFDDQK--LITGSLDKTIRV 323
           +GSYD  + I+D  TG  ++ L+   D         +  ++F +    L+  SLD  +++
Sbjct: 156 SGSYDGLIRIFDAETGHCLKTLTYDKDWKRENGVVPISQVKFSENARYLLVKSLDGVVKI 215

Query: 324 WNYVTGACVSTYRGH------------QDSVLSVDSFRKLIVSGSADKTVKVWHVESRTC 371
           W+ + G  V T++               D +   D    L++SG  +  +  W+ ++++ 
Sbjct: 216 WDCIGGCVVRTFQVQPLEKGVLHHSCGMDFLNPEDGSTPLVISGYENGDIYCWNSDTKSL 275

Query: 372 YTL 374
             L
Sbjct: 276 LQL 278

>AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH]
           (1146710..1147672) [963 bp, 320 aa]
          Length = 320

 Score = 58.2 bits (139), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 78/163 (47%), Gaps = 15/163 (9%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFD--DQKLITGSLDKTIRVWNYVTGAC 331
           +GS D TV I  L  G+L  +L GH+  V ++ F+     L T S+D++I+ W+ ++G  
Sbjct: 72  SGSEDFTVEITHLEYGRL-HKLRGHSAPVLSVVFNCKGNLLCTASVDESIKQWDVLSGTL 130

Query: 332 VSTYRGHQDSVLSVDSF---RKLIVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLH 387
           + T   H D V+S+D+      ++ SGS D  ++++  ES  C  TL     W     + 
Sbjct: 131 LKTMSAHSDPVVSIDTPDCDATILSSGSYDGLIRIFDTESGHCLKTLTYDKDWQTDDGVV 190

Query: 388 PKSFTCFS--------GSDDMTIRMWDIRTNTCVRVFHGHVGQ 422
           P S   FS         S D  +++WD      VR F    G+
Sbjct: 191 PISQVKFSRNGKFLLVRSLDGVVKLWDFIRGCVVRTFKDASGE 233

 Score = 45.1 bits (105), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 53/230 (23%), Positives = 82/230 (35%), Gaps = 44/230 (19%)

Query: 352 IVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNT 411
           + SGS D TV++ H+E    + LRGH+  V  V  + K     + S D +I+ WD+ + T
Sbjct: 70  VASGSEDFTVEITHLEYGRLHKLRGHSAPVLSVVFNCKGNLLCTASVDESIKQWDVLSGT 129

Query: 412 CVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYP-- 469
            ++    H   V  +       D  +                    ++ +   +L Y   
Sbjct: 130 LLKTMSAHSDPVVSI-------DTPDCDATILSSGSYDGLIRIFDTESGHCLKTLTYDKD 182

Query: 470 -------------------THLLSCSLDNTIKLWNVKTGACIRTQFGHVEG--------- 501
                                LL  SLD  +KLW+   G  +RT F    G         
Sbjct: 183 WQTDDGVVPISQVKFSRNGKFLLVRSLDGVVKLWDFIRGCVVRT-FKDASGESRMKYSCG 241

Query: 502 ----VWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIH--APVACV 545
                 D  A +  +V G  D +  VW+ Q+     T  G H  +PV  V
Sbjct: 242 MDFLYPDSEAADVMVVVGGEDGNICVWNAQSKAVAQTLKGQHEDSPVIAV 291

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 36/69 (52%), Gaps = 3/69 (4%)

Query: 479 NTIKLWNVKTGACIRTQFGHVEGVWDI--AADNFRIVSGSHDRSCKVWDLQTGKCMHTFV 536
             I +++V  G C R +  H E + DI  + D+  + SGS D + ++  L+ G+ +H   
Sbjct: 35  TAICVYSVGDGGCARYETTHTEPINDICWSPDSACVASGSEDFTVEITHLEYGR-LHKLR 93

Query: 537 GIHAPVACV 545
           G  APV  V
Sbjct: 94  GHSAPVLSV 102

>Kwal_55.22067
          Length = 451

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 63/143 (44%), Gaps = 6/143 (4%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFD--DQKLITGSLDKTIRVWNYVTGAC 331
           +G  D T+ IW      +      HT  ++ + F   D K +T S D  +++WN+  G  
Sbjct: 142 SGDSDGTIKIWQPNFNMVKVLDEAHTQCIRGISFSGTDSKFVTCSDDNILKIWNFSNGQQ 201

Query: 332 VSTYRGHQDSVLSVD--SFRKLIVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHP 388
            ST  GH   V S D      LI SGS D  VK+W   +  C  T+ G    +   K  P
Sbjct: 202 ESTLSGHHWDVRSCDWHPTMGLIASGSKDNLVKLWDPRAGQCISTILGCKHTIISTKFQP 261

Query: 389 KSFTCFSG-SDDMTIRMWDIRTN 410
                 +  S D + R++DIR N
Sbjct: 262 TKGNMLAVISKDKSCRIFDIRQN 284

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 59/149 (39%), Gaps = 5/149 (3%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGACV 332
            +Y    ++W+ +T      +  H   V  +++      LI+G  D TI++W        
Sbjct: 101 ATYSGEFSLWNGSTFNFESIMQAHDSAVAVMKYSHAGDWLISGDSDGTIKIWQPNFNMVK 160

Query: 333 STYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWHVES-RTCYTLRGHTGWVNCVKLHPK 389
                H   +  +S        V+ S D  +K+W+  + +   TL GH   V     HP 
Sbjct: 161 VLDEAHTQCIRGISFSGTDSKFVTCSDDNILKIWNFSNGQQESTLSGHHWDVRSCDWHPT 220

Query: 390 SFTCFSGSDDMTIRMWDIRTNTCVRVFHG 418
                SGS D  +++WD R   C+    G
Sbjct: 221 MGLIASGSKDNLVKLWDPRAGQCISTILG 249

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 39/73 (53%), Gaps = 8/73 (10%)

Query: 470 THLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFR-----IVSGSHDRSCKVW 524
           +  ++CS DN +K+WN   G    T  GH    WD+ + ++      I SGS D   K+W
Sbjct: 180 SKFVTCSDDNILKIWNFSNGQQESTLSGHH---WDVRSCDWHPTMGLIASGSKDNLVKLW 236

Query: 525 DLQTGKCMHTFVG 537
           D + G+C+ T +G
Sbjct: 237 DPRAGQCISTILG 249

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 49/232 (21%), Positives = 86/232 (37%), Gaps = 59/232 (25%)

Query: 310 QKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKL---IVSGSADKTVKVWHV 366
           ++L+  +      +WN  T    S  + H DS ++V  +      ++SG +D T+K+W  
Sbjct: 96  RRLVVATYSGEFSLWNGSTFNFESIMQAH-DSAVAVMKYSHAGDWLISGDSDGTIKIWQP 154

Query: 367 ESRTCYTL-RGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQK 425
                  L   HT  +  +          + SDD  +++W+           GH      
Sbjct: 155 NFNMVKVLDEAHTQCIRGISFSGTDSKFVTCSDDNILKIWNFSNGQQESTLSGH------ 208

Query: 426 VIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLL--SCSLDNTIKL 483
                                          V++ ++     +PT  L  S S DN +KL
Sbjct: 209 ----------------------------HWDVRSCDW-----HPTMGLIASGSKDNLVKL 235

Query: 484 WNVKTGACIRTQFG--HVEGVWDIAADNFRIVSG------SHDRSCKVWDLQ 527
           W+ + G CI T  G  H      I +  F+   G      S D+SC+++D++
Sbjct: 236 WDPRAGQCISTILGCKHT-----IISTKFQPTKGNMLAVISKDKSCRIFDIR 282

>CAGL0A02772g complement(289274..290599) similar to sp|P40968
           Saccharomyces cerevisiae YDR364c CDC40, hypothetical
           start
          Length = 441

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 81/184 (44%), Gaps = 21/184 (11%)

Query: 246 RKGIYRIQEFKGHMDGVXXXXXXXXX---XXTGSYDSTVAIWDLATG-KLIRRLSGHTDG 301
           +K IYR   +KGH +G               +G  D+TV +WD     K +R   GH+  
Sbjct: 138 KKVIYR---YKGHHNGTTSLRLLPGTGHLILSGGNDNTVKLWDFYHDRKCLRDFVGHSKP 194

Query: 302 VKALRF--DDQKLITGSLDKTIRVWNYVTGAC---VSTYRGHQDSVLSVDSFRKLIVSGS 356
           +K L F  D  + ++GS D+ +++W+  TG     ++TY     +     S  + +V  S
Sbjct: 195 IKTLDFTSDSSQFLSGSYDQQVKIWDTETGKVTKRLNTYSTPNSAEFRPTSGNEFVVGLS 254

Query: 357 ADKTVKVWHVESRTC------YTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTN 410
           + K   + H ++R             H   +  +K  P      S S+D T+R+W+ + N
Sbjct: 255 SSK---IKHYDTRVSEKDGLVQVYDHHLSSILAIKYFPDGSKFISSSEDKTLRIWNNQVN 311

Query: 411 TCVR 414
             ++
Sbjct: 312 IPIK 315

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 48/96 (50%), Gaps = 6/96 (6%)

Query: 466 LPYPTHL-LSCSLDNTIKLWNV-KTGACIRTQFGHVEGV--WDIAADNFRIVSGSHDRSC 521
           LP   HL LS   DNT+KLW+      C+R   GH + +   D  +D+ + +SGS+D+  
Sbjct: 157 LPGTGHLILSGGNDNTVKLWDFYHDRKCLRDFVGHSKPIKTLDFTSDSSQFLSGSYDQQV 216

Query: 522 KVWDLQTGKCMHTFVGIHAPVACV--GIGDSEFVSG 555
           K+WD +TGK          P +        +EFV G
Sbjct: 217 KIWDTETGKVTKRLNTYSTPNSAEFRPTSGNEFVVG 252

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 80/214 (37%), Gaps = 47/214 (21%)

Query: 290 KLIRRLSGHTDGVKALRF---DDQKLITGSLDKTIRVWN-YVTGACVSTYRGHQDSVLSV 345
           K+I R  GH +G  +LR        +++G  D T+++W+ Y    C+  + GH   + ++
Sbjct: 139 KVIYRYKGHHNGTTSLRLLPGTGHLILSGGNDNTVKLWDFYHDRKCLRDFVGHSKPIKTL 198

Query: 346 D--SFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFS-GSDDMTI 402
           D  S     +SGS D+ VK+W  E+             N  +  P S   F  G     I
Sbjct: 199 DFTSDSSQFLSGSYDQQVKIWDTETGKVTKRLNTYSTPNSAEFRPTSGNEFVVGLSSSKI 258

Query: 403 RMWDIRT---NTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQA 459
           + +D R    +  V+V+  H+  +  +     GS  I                       
Sbjct: 259 KHYDTRVSEKDGLVQVYDHHLSSILAIKYFPDGSKFI----------------------- 295

Query: 460 ANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIR 493
                         S S D T+++WN +    I+
Sbjct: 296 --------------SSSEDKTLRIWNNQVNIPIK 315

>Kwal_56.24163
          Length = 729

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 59/122 (48%), Gaps = 14/122 (11%)

Query: 278 DSTVAIWDLATGKLIRRLSGH-TDGVKALRF----DDQKLITGSLDKTIRVWNYVTGACV 332
           D TV IW L        L  H T GV  + +    D   LIT S D+T+++W+Y T +CV
Sbjct: 19  DHTVKIWSLGQPTANFTLQAHETRGVNYVDYYPLQDKPYLITSSDDRTVKIWDYQTKSCV 78

Query: 333 STYRGHQDSVLSVDSFR---KLIVSGSADKTVKVWHVES---RTCYTLRGHTGWVNCVKL 386
           +T  GH  +V S   F     +I+SGS D T+KVW+  +        L     W  C+  
Sbjct: 79  ATLEGHMANV-SYAVFHPSLPIILSGSEDGTLKVWNSNTYKLEKTLNLGLERSW--CIAT 135

Query: 387 HP 388
           HP
Sbjct: 136 HP 137

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 55/108 (50%), Gaps = 6/108 (5%)

Query: 308 DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQD-SVLSVDSF----RKLIVSGSADKTVK 362
           D     +  LD T+++W+        T + H+   V  VD +    +  +++ S D+TVK
Sbjct: 9   DPSTFASACLDHTVKIWSLGQPTANFTLQAHETRGVNYVDYYPLQDKPYLITSSDDRTVK 68

Query: 363 VWHVESRTCY-TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRT 409
           +W  ++++C  TL GH   V+    HP      SGS+D T+++W+  T
Sbjct: 69  IWDYQTKSCVATLEGHMANVSYAVFHPSLPIILSGSEDGTLKVWNSNT 116

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 64/159 (40%), Gaps = 41/159 (25%)

Query: 352 IVSGSADKTVKVWHVESRTC-YTLRGH-TGWVNCVKLHPKSFTCF--SGSDDMTIRMWDI 407
             S   D TVK+W +   T  +TL+ H T  VN V  +P     +  + SDD T+++WD 
Sbjct: 13  FASACLDHTVKIWSLGQPTANFTLQAHETRGVNYVDYYPLQDKPYLITSSDDRTVKIWDY 72

Query: 408 RTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLP 467
           +T +CV    GH+  V   +                                  F  SLP
Sbjct: 73  QTKSCVATLEGHMANVSYAV----------------------------------FHPSLP 98

Query: 468 YPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA 506
               +LS S D T+K+WN  T    +T    +E  W IA
Sbjct: 99  I---ILSGSEDGTLKVWNSNTYKLEKTLNLGLERSWCIA 134

 Score = 42.4 bits (98), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 39/67 (58%), Gaps = 2/67 (2%)

Query: 471 HLLSCSLDNTIKLWNVKTGACIRTQFGHVEGV-WDIAADNFRIV-SGSHDRSCKVWDLQT 528
           +L++ S D T+K+W+ +T +C+ T  GH+  V + +   +  I+ SGS D + KVW+  T
Sbjct: 57  YLITSSDDRTVKIWDYQTKSCVATLEGHMANVSYAVFHPSLPIILSGSEDGTLKVWNSNT 116

Query: 529 GKCMHTF 535
            K   T 
Sbjct: 117 YKLEKTL 123

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 40/80 (50%), Gaps = 5/80 (6%)

Query: 469 PTHLLSCSLDNTIKLWNV-KTGACIRTQFGHVEGV----WDIAADNFRIVSGSHDRSCKV 523
           P+   S  LD+T+K+W++ +  A    Q     GV    +    D   +++ S DR+ K+
Sbjct: 10  PSTFASACLDHTVKIWSLGQPTANFTLQAHETRGVNYVDYYPLQDKPYLITSSDDRTVKI 69

Query: 524 WDLQTGKCMHTFVGIHAPVA 543
           WD QT  C+ T  G  A V+
Sbjct: 70  WDYQTKSCVATLEGHMANVS 89

 Score = 36.2 bits (82), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWN 325
           T S D TV IWD  T   +  L GH   V    F      +++GS D T++VWN
Sbjct: 60  TSSDDRTVKIWDYQTKSCVATLEGHMANVSYAVFHPSLPIILSGSEDGTLKVWN 113

>ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH]
           complement(375532..376881) [1350 bp, 449 aa]
          Length = 449

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 69/143 (48%), Gaps = 10/143 (6%)

Query: 274 TGSYDSTVAIW--DLATGKLIRRLSGHTDGVKALRFD--DQKLITGSLDKTIRVWNYVTG 329
           +G  D T+ IW  +    K++ R   HT+ ++ + F   DQK +T S D  +++WN+  G
Sbjct: 138 SGDADGTIKIWQPNFNMVKVLDR--AHTECMRDISFSYSDQKFVTCSDDNVLKIWNFSNG 195

Query: 330 ACVSTYRGHQDSVLSVDSFRK--LIVSGSADKTVKVWHVES-RTCYTLRGHTGWVNCVKL 386
                  GH   V S D   K  LIVSGS D  +K+W   + R   T+ G    V   K 
Sbjct: 196 QQERVLSGHHWDVKSCDWHPKMGLIVSGSKDNLIKLWDPRTGRNVSTILGLKHTVIKTKF 255

Query: 387 HPKSFTCFS-GSDDMTIRMWDIR 408
            P      +  S D +I+++D+R
Sbjct: 256 QPTQGNLLAVVSKDKSIKIYDMR 278

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 62/149 (41%), Gaps = 5/149 (3%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGACV 332
            +Y    ++W+ ++      +  H   V  +++      LI+G  D TI++W        
Sbjct: 97  ATYSGEFSLWNGSSFNFESIMQAHDSAVTVMQYSHAGDWLISGDADGTIKIWQPNFNMVK 156

Query: 333 STYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWHVES-RTCYTLRGHTGWVNCVKLHPK 389
              R H + +  +S     +  V+ S D  +K+W+  + +    L GH   V     HPK
Sbjct: 157 VLDRAHTECMRDISFSYSDQKFVTCSDDNVLKIWNFSNGQQERVLSGHHWDVKSCDWHPK 216

Query: 390 SFTCFSGSDDMTIRMWDIRTNTCVRVFHG 418
                SGS D  I++WD RT   V    G
Sbjct: 217 MGLIVSGSKDNLIKLWDPRTGRNVSTILG 245

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 40/72 (55%), Gaps = 8/72 (11%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFR-----IVSGSHDRSCKVWDL 526
            ++CS DN +K+WN   G   R   GH    WD+ + ++      IVSGS D   K+WD 
Sbjct: 178 FVTCSDDNVLKIWNFSNGQQERVLSGHH---WDVKSCDWHPKMGLIVSGSKDNLIKLWDP 234

Query: 527 QTGKCMHTFVGI 538
           +TG+ + T +G+
Sbjct: 235 RTGRNVSTILGL 246

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 49/228 (21%), Positives = 85/228 (37%), Gaps = 51/228 (22%)

Query: 310 QKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKL---IVSGSADKTVKVWHV 366
           ++L+  +      +WN  +    S  + H DS ++V  +      ++SG AD T+K+W  
Sbjct: 92  RRLVVATYSGEFSLWNGSSFNFESIMQAH-DSAVTVMQYSHAGDWLISGDADGTIKIWQP 150

Query: 367 ESRTCYTL-RGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQK 425
                  L R HT  +  +          + SDD  +++W+       RV  GH      
Sbjct: 151 NFNMVKVLDRAHTECMRDISFSYSDQKFVTCSDDNVLKIWNFSNGQQERVLSGH------ 204

Query: 426 VIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWN 485
                                          V++ ++    P    ++S S DN IKLW+
Sbjct: 205 ----------------------------HWDVKSCDWH---PKMGLIVSGSKDNLIKLWD 233

Query: 486 VKTGACIRTQFGHVEGVWDIAADNFRIVSG------SHDRSCKVWDLQ 527
            +TG  + T  G    V       F+   G      S D+S K++D++
Sbjct: 234 PRTGRNVSTILGLKHTV---IKTKFQPTQGNLLAVVSKDKSIKIYDMR 278

 Score = 30.0 bits (66), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 29/70 (41%), Gaps = 2/70 (2%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQTG 529
           L+S   D TIK+W             H E + DI+    + + V+ S D   K+W+   G
Sbjct: 136 LISGDADGTIKIWQPNFNMVKVLDRAHTECMRDISFSYSDQKFVTCSDDNVLKIWNFSNG 195

Query: 530 KCMHTFVGIH 539
           +      G H
Sbjct: 196 QQERVLSGHH 205

>Scas_717.68
          Length = 908

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 55/111 (49%), Gaps = 6/111 (5%)

Query: 309 DQKLI-TGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVD-SFRKLIVSGSADKTVKVWHV 366
           DQK+  T  L+    V+N    +C   ++ H   VL +D S    +++ S D+TVK+WH+
Sbjct: 300 DQKISSTNELNLYAPVFN---PSCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHL 356

Query: 367 ESRTCYTLRGHTGWVNCVKLHPKSFTCF-SGSDDMTIRMWDIRTNTCVRVF 416
           E +T      H  +V CV+ HP     F SG  D  +R+W I  N     F
Sbjct: 357 ERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEF 407

 Score = 36.6 bits (83), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 69/172 (40%), Gaps = 29/172 (16%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF---DDQKLITGSLDKTIRVW------ 324
           T S D TV +W L     ++    H D V  +RF   DD+  I+G LD  +R+W      
Sbjct: 344 TSSMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENE 402

Query: 325 --------NYVTGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHV-----ESRTC 371
                   + +T   +S   G    V + + +  ++++   ++ V  +HV     + R  
Sbjct: 403 ITFEFDCQDLITSLTLSPGDGKYTIVGTFNGYVHVLLTKGLEQ-VSSFHVVDKNTQERNT 461

Query: 372 YTLRGHTG----WVNCVKLHP-KSFTCFSGSDDMTIRMWDIRTNTCVRVFHG 418
            + + H G     + C K  P  S      S D  IR++D+     +    G
Sbjct: 462 ASTKIHHGPRVTGLECFKYEPDNSLRIVVTSSDSRIRIFDLEKKKLLEYLKG 513

>YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associated
           splicing factor, member of WD (WD-40) repeat family
           [1398 bp, 465 aa]
          Length = 465

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/244 (24%), Positives = 99/244 (40%), Gaps = 42/244 (17%)

Query: 290 KLIRRLSGHTDGVKALRFDDQKLITGSL--DKTIRVWNYVTGACVSTYRGHQDSVLSVDS 347
           +L+  L GH   +  +++       GS   D T R+W+  T   +    GH   V S+ S
Sbjct: 256 RLLGDLVGHERRISDVKYHPSGKFIGSASHDMTWRLWDASTHQELLLQEGHDKGVFSL-S 314

Query: 348 FR---KLIVSGSADKTVKVWHVESRT-CYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIR 403
           F+    L+ SG  D    +W + S +   TL GH+  +  V   P  +   +G  D  I 
Sbjct: 315 FQCDGSLVCSGGMDSLSMLWDIRSGSKVMTLAGHSKPIYTVAWSPNGYQVATGGGDGIIN 374

Query: 404 MWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFD 463
           +WDIR            GQ+ +++                             V+ +  D
Sbjct: 375 VWDIRKRD--------EGQLNQILA---------------------HRNIVTQVRFSKED 405

Query: 464 HSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGV--WDIAADNFRIVSGSHDRSC 521
                   L+SC  DN I +++  T   + +  GH + +   DI+ ++  +VSG  DRS 
Sbjct: 406 GG----KKLVSCGYDNLINVYSSDTWLKMGSLAGHTDKIISLDISNNSHFLVSGGWDRSI 461

Query: 522 KVWD 525
           K+W+
Sbjct: 462 KLWN 465

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 50/102 (49%), Gaps = 8/102 (7%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGAC 331
           + S+D T  +WD +T + +    GH  GV +L F  D   + +G +D    +W+  +G+ 
Sbjct: 282 SASHDMTWRLWDASTHQELLLQEGHDKGVFSLSFQCDGSLVCSGGMDSLSMLWDIRSGSK 341

Query: 332 VSTYRGHQDSVLSV----DSFRKLIVSGSADKTVKVWHVESR 369
           V T  GH   + +V    + ++  + +G  D  + VW +  R
Sbjct: 342 VMTLAGHSKPIYTVAWSPNGYQ--VATGGGDGIINVWDIRKR 381

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/235 (21%), Positives = 92/235 (39%), Gaps = 48/235 (20%)

Query: 304 ALRFDDQKLITGSLDKTIRVWNYVT-GACVSTYRGHQDSVLSVD---SFRKLIVSGSADK 359
           +L  DD  + TGS    ++V N  T          H   + ++D        ++S + D 
Sbjct: 182 SLSTDDMVVATGSWAGDLQVLNSQTLQPLTQKLDSHVGKIGAIDWHPDSNNQMISCAEDG 241

Query: 360 TVKVWHVES-----RTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVR 414
            +K +   +     R    L GH   ++ VK HP      S S DMT R+WD  T+  + 
Sbjct: 242 LIKNFQYSNEEGGLRLLGDLVGHERRISDVKYHPSGKFIGSASHDMTWRLWDASTHQELL 301

Query: 415 VFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLS 474
           +  GH    + V  L+   D                                   + + S
Sbjct: 302 LQEGH---DKGVFSLSFQCD----------------------------------GSLVCS 324

Query: 475 CSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQ 527
             +D+   LW++++G+ + T  GH + ++ +A   + +++ +G  D    VWD++
Sbjct: 325 GGMDSLSMLWDIRSGSKVMTLAGHSKPIYTVAWSPNGYQVATGGGDGIINVWDIR 379

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 54/101 (53%), Gaps = 10/101 (9%)

Query: 274 TGSYDSTVAIWDLA---TGKLIRRLSGHTDGVKALRFDDQ----KLITGSLDKTIRVWNY 326
           TG  D  + +WD+     G+L + L+ H + V  +RF  +    KL++   D  I V++ 
Sbjct: 366 TGGGDGIINVWDIRKRDEGQLNQILA-HRNIVTQVRFSKEDGGKKLVSCGYDNLINVYSS 424

Query: 327 VTGACVSTYRGHQDSVLSVD--SFRKLIVSGSADKTVKVWH 365
            T   + +  GH D ++S+D  +    +VSG  D+++K+W+
Sbjct: 425 DTWLKMGSLAGHTDKIISLDISNNSHFLVSGGWDRSIKLWN 465

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 39/82 (47%), Gaps = 2/82 (2%)

Query: 467 PYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA--ADNFRIVSGSHDRSCKVW 524
           P    + S S D T +LW+  T   +  Q GH +GV+ ++   D   + SG  D    +W
Sbjct: 275 PSGKFIGSASHDMTWRLWDASTHQELLLQEGHDKGVFSLSFQCDGSLVCSGGMDSLSMLW 334

Query: 525 DLQTGKCMHTFVGIHAPVACVG 546
           D+++G  + T  G   P+  V 
Sbjct: 335 DIRSGSKVMTLAGHSKPIYTVA 356

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 66/143 (46%), Gaps = 11/143 (7%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVT--G 329
           +G  DS   +WD+ +G  +  L+GH+  +  + +  +  ++ TG  D  I VW+      
Sbjct: 324 SGGMDSLSMLWDIRSGSKVMTLAGHSKPIYTVAWSPNGYQVATGGGDGIINVWDIRKRDE 383

Query: 330 ACVSTYRGHQDSVLSV-----DSFRKLIVSGSADKTVKVWHVES-RTCYTLRGHTGWVNC 383
             ++    H++ V  V     D  +KL+  G  D  + V+  ++     +L GHT  +  
Sbjct: 384 GQLNQILAHRNIVTQVRFSKEDGGKKLVSCG-YDNLINVYSSDTWLKMGSLAGHTDKIIS 442

Query: 384 VKLHPKSFTCFSGSDDMTIRMWD 406
           + +   S    SG  D +I++W+
Sbjct: 443 LDISNNSHFLVSGGWDRSIKLWN 465

>CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces
           cerevisiae YBR175w, start by similarity
          Length = 316

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 71/140 (50%), Gaps = 14/140 (10%)

Query: 291 LIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSV--- 345
           L+ RL GHT  V +L ++++   L T S+D++I+VW+ +TG  + T   H + V+S+   
Sbjct: 88  LLHRLVGHTAPVISLCYNNKGNLLFTSSMDESIKVWDVLTGTVMKTMSAHSEPVVSIDLS 147

Query: 346 DSFRKLIVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHPKSFTCFSG-------- 396
           D+   ++ SGS D  ++++   +  C  TL     W +   + P +   FS         
Sbjct: 148 DNDGSILSSGSHDGLIRIFDTATGHCLKTLTYDKDWQSETGVVPIAKVKFSANTKYLLVK 207

Query: 397 SDDMTIRMWDIRTNTCVRVF 416
           S D  +++WD  +   VR F
Sbjct: 208 SYDGVVKIWDSVSGDVVRTF 227

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 52/104 (50%), Gaps = 13/104 (12%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK---LITGSLDKTIRVWNYVTGA 330
           T S D ++ +WD+ TG +++ +S H++ V ++   D     L +GS D  IR+++  TG 
Sbjct: 113 TSSMDESIKVWDVLTGTVMKTMSAHSEPVVSIDLSDNDGSILSSGSHDGLIRIFDTATGH 172

Query: 331 CVSTYRGHQD----------SVLSVDSFRKLIVSGSADKTVKVW 364
           C+ T    +D          + +   +  K ++  S D  VK+W
Sbjct: 173 CLKTLTYDKDWQSETGVVPIAKVKFSANTKYLLVKSYDGVVKIW 216

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 37/67 (55%), Gaps = 3/67 (4%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAA---DNFRIVSGSHDRSCKVWDLQT 528
           L + S+D +IK+W+V TG  ++T   H E V  I     D   + SGSHD   +++D  T
Sbjct: 111 LFTSSMDESIKVWDVLTGTVMKTMSAHSEPVVSIDLSDNDGSILSSGSHDGLIRIFDTAT 170

Query: 529 GKCMHTF 535
           G C+ T 
Sbjct: 171 GHCLKTL 177

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/196 (25%), Positives = 78/196 (39%), Gaps = 46/196 (23%)

Query: 350 KLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRT 409
           K I S S D TV V H +    + L GHT  V  +  + K    F+ S D +I++WD+ T
Sbjct: 68  KCIASCSDDFTVVVTHRQLGLLHRLVGHTAPVISLCYNNKGNLLFTSSMDESIKVWDVLT 127

Query: 410 NTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYP 469
            T ++    H   V                                S+  ++ D S+   
Sbjct: 128 GTVMKTMSAHSEPV-------------------------------VSIDLSDNDGSI--- 153

Query: 470 THLLSCSLDNTIKLWNVKTGACIRT-----QFGHVEGVWDIAADNFR-----IVSGSHDR 519
             L S S D  I++++  TG C++T      +    GV  IA   F      ++  S+D 
Sbjct: 154 --LSSGSHDGLIRIFDTATGHCLKTLTYDKDWQSETGVVPIAKVKFSANTKYLLVKSYDG 211

Query: 520 SCKVWDLQTGKCMHTF 535
             K+WD  +G  + TF
Sbjct: 212 VVKIWDSVSGDVVRTF 227

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 39/82 (47%), Gaps = 3/82 (3%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADN--FRIVSGSHDRSCKVWDLQTG 529
           + SCS D T+ + + + G   R   GH   V  +  +N    + + S D S KVWD+ TG
Sbjct: 70  IASCSDDFTVVVTHRQLGLLHRL-VGHTAPVISLCYNNKGNLLFTSSMDESIKVWDVLTG 128

Query: 530 KCMHTFVGIHAPVACVGIGDSE 551
             M T      PV  + + D++
Sbjct: 129 TVMKTMSAHSEPVVSIDLSDND 150

 Score = 34.3 bits (77), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 39/73 (53%), Gaps = 10/73 (13%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTD--------GVKALRF--DDQKLITGSLDKTIRV 323
           +GS+D  + I+D ATG  ++ L+   D         +  ++F  + + L+  S D  +++
Sbjct: 156 SGSHDGLIRIFDTATGHCLKTLTYDKDWQSETGVVPIAKVKFSANTKYLLVKSYDGVVKI 215

Query: 324 WNYVTGACVSTYR 336
           W+ V+G  V T++
Sbjct: 216 WDSVSGDVVRTFK 228

>AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH]
           (1107932..1109335) [1404 bp, 467 aa]
          Length = 467

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 60/267 (22%), Positives = 105/267 (39%), Gaps = 25/267 (9%)

Query: 290 KLIRRLSGHTDGVKALRF---DDQKLITGSLDKTIRVWN-YVTGACVSTYRGHQDSVLSV 345
           +++    GH  G  AL F        ++G  D  +++W+ Y     +  Y GH+ ++ S 
Sbjct: 165 RILHVYDGHDRGTTALEFLRKTGHLFLSGGNDGVLKIWDMYHERLLLRDYCGHRKAI-SA 223

Query: 346 DSFRK---LIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFT-CFSGSDDMT 401
            SF        S S DKTVK+W  E+             NC+  HP++      G  D  
Sbjct: 224 TSFSHDNVQFASSSYDKTVKIWDTETGDIINRLSFKATPNCMTFHPQNKEQLLVGFSDSK 283

Query: 402 IRMWDIRTNT---CVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQ 458
           IR +D+R +     ++++  H+  +  +     GS  I                      
Sbjct: 284 IRHFDLRVDKKDGVIQIYDHHLAAINALRYFPDGSKFISSSDDKSIRIWENQINIPIKQI 343

Query: 459 AANFDHSLP----YPTH--LLSCSLDNTIKLWNVKTGAC--IRTQF-GH----VEGVWDI 505
           +    +  P    +P H    + S+DN+I ++++K       R  F GH       ++DI
Sbjct: 344 SDTDQYPAPWIQLHPEHNQFAAQSMDNSIYVYSMKPKYKRHPRKAFRGHKSAGYNSMFDI 403

Query: 506 AADNFRIVSGSHDRSCKVWDLQTGKCM 532
           A D   + +G       +WD +T K +
Sbjct: 404 APDGRYVAAGDTSGRLFIWDWKTTKIL 430

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 68/159 (42%), Gaps = 14/159 (8%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF---DDQKLITGSLDKTIRVWNYVTGA 330
           + SYD TV IWD  TG +I RLS        + F   + ++L+ G  D  IR ++     
Sbjct: 235 SSSYDKTVKIWDTETGDIINRLSFKAT-PNCMTFHPQNKEQLLVGFSDSKIRHFDLRVDK 293

Query: 331 CVSTYRGHQDSVLSVDSFRKL-----IVSGSADKTVKVWHVESRTCYTLRGHTGWVNC-- 383
                + +   + ++++ R        +S S DK++++W  +          T       
Sbjct: 294 KDGVIQIYDHHLAAINALRYFPDGSKFISSSDDKSIRIWENQINIPIKQISDTDQYPAPW 353

Query: 384 VKLHPKSFTCFSGSDDMTIRMWDIRTNT---CVRVFHGH 419
           ++LHP+     + S D +I ++ ++        + F GH
Sbjct: 354 IQLHPEHNQFAAQSMDNSIYVYSMKPKYKRHPRKAFRGH 392

>Scas_720.45
          Length = 755

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 60/126 (47%), Gaps = 14/126 (11%)

Query: 274 TGSYDSTVAIWDLATGKLIRRL-SGHTDGVKALRF----DDQKLITGSLDKTIRVWNYVT 328
           +G  D TV +W L        L SG   GV  + +    D   LIT S D T +VW+Y T
Sbjct: 15  SGCLDRTVKVWSLGQATPNFTLNSGQEKGVNYVDYYPLPDKPYLITSSDDLTCKVWDYQT 74

Query: 329 GACVSTYRGHQDSVLSVDSFR---KLIVSGSADKTVKVWHVES---RTCYTLRGHTGWVN 382
            +CV+T  GH  +V S   F     +I+SGS D T+K+W+  +       +L     W  
Sbjct: 75  KSCVATLEGHMANV-SFAVFHPTLPIIISGSEDGTLKIWNSATYKVEKTLSLGLERSW-- 131

Query: 383 CVKLHP 388
           C+  HP
Sbjct: 132 CIATHP 137

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 54/108 (50%), Gaps = 6/108 (5%)

Query: 308 DDQKLITGSLDKTIRVWNYVTGACVSTYR-GHQDSVLSVDSF----RKLIVSGSADKTVK 362
           D     +G LD+T++VW+        T   G +  V  VD +    +  +++ S D T K
Sbjct: 9   DPNTFASGCLDRTVKVWSLGQATPNFTLNSGQEKGVNYVDYYPLPDKPYLITSSDDLTCK 68

Query: 363 VWHVESRTCY-TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRT 409
           VW  ++++C  TL GH   V+    HP      SGS+D T+++W+  T
Sbjct: 69  VWDYQTKSCVATLEGHMANVSFAVFHPTLPIIISGSEDGTLKIWNSAT 116

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 66/160 (41%), Gaps = 43/160 (26%)

Query: 352 IVSGSADKTVKVWHV-ESRTCYTLR-GHTGWVNCVKLHP---KSFTCFSGSDDMTIRMWD 406
             SG  D+TVKVW + ++   +TL  G    VN V  +P   K +   + SDD+T ++WD
Sbjct: 13  FASGCLDRTVKVWSLGQATPNFTLNSGQEKGVNYVDYYPLPDKPY-LITSSDDLTCKVWD 71

Query: 407 IRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSL 466
            +T +CV    GH+  V   +                                  F  +L
Sbjct: 72  YQTKSCVATLEGHMANVSFAV----------------------------------FHPTL 97

Query: 467 PYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA 506
           P    ++S S D T+K+WN  T    +T    +E  W IA
Sbjct: 98  PI---IISGSEDGTLKIWNSATYKVEKTLSLGLERSWCIA 134

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 63/156 (40%), Gaps = 37/156 (23%)

Query: 383 CVKLHPKSFTCF-SGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXX 441
           CV  +PK    F SG  D T+++W +             GQ      L  G +       
Sbjct: 2   CVAFNPKDPNTFASGCLDRTVKVWSL-------------GQATPNFTLNSGQE------- 41

Query: 442 XXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEG 501
                          V   ++ + LP   +L++ S D T K+W+ +T +C+ T  GH+  
Sbjct: 42  -------------KGVNYVDY-YPLPDKPYLITSSDDLTCKVWDYQTKSCVATLEGHMAN 87

Query: 502 V-WDIAADNFR-IVSGSHDRSCKVWDLQTGKCMHTF 535
           V + +       I+SGS D + K+W+  T K   T 
Sbjct: 88  VSFAVFHPTLPIIISGSEDGTLKIWNSATYKVEKTL 123

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 38/80 (47%), Gaps = 5/80 (6%)

Query: 469 PTHLLSCSLDNTIKLWNV-KTGACIRTQFGHVEGV----WDIAADNFRIVSGSHDRSCKV 523
           P    S  LD T+K+W++ +         G  +GV    +    D   +++ S D +CKV
Sbjct: 10  PNTFASGCLDRTVKVWSLGQATPNFTLNSGQEKGVNYVDYYPLPDKPYLITSSDDLTCKV 69

Query: 524 WDLQTGKCMHTFVGIHAPVA 543
           WD QT  C+ T  G  A V+
Sbjct: 70  WDYQTKSCVATLEGHMANVS 89

>Sklu_1880.3 YDR364C, Contig c1880 4293-5708
          Length = 471

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 65/270 (24%), Positives = 112/270 (41%), Gaps = 25/270 (9%)

Query: 290 KLIRRLSGHTDGVKALRFDDQK---LITGSLDKTIRVWN-YVTGACVSTYRGHQDSV--L 343
           K+I    GH +G   L+F  +     ++G  D  I +W+ Y     +  YRGH+ +V  +
Sbjct: 169 KIIYTFKGHVNGTTKLKFLPETGHLFLSGGNDNVINIWDMYHERTLLRDYRGHRKAVRDI 228

Query: 344 SVDSFRKLIVSGSADKTVKVWHVES-RTCYTLRGHTGWVNCVKLHPKSFTCF-SGSDDMT 401
           + +S     +S S D+T+KVW  E+ +    L+ H+   NC   HP +   +  G  +  
Sbjct: 229 NFNSDGTEFLSVSFDQTLKVWDTETGKVKSRLKWHS-VPNCATYHPTNNNEYIVGLSNSE 287

Query: 402 IRMWDIRTNT---CVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQ 458
           IR +D R +     ++ ++ H+  +  +     GS  I                      
Sbjct: 288 IRHYDSRVSNKEGLIQTYNHHLSSIISLKYFPDGSKFISSSEDKTVRIWENQVNIPIKQI 347

Query: 459 AANFDHSLPY-----PTHLLSC-SLDNTIKLWNVKTGACIRTQF---GHVEGVWDI---- 505
           +    +S+PY       H  S  S+DN I  +++K       +    GH+   + I    
Sbjct: 348 SDTSQYSMPYLEIHPEQHYFSAQSMDNAIYSFSMKPKYKKNLKKVFRGHLCAGFGINFGF 407

Query: 506 AADNFRIVSGSHDRSCKVWDLQTGKCMHTF 535
           + D   IVSG    S  VWD +T + +  F
Sbjct: 408 SPDGQYIVSGDSRGSVVVWDWKTTRTLKRF 437

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 80/179 (44%), Gaps = 20/179 (11%)

Query: 252 IQEFKGHMDGVXXXXXXXXX---XXTGSYDSTVAIWDLATGK-LIRRLSGHTDGVKALRF 307
           I  FKGH++G               +G  D+ + IWD+   + L+R   GH   V+ + F
Sbjct: 171 IYTFKGHVNGTTKLKFLPETGHLFLSGGNDNVINIWDMYHERTLLRDYRGHRKAVRDINF 230

Query: 308 --DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKL----IVSGSADKTV 361
             D  + ++ S D+T++VW+  TG   S  + H  SV +  ++        + G ++  +
Sbjct: 231 NSDGTEFLSVSFDQTLKVWDTETGKVKSRLKWH--SVPNCATYHPTNNNEYIVGLSNSEI 288

Query: 362 KVWHVESRTC------YTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVR 414
           +  H +SR         T   H   +  +K  P      S S+D T+R+W+ + N  ++
Sbjct: 289 R--HYDSRVSNKEGLIQTYNHHLSSIISLKYFPDGSKFISSSEDKTVRIWENQVNIPIK 345

>YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein
           required for the second catalytic step of mRNA splicing,
           member of WD (WD-40) repeat family [1368 bp, 455 aa]
          Length = 455

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 77/180 (42%), Gaps = 22/180 (12%)

Query: 252 IQEFKGHMDGVXXXXXXXXXXX---TGSYDSTVAIWDLATG-KLIRRLSGHTDGVKALRF 307
           I+ + GH +G               +G  D T+ IWD     + +R   GH   +KALRF
Sbjct: 155 IRNYPGHPEGTTALKFLPKTGHLILSGGNDHTIKIWDFYHDYECLRDFQGHNKPIKALRF 214

Query: 308 --DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFR-----KLIVSGSADKT 360
             D Q  ++ S D+++++W+  TG   +  R H +S  +    R     + IV  S    
Sbjct: 215 TEDCQSFLSSSFDRSVKIWDTETGKVKT--RLHLNSTPADVESRPTNPHEFIVGLS---N 269

Query: 361 VKVWHVESRTC------YTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVR 414
            K+ H + R         T   H   +  +K  P      S S+D T+R+W+ + N  ++
Sbjct: 270 SKILHYDDRVSENQGLVQTYDHHLSSILALKYFPDGSKFISSSEDKTVRIWENQINVPIK 329

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 60/270 (22%), Positives = 104/270 (38%), Gaps = 27/270 (10%)

Query: 290 KLIRRLSGHTDGVKALRFDDQK---LITGSLDKTIRVWN-YVTGACVSTYRGHQDSV--L 343
           K+IR   GH +G  AL+F  +    +++G  D TI++W+ Y    C+  ++GH   +  L
Sbjct: 153 KVIRNYPGHPEGTTALKFLPKTGHLILSGGNDHTIKIWDFYHDYECLRDFQGHNKPIKAL 212

Query: 344 SVDSFRKLIVSGSADKTVKVWHVES---RTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDM 400
                 +  +S S D++VK+W  E+   +T   L      V     +P  F    G  + 
Sbjct: 213 RFTEDCQSFLSSSFDRSVKIWDTETGKVKTRLHLNSTPADVESRPTNPHEFIV--GLSNS 270

Query: 401 TIRMWDIRTNT---CVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSV 457
            I  +D R +     V+ +  H+  +  +     GS  I                     
Sbjct: 271 KILHYDDRVSENQGLVQTYDHHLSSILALKYFPDGSKFISSSEDKTVRIWENQINVPIKQ 330

Query: 458 QAANFDHSLPY----PTHLLSC--SLDNTIKLWNVKTGACIRTQ---FGHVEGVWDI--- 505
            +    HS+P+    P+    C  S+DN I  +++K       +    GH    + I   
Sbjct: 331 ISDTAQHSMPFLNVHPSQNYFCAQSMDNRIYSFSLKPKYKRHPKKIFKGHSSAGYGISLA 390

Query: 506 -AADNFRIVSGSHDRSCKVWDLQTGKCMHT 534
            + D   I SG        WD  T + ++ 
Sbjct: 391 FSGDGRYICSGDSKSRLFTWDWNTSRLLNN 420

>KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces
           cerevisiae YNL317w PFS2 polyadenylation factor I subunit
           2 required for mRNA 3 -end processing, bridges two mRNA
           3 -end processing factors singleton, start by similarity
          Length = 452

 Score = 55.8 bits (133), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 78/140 (55%), Gaps = 9/140 (6%)

Query: 276 SYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGACVS 333
           S D+ + IW+ + G+  R LSGH   VK+  +  +   +++GS D  I+ W+  +G+CVS
Sbjct: 184 SDDNVLKIWNFSNGQQERVLSGHHWDVKSCDWHPKMGLIVSGSKDNLIKFWDPRSGSCVS 243

Query: 334 TYRGHQDSVLSVDSFRK---LIVSGSADKTVKVWHV--ESRTCYTLRGHTGWVNCVKLHP 388
           T  G + +++S     K   L+   S DKT KV+ +  +++  +++R    ++  ++ HP
Sbjct: 244 TMLGFKHTIISTKFQPKQGNLLSVISKDKTCKVYDIRQQAKELFSVRDDVDYM-TLQWHP 302

Query: 389 KSFTCFS-GSDDMTIRMWDI 407
              T F+ G  D +I+ +D+
Sbjct: 303 IDETVFTVGCYDGSIKHFDL 322

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 62/149 (41%), Gaps = 5/149 (3%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGACV 332
            +Y+   ++W  ++      +  H   V  + +      +++GS D  +++W        
Sbjct: 99  ATYNGEFSLWSGSSFNFESIMQAHDSAVTVMTYSHTGDWMVSGSADGELKIWQPNFNMVK 158

Query: 333 STYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWHVES-RTCYTLRGHTGWVNCVKLHPK 389
              + H + V  +S     +  VS S D  +K+W+  + +    L GH   V     HPK
Sbjct: 159 VMDQAHMECVREISFSPTDQKFVSCSDDNVLKIWNFSNGQQERVLSGHHWDVKSCDWHPK 218

Query: 390 SFTCFSGSDDMTIRMWDIRTNTCVRVFHG 418
                SGS D  I+ WD R+ +CV    G
Sbjct: 219 MGLIVSGSKDNLIKFWDPRSGSCVSTMLG 247

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 39/77 (50%), Gaps = 8/77 (10%)

Query: 467 PYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFR-----IVSGSHDRSC 521
           P     +SCS DN +K+WN   G   R   GH    WD+ + ++      IVSGS D   
Sbjct: 175 PTDQKFVSCSDDNVLKIWNFSNGQQERVLSGHH---WDVKSCDWHPKMGLIVSGSKDNLI 231

Query: 522 KVWDLQTGKCMHTFVGI 538
           K WD ++G C+ T +G 
Sbjct: 232 KFWDPRSGSCVSTMLGF 248

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/228 (21%), Positives = 90/228 (39%), Gaps = 51/228 (22%)

Query: 310 QKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKL---IVSGSADKTVKVWHV 366
           ++L+  + +    +W+  +    S  + H DS ++V ++      +VSGSAD  +K+W  
Sbjct: 94  RRLVVATYNGEFSLWSGSSFNFESIMQAH-DSAVTVMTYSHTGDWMVSGSADGELKIWQP 152

Query: 367 ESRTCYTL-RGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQK 425
                  + + H   V  +   P      S SDD  +++W+       RV  GH      
Sbjct: 153 NFNMVKVMDQAHMECVREISFSPTDQKFVSCSDDNVLKIWNFSNGQQERVLSGH------ 206

Query: 426 VIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWN 485
                                          V++ ++    P    ++S S DN IK W+
Sbjct: 207 ----------------------------HWDVKSCDWH---PKMGLIVSGSKDNLIKFWD 235

Query: 486 VKTGACIRTQFGHVEGVWDIAADNFRIVSG------SHDRSCKVWDLQ 527
            ++G+C+ T  G       I +  F+   G      S D++CKV+D++
Sbjct: 236 PRSGSCVSTMLGFKH---TIISTKFQPKQGNLLSVISKDKTCKVYDIR 280

>KLLA0E21879g complement(1944865..1945866) similar to sgd|S0002675
           Saccharomyces cerevisiae YDR267c, start by similarity
          Length = 333

 Score = 55.5 bits (132), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 72/156 (46%), Gaps = 25/156 (16%)

Query: 274 TGSYDSTVAIW-----------DLATGKLIRRLSGHTDGVK--ALRFDDQKLITGSLDKT 320
            GS+DSTV+IW           DL T +L+  + GH + +K  A   D + L T S DK+
Sbjct: 74  AGSFDSTVSIWGKDDDGYNDENDLET-ELLAIIEGHENEIKCVAWSHDGELLATCSRDKS 132

Query: 321 IRVWNYVTGA----CVSTYRGHQDSVLSVDSFRK--LIVSGSADKTVKVWH---VESRTC 371
           + +W          C+S  + H   V  V   +   L+ S S D TV++W     +   C
Sbjct: 133 VWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECC 192

Query: 372 YTLRGHTG--WVNCVKLHPKSFTCFSGSDDMTIRMW 405
             L GH G  W +  +    +    SGSDD T+R+W
Sbjct: 193 AVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 58/269 (21%), Positives = 105/269 (39%), Gaps = 65/269 (24%)

Query: 286 LATGKLIRRLSGHTDGVKALRFDDQKLI-TGSLDKTIRVWNYVTGACVSTY--RGHQDSV 342
           +A  KL++ L+ H D   ++  ++  ++ TGS D+ I++ +  +   +       H+ +V
Sbjct: 1   MAGLKLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTV 60

Query: 343 LSVDSFR---KLIVSGSADKTVKVW-----------HVESRTCYTLRGHTGWVNCVKLHP 388
            SV ++R    ++ +GS D TV +W            +E+     + GH   + CV    
Sbjct: 61  RSV-AWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSH 119

Query: 389 KSFTCFSGSDDMTIRMWDI----RTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXX 444
                 + S D ++ +W+         C+ V   H   V+ VI                 
Sbjct: 120 DGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVI----------------- 162

Query: 445 XXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWN--VKTGACIRTQFGHVEGV 502
                            +  SLP    L S S D+T+++W        C     GH   V
Sbjct: 163 -----------------WHQSLPL---LASSSYDDTVRIWKDCDDDWECCAVLNGHEGTV 202

Query: 503 W----DIAADNFRIVSGSHDRSCKVWDLQ 527
           W    + +  N R+ SGS D + ++W L+
Sbjct: 203 WSSDFEKSNSNVRLCSGSDDGTVRIWCLE 231

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 62/148 (41%), Gaps = 24/148 (16%)

Query: 274 TGSYDSTVAIWDL----ATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYV 327
           T S D +V IW+        + I  L  H+  VK + +      L + S D T+R+W   
Sbjct: 126 TCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDC 185

Query: 328 TG--ACVSTYRGHQDSVLSVDSFRK-----LIVSGSADKTVKVWHVES----------RT 370
                C +   GH+ +V S D F K      + SGS D TV++W +E           + 
Sbjct: 186 DDDWECCAVLNGHEGTVWSSD-FEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQE 244

Query: 371 CYTLRGHTGWVNCVKLHPKSFTCFSGSD 398
               + HT  V  V   PK +   +GSD
Sbjct: 245 SILPKAHTRAVYSVNWSPKGYIASTGSD 272

>Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement
          Length = 711

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 54/189 (28%), Positives = 77/189 (40%), Gaps = 41/189 (21%)

Query: 337 GHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSG 396
           GH+ +V S+ S    ++S S DKT KVWH      Y L GH+  V   K  P+     + 
Sbjct: 97  GHKGNVCSLSSKNNFVISSSWDKTAKVWH-NGSAIYDLVGHSASVWDAKFLPEKDFFLTA 155

Query: 397 SDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXS 456
           S D TI++W    N  ++ F G            +  D+I                    
Sbjct: 156 SADCTIKLW--HGNKLIKTFSG------------IHKDVIR------------------- 182

Query: 457 VQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA-ADNFRIVSG 515
               + D S P      SCS D T+K+ N   G  ++T  GH   V+ +    N  +VS 
Sbjct: 183 ----HLDIS-PDGETFASCSNDGTVKI-NDMDGNILKTFTGHESFVYSVKFLPNGDLVSC 236

Query: 516 SHDRSCKVW 524
             DRS +VW
Sbjct: 237 GEDRSVRVW 245

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/244 (23%), Positives = 100/244 (40%), Gaps = 47/244 (19%)

Query: 292 IRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSF--R 349
           +  L GH   V +L   +  +I+ S DKT +VW+   G+ +    GH  SV        +
Sbjct: 92  VYMLIGHKGNVCSLSSKNNFVISSSWDKTAKVWH--NGSAIYDLVGHSASVWDAKFLPEK 149

Query: 350 KLIVSGSADKTVKVWHVESRTCYTLRG-HTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIR 408
              ++ SAD T+K+WH  ++   T  G H   +  + + P   T  S S+D T+++ D+ 
Sbjct: 150 DFFLTASADCTIKLWH-GNKLIKTFSGIHKDVIRHLDISPDGETFASCSNDGTVKINDMD 208

Query: 409 TNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPY 468
            N  ++ F GH   V  V  L  G                                    
Sbjct: 209 GN-ILKTFTGHESFVYSVKFLPNGD----------------------------------- 232

Query: 469 PTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDI-AADNFRIVSGSHDRSCKVWDLQ 527
              L+SC  D ++++W+ KTGA  +        +WD+    N  I+ GS D   +++ ++
Sbjct: 233 ---LVSCGEDRSVRVWS-KTGAVKQVLRLPAVSIWDLDILPNGDILVGSSDNMVRIFTVE 288

Query: 528 TGKC 531
             + 
Sbjct: 289 ESRI 292

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 67/154 (43%), Gaps = 10/154 (6%)

Query: 257 GHMDGVXXXXXXXXXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LIT 314
           GH   V           + S+D T  +W    G  I  L GH+  V   +F  +K   +T
Sbjct: 97  GHKGNVCSLSSKNNFVISSSWDKTAKVWH--NGSAIYDLVGHSASVWDAKFLPEKDFFLT 154

Query: 315 GSLDKTIRVWNYVTGACVSTYRG-HQDSV--LSVDSFRKLIVSGSADKTVKVWHVESRTC 371
            S D TI++W+      + T+ G H+D +  L +    +   S S D TVK+  ++    
Sbjct: 155 ASADCTIKLWH--GNKLIKTFSGIHKDVIRHLDISPDGETFASCSNDGTVKINDMDGNIL 212

Query: 372 YTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMW 405
            T  GH  +V  VK  P      S  +D ++R+W
Sbjct: 213 KTFTGHESFVYSVKFLPNG-DLVSCGEDRSVRVW 245

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 67/267 (25%), Positives = 99/267 (37%), Gaps = 55/267 (20%)

Query: 290 KLIRRLSGHTDGVKAL-RFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLS---V 345
           KL   L GH   VK++   +D ++ + S D T+RVW+   G        + +  ++    
Sbjct: 3   KLSADLKGHEQDVKSVVAINDSQVASCSRDGTVRVWSNNDGVWNGVIAHNSEKFINSLCY 62

Query: 346 DSFRKLIVSGSADKTV----KVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMT 401
           D   +L+  G  D  V     +   +    Y L GH G  N   L  K+    S S D T
Sbjct: 63  DKSSQLLFYGGQDTLVGGISPLATTDEDPVYMLIGHKG--NVCSLSSKNNFVISSSWDKT 120

Query: 402 IRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAAN 461
            ++W     + +    GH                                    SV  A 
Sbjct: 121 AKVW--HNGSAIYDLVGH----------------------------------SASVWDAK 144

Query: 462 FDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGV---WDIAADNFRIVSGSHD 518
           F   LP     L+ S D TIKLW+      I+T  G  + V    DI+ D     S S+D
Sbjct: 145 F---LPEKDFFLTASADCTIKLWH--GNKLIKTFSGIHKDVIRHLDISPDGETFASCSND 199

Query: 519 RSCKVWDLQTGKCMHTFVGIHAPVACV 545
            + K+ D+  G  + TF G  + V  V
Sbjct: 200 GTVKINDMD-GNILKTFTGHESFVYSV 225

>Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement
          Length = 314

 Score = 55.1 bits (131), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 76/157 (48%), Gaps = 15/157 (9%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGAC 331
           T S D T+ I  +  G+L  RL GHT  V +L +  +   L + S+D++I++W+ +TG  
Sbjct: 73  TASDDFTIEINHITYGRL-HRLVGHTAPVLSLVYTSKGNLLCSASMDESIKIWDVLTGTL 131

Query: 332 VSTYRGHQDSVLSVD---SFRKLIVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLH 387
           + T   H + V+S+D       ++ SGS D  ++++   +  C  TL     W +   + 
Sbjct: 132 LKTISAHSEPVVSIDMPVCDPSILSSGSYDGLIRIFDTTTGHCLKTLTYDKDWKSENGVV 191

Query: 388 PKSFTCFS--------GSDDMTIRMWDIRTNTCVRVF 416
           P S   FS         S D  +++WD    + VR F
Sbjct: 192 PISQVKFSVNGKYLLVKSLDGVLKIWDFIRGSVVRTF 228

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 37/67 (55%), Gaps = 3/67 (4%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDI---AADNFRIVSGSHDRSCKVWDLQT 528
           L S S+D +IK+W+V TG  ++T   H E V  I     D   + SGS+D   +++D  T
Sbjct: 112 LCSASMDESIKIWDVLTGTLLKTISAHSEPVVSIDMPVCDPSILSSGSYDGLIRIFDTTT 171

Query: 529 GKCMHTF 535
           G C+ T 
Sbjct: 172 GHCLKTL 178

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 52/239 (21%), Positives = 87/239 (36%), Gaps = 48/239 (20%)

Query: 309 DQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSV--DSFRKLIVSGSADKTVKVWHV 366
           D K I  S   +  ++N   G        H +S+  +      + I + S D T+++ H+
Sbjct: 26  DGKFIAVSQGTSYLLYNVSDGLSAFIPTSHVESMSDICWSPDSQCIATASDDFTIEINHI 85

Query: 367 ESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKV 426
                + L GHT  V  +    K     S S D +I++WD+ T T ++    H       
Sbjct: 86  TYGRLHRLVGHTAPVLSLVYTSKGNLLCSASMDESIKIWDVLTGTLLKTISAH------- 138

Query: 427 IPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNV 486
                                        S    + D  +  P+ L S S D  I++++ 
Sbjct: 139 -----------------------------SEPVVSIDMPVCDPSILSSGSYDGLIRIFDT 169

Query: 487 KTGACIRT-----QFGHVEGVWDIAADNFRI-----VSGSHDRSCKVWDLQTGKCMHTF 535
            TG C++T      +    GV  I+   F +     +  S D   K+WD   G  + TF
Sbjct: 170 TTGHCLKTLTYDKDWKSENGVVPISQVKFSVNGKYLLVKSLDGVLKIWDFIRGSVVRTF 228

 Score = 38.1 bits (87), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 40/73 (54%), Gaps = 10/73 (13%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTD--------GVKALRF--DDQKLITGSLDKTIRV 323
           +GSYD  + I+D  TG  ++ L+   D         +  ++F  + + L+  SLD  +++
Sbjct: 157 SGSYDGLIRIFDTTTGHCLKTLTYDKDWKSENGVVPISQVKFSVNGKYLLVKSLDGVLKI 216

Query: 324 WNYVTGACVSTYR 336
           W+++ G+ V T++
Sbjct: 217 WDFIRGSVVRTFK 229

>Scas_658.1
          Length = 442

 Score = 55.5 bits (132), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 69/154 (44%), Gaps = 17/154 (11%)

Query: 274 TGSYDSTVAIWDLATGK-LIRRLSGHTDGVKALRFDDQ--KLITGSLDKTIRVWNYVTGA 330
           +G  D+ V +WD    + L+R   GH+  + +L F+D     I+ S D TI++W+   G 
Sbjct: 167 SGGNDNIVKVWDFYHKRNLLRDYKGHSKAINSLDFNDDGTNFISSSFDHTIKIWDTEQGK 226

Query: 331 CVSTYRGHQDSVLSVDSFRKL----IVSGSADKTVKVWHVESRTCYT------LRGHTGW 380
             +  + H  S  +   FR       + G A+   K++H ++R             H   
Sbjct: 227 VKT--KLHFKSTPNDVKFRPFNSSEFIVGFANS--KIYHYDTRISENDGRVQVYDHHMSS 282

Query: 381 VNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVR 414
           +  +K  P      S S+D T+R+WD + N  ++
Sbjct: 283 ILALKFFPDGSKFISSSEDKTVRIWDNQVNVPIK 316

 Score = 35.8 bits (81), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 32/155 (20%), Positives = 55/155 (35%), Gaps = 14/155 (9%)

Query: 351 LIVSGSADKTVKVW--HVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIR 408
           L++SG  D  VKVW  + +       +GH+  +N +  +       S S D TI++WD  
Sbjct: 164 LLLSGGNDNIVKVWDFYHKRNLLRDYKGHSKAINSLDFNDDGTNFISSSFDHTIKIWDTE 223

Query: 409 TNTCVRVFH-GHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSL- 466
                   H        K  P      ++                    VQ   +DH + 
Sbjct: 224 QGKVKTKLHFKSTPNDVKFRPFNSSEFIVGFANSKIYHYDTRISENDGRVQV--YDHHMS 281

Query: 467 --------PYPTHLLSCSLDNTIKLWNVKTGACIR 493
                   P  +  +S S D T+++W+ +    I+
Sbjct: 282 SILALKFFPDGSKFISSSEDKTVRIWDNQVNVPIK 316

>CAGL0K00275g complement(25300..27447) similar to sp|P36037
           Saccharomyces cerevisiae YKL213c DOA1, hypothetical
           start
          Length = 715

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 47/158 (29%), Positives = 68/158 (43%), Gaps = 9/158 (5%)

Query: 257 GHMDGVXXXXXXXXXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGV-KALRFDDQKLITG 315
           GH   V           + S+D T  IWD    KL   L  H   V  +    D  ++T 
Sbjct: 100 GHTGNVCGLRFQNGLLLSSSWDKTAKIWD--NNKLKYDLRNHEASVWDSTMVSDDIILTA 157

Query: 316 SLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSF--RKLIVSGSADKTVKVWHVESRTCYT 373
           S DK+I VW  + G  +       D V+    +    +  S S D T+K+ ++E      
Sbjct: 158 SADKSIGVW--MEGKLIKKLSNIHDDVIRHLEYISNDIFASCSNDGTIKLLNLEGEIKNV 215

Query: 374 LRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNT 411
             GH  +V CVK H  + T FS  +D T+R+W I  +T
Sbjct: 216 FEGHESFVYCVK-HMNN-TLFSCGEDSTVRIWSINGST 251

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 62/134 (46%), Gaps = 6/134 (4%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSG-HTDGVKALRFDDQKLITG-SLDKTIRVWNYVTGAC 331
           T S D ++ +W    GKLI++LS  H D ++ L +    +    S D TI++ N + G  
Sbjct: 156 TASADKSIGVW--MEGKLIKKLSNIHDDVIRHLEYISNDIFASCSNDGTIKLLN-LEGEI 212

Query: 332 VSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSF 391
            + + GH+  V  V      + S   D TV++W +   T   +R     V  + L P   
Sbjct: 213 KNVFEGHESFVYCVKHMNNTLFSCGEDSTVRIWSINGSTKQVIRIPAVSVWNLDLLPNGD 272

Query: 392 TCFSGSDDMTIRMW 405
                SD+ TIR++
Sbjct: 273 FVICCSDN-TIRIF 285

 Score = 33.5 bits (75), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 42/88 (47%), Gaps = 13/88 (14%)

Query: 472 LLSCSLDNTIKLW-NVKTGACIRTQFGHVEGVWD--IAADNFRIVSGSHDRSCKVWDLQT 528
           LLS S D T K+W N K    +R    H   VWD  + +D+  I++ S D+S  VW    
Sbjct: 115 LLSSSWDKTAKIWDNNKLKYDLR---NHEASVWDSTMVSDDI-ILTASADKSIGVW--ME 168

Query: 529 GKCMHTFVGIHAPVACVGIGDSEFVSGD 556
           GK +     IH  V    I   E++S D
Sbjct: 169 GKLIKKLSNIHDDV----IRHLEYISND 192

>CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces
           cerevisiae YDR267c, start by similarity
          Length = 337

 Score = 54.7 bits (130), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 72/154 (46%), Gaps = 23/154 (14%)

Query: 275 GSYDSTVAIW-----DLATG-----KLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIR 322
           GS+DST++IW     DL  G     +L+  + GH + VK + +  D   L T S DK++ 
Sbjct: 77  GSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVW 136

Query: 323 VWNYVTGA----CVSTYRGHQDSVLSV--DSFRKLIVSGSADKTVKVW--HVESRTCYT- 373
           +W          C+S  + H   V  V   +   L+ S S D TV++W  + +   C   
Sbjct: 137 IWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAV 196

Query: 374 LRGHTGWVNCVKLHPKS--FTCFSGSDDMTIRMW 405
           L GH G + C     +       SGSDD T+R+W
Sbjct: 197 LTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230

 Score = 38.1 bits (87), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 65/288 (22%), Positives = 102/288 (35%), Gaps = 76/288 (26%)

Query: 290 KLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGA----CVSTYRGHQDSVL 343
           +L + L  H D V ++ F+  +  L TGS D+ I+V     G      V     H+ +V 
Sbjct: 4   QLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVR 63

Query: 344 SVDSFR---KLIVSGSADKTVKVW-----------HVESRTCYTLRGHTGWVNCVKLHPK 389
           SV ++R    L+ +GS D T+ +W            +E      + GH   V  +     
Sbjct: 64  SV-AWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQD 122

Query: 390 SFTCFSGSDDMTIRMWDI----RTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXX 445
                + S D ++ +W+         C+ V   H   V+ V+  T               
Sbjct: 123 GCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHT--------------- 167

Query: 446 XXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTG--ACIRTQFGHVEGVW 503
                             H+L     L S S D+T+++W        C     GH   +W
Sbjct: 168 -----------------KHNL-----LASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIW 205

Query: 504 --DIA--ADNFRIVSGSHDRSCKVW--------DLQTGKCMHTFVGIH 539
             D +   D  R+ SGS D + +VW        D Q   C  T    H
Sbjct: 206 CSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAH 253

 Score = 30.4 bits (67), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 6/60 (10%)

Query: 274 TGSYDSTVAIWDLATG--KLIRRLSGHTDGVKALRF----DDQKLITGSLDKTIRVWNYV 327
           + SYD TV IW       +    L+GH   +    F    D  +L +GS D T+RVW Y+
Sbjct: 174 SSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYI 233

>YOR272W (YTM1) [5058] chr15 (832810..834192) Microtubule-associated
           protein essential for the G1/S transition, member of WD
           (WD-40) repeat family [1383 bp, 460 aa]
          Length = 460

 Score = 55.1 bits (131), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 74/316 (23%), Positives = 129/316 (40%), Gaps = 42/316 (13%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF-DDQKLITGSLDKTIRVW-------- 324
           +GSYD  V  WDL+ G + ++ SGH+  ++A+++  + +L++   D+T+R+W        
Sbjct: 120 SGSYDGIVRTWDLS-GNVQKQYSGHSGPIRAVKYISNTRLVSAGNDRTLRLWKTKNDDLK 178

Query: 325 ---------------NYVTGACVSTYRGHQDSVLSVD-SFRKLIVSGSADKTVKVWHVES 368
                          N   G  ++   GH+  V+S+D S    I+S S D ++  W    
Sbjct: 179 LTSQQQAQEDDDDEVNIEDGKTLAILEGHKAPVVSIDVSDNSRILSASYDNSIGFWSTIY 238

Query: 369 RTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVI- 427
           +    +       N    + K  T       +T++   IR    + +   H   V++VI 
Sbjct: 239 KEMTVVDPLEDINNP---NNKISTAARKRRKLTMKDGTIRRRAPLSLLESHTAPVEQVIF 295

Query: 428 ---PLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSC-SLDNTIKL 483
                T+G  + +                  +   +    +     +LL+C S    I L
Sbjct: 296 DSTDNTVGYSVSQDHTIKTWDLVTARCIDTRTTSYSLLSIAQLSTLNLLACGSSARHITL 355

Query: 484 WNVKTGACIR-TQ---FGHVEGV--WDIAADNFRIV-SGSHDRSCKVWDLQTGKCMHTFV 536
            + + GA  + TQ    GH   V   D   +N  I+ SGSHD + KVWD+++   M+T  
Sbjct: 356 HDPRVGASSKVTQQQLIGHKNFVSSLDTCPENEYILCSGSHDGTVKVWDVRSTSPMYTIT 415

Query: 537 GIHAPVACVGIGDSEF 552
                V   G+ D  F
Sbjct: 416 REDKSVQK-GVNDKVF 430

 Score = 36.2 bits (82), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 1/70 (1%)

Query: 341 SVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDM 400
           S L V    K I+SGS D  V+ W +         GH+G +  VK +  +    S  +D 
Sbjct: 107 SSLDVGDGSKHIISGSYDGIVRTWDLSGNVQKQYSGHSGPIRAVK-YISNTRLVSAGNDR 165

Query: 401 TIRMWDIRTN 410
           T+R+W  + +
Sbjct: 166 TLRLWKTKND 175

 Score = 33.5 bits (75), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 22/107 (20%), Positives = 45/107 (42%), Gaps = 25/107 (23%)

Query: 471 HLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA-ADNFRIVSGSHDRSCKVW----- 524
           H++S S D  ++ W++ +G   +   GH   +  +    N R+VS  +DR+ ++W     
Sbjct: 117 HIISGSYDGIVRTWDL-SGNVQKQYSGHSGPIRAVKYISNTRLVSAGNDRTLRLWKTKND 175

Query: 525 ------------------DLQTGKCMHTFVGIHAPVACVGIGDSEFV 553
                             +++ GK +    G  APV  + + D+  +
Sbjct: 176 DLKLTSQQQAQEDDDDEVNIEDGKTLAILEGHKAPVVSIDVSDNSRI 222

>Scas_692.25
          Length = 488

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 77/187 (41%), Gaps = 50/187 (26%)

Query: 276 SYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTY 335
           S D+++ IW    G ++     H + V+ L      +++GS D ++R+ ++ +G  +S  
Sbjct: 256 SRDTSIRIWTAEDGMILNSFHPHNEWVRCLDVSGDFVLSGSQDASLRLTHWPSGNGLSIG 315

Query: 336 RGHQDSVLSV----------------DSFRKLI--------------VSGSADKTVKVWH 365
            GH+  + SV                +  RK +               S S D+ +K+W 
Sbjct: 316 IGHEFPIESVKFILPLSTNEKASPTINYLRKPLEIDSDYEKMSFKYCASASRDRLIKIWE 375

Query: 366 VES------------------RTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDI 407
           + +                  +   TL+GH  WV  +++  +    FS SDD TIR W++
Sbjct: 376 IPTPRFVMHRPPVPNSSNSNFKCIMTLKGHASWVKDLRI--RGNYLFSCSDDKTIRCWNL 433

Query: 408 RTNTCVR 414
               CV+
Sbjct: 434 ENGECVK 440

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 51/237 (21%), Positives = 89/237 (37%), Gaps = 40/237 (16%)

Query: 337 GHQDSVLSVDSFRKL----IVSGSADKTVKVWHVES-RTCYTLRGHTGWVNCVKLHPKSF 391
            H+  V  V  FRKL    + S S D ++++W  E      +   H  WV C+ +     
Sbjct: 233 NHEHIVSEVKLFRKLNNIYLASCSRDTSIRIWTAEDGMILNSFHPHNEWVRCLDV--SGD 290

Query: 392 TCFSGSDDMTIRMWDIRTNTCVRVFHGH---VGQVQKVIPLTLGSDLIEXXXXXXXXXXX 448
              SGS D ++R+    +   + +  GH   +  V+ ++PL+                  
Sbjct: 291 FVLSGSQDASLRLTHWPSGNGLSIGIGHEFPIESVKFILPLSTNEKASPTINYLRKPLEI 350

Query: 449 XXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTG-----------------AC 491
                  S +            +  S S D  IK+W + T                   C
Sbjct: 351 DSDYEKMSFK------------YCASASRDRLIKIWEIPTPRFVMHRPPVPNSSNSNFKC 398

Query: 492 IRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAP-VACVGI 547
           I T  GH   V D+      + S S D++ + W+L+ G+C+  +  +H+  V C+ +
Sbjct: 399 IMTLKGHASWVKDLRIRGNYLFSCSDDKTIRCWNLENGECVKQWTDLHSGFVTCLDM 455

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 32/79 (40%), Gaps = 17/79 (21%)

Query: 274 TGSYDSTVAIWDLATGKL-----------------IRRLSGHTDGVKALRFDDQKLITGS 316
           + S D  + IW++ T +                  I  L GH   VK LR     L + S
Sbjct: 364 SASRDRLIKIWEIPTPRFVMHRPPVPNSSNSNFKCIMTLKGHASWVKDLRIRGNYLFSCS 423

Query: 317 LDKTIRVWNYVTGACVSTY 335
            DKTIR WN   G CV  +
Sbjct: 424 DDKTIRCWNLENGECVKQW 442

 Score = 37.0 bits (84), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 44/106 (41%), Gaps = 19/106 (17%)

Query: 314 TGSLDKTIRVWNYVTG-----------------ACVSTYRGHQDSVLSVDSFRKLIVSGS 356
           + S D+ I++W   T                   C+ T +GH   V  +      + S S
Sbjct: 364 SASRDRLIKIWEIPTPRFVMHRPPVPNSSNSNFKCIMTLKGHASWVKDLRIRGNYLFSCS 423

Query: 357 ADKTVKVWHVESRTCYT--LRGHTGWVNCVKLHPKSFTCFSGSDDM 400
            DKT++ W++E+  C       H+G+V C+ + P   T  +G   +
Sbjct: 424 DDKTIRCWNLENGECVKQWTDLHSGFVTCLDMDPDGGTNDTGQQSL 469

>KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces
           cerevisiae YDR364c CDC40 cell division control protein
           singleton, start by similarity
          Length = 429

 Score = 54.7 bits (130), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 74/188 (39%), Gaps = 28/188 (14%)

Query: 251 RIQEFKGHMDGVXXXXXXXXX---XXTGSYDSTVAIWDLATGK-LIRRLSGHTDGVKALR 306
           +I E+ GH +G               +G  D+ + +WD    + L+R   GH+  +K L 
Sbjct: 127 KIAEYYGHKNGTTSLRFIPKTGHLLLSGGNDNIIKLWDFYHERELLRTYEGHSMTIKDLN 186

Query: 307 FDDQ--KLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVW 364
           F D      + S DK +++WN        T +G  D  L  +S    I     DK   V 
Sbjct: 187 FTDNGHSFASASFDKWVKIWN--------TEKGIIDKRLRFNSVPNCITFHPKDKNQLVV 238

Query: 365 HVESRTC--YTLR------------GHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTN 410
            + +     Y LR             H G +  +K  P      S S+D T+R+W+ R N
Sbjct: 239 GLSNSEIRHYDLRLSENHGEVQKYDHHQGSILALKYFPDGKKLISSSEDKTVRIWENRIN 298

Query: 411 TCVRVFHG 418
             ++   G
Sbjct: 299 IPIKQISG 306

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 3/61 (4%)

Query: 472 LLSCSLDNTIKLWNV-KTGACIRTQFGHVEGVWDIA-ADN-FRIVSGSHDRSCKVWDLQT 528
           LLS   DN IKLW+       +RT  GH   + D+   DN     S S D+  K+W+ + 
Sbjct: 151 LLSGGNDNIIKLWDFYHERELLRTYEGHSMTIKDLNFTDNGHSFASASFDKWVKIWNTEK 210

Query: 529 G 529
           G
Sbjct: 211 G 211

>ACR091W [1138] [Homologous to ScYDR267C - SH]
           complement(520609..521595) [987 bp, 328 aa]
          Length = 328

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 102/238 (42%), Gaps = 34/238 (14%)

Query: 197 LPLLHMKRARYIKSDKA-SASKGEGEDAPQSRMRPWKVVYRERFKV----ESNWRKGIYR 251
           +P LH+ R+  +  D+  S    +G  A  S  R  K+V    FK+    +    K   R
Sbjct: 1   MPNLHLVRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVR 60

Query: 252 IQEFKGHMDGVXXXXXXXXXXXTGSYDSTVAIW----DLATGK--LIRRLSGHTDGVKAL 305
              ++ H +              GS+D+TV+IW    D  +G+  L+  + GH + VK++
Sbjct: 61  SVAWRPHCN----------VLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSV 110

Query: 306 RF--DDQKLITGSLDKTIRVWNYVTGA----CVSTYRGHQDSVLSV--DSFRKLIVSGSA 357
            +  D   L T S DK++ +W     +    C S  + H   V  +   + R L+ S S 
Sbjct: 111 AWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSY 170

Query: 358 DKTVKVWHVES---RTCYTLRGHTGWVNCVKLH--PKSFTCFSGSDDMTIRMWDIRTN 410
           D TV++W  +         L GH G V C             SGSDD T+R+W   T+
Sbjct: 171 DDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTD 228

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 54/219 (24%), Positives = 87/219 (39%), Gaps = 28/219 (12%)

Query: 332 VSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLR-----GHTGWVNCVKL 386
           V + + H D   SVD  + L+ +GSAD+ +K+  V+ R    +       H   V  V  
Sbjct: 7   VRSLKLHGDRCWSVDISKGLLATGSADRKIKL--VDVRNFKLVEELDDTAHKKAVRSVAW 64

Query: 387 HPKSFTCFSGSDDMTIRMW-----DIRTNT-CVRVFHGHVGQVQKVIPLTLGSDLI---- 436
            P      +GS D T+ +W     D    T  + V  GH  +V+ V     G+ L     
Sbjct: 65  RPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSR 124

Query: 437 EXXXXXXXXXXXXXXXXXXSV---QAANFDHSLPYPTHLL--SCSLDNTIKLWNVKTG-- 489
           +                  SV    + +  H + + + LL  S S D+T+++W  +    
Sbjct: 125 DKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDW 184

Query: 490 ACIRTQFGHVEGVW----DIAADNFRIVSGSHDRSCKVW 524
            C     GH   VW    + A    R+ SGS D + ++W
Sbjct: 185 ECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223

>CAGL0G03399g complement(325879..326988) highly similar to sp|P40066
           Saccharomyces cerevisiae YER107c GLE2, start by
           similarity
          Length = 369

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 64/103 (62%), Gaps = 8/103 (7%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF------DDQKLITGSLDKTIRVWNYV 327
           +G  D+TV ++D+A+G+  +++  H D VK+LRF      + + L+TGS DKTI+ W+  
Sbjct: 96  SGGCDNTVKLYDVASGQS-QQIGSHNDAVKSLRFVQCGPTNTECLVTGSWDKTIKFWDTR 154

Query: 328 TGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRT 370
               ++T     + V ++D+ ++L+V G+A++ + + ++ + T
Sbjct: 155 QPQPITTI-AMPERVYTMDNKQQLLVVGTAERHIAIINLANPT 196

 Score = 37.0 bits (84), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 50/121 (41%), Gaps = 14/121 (11%)

Query: 300 DGVKALRFDDQK---LITGSLDKTIRVWNYVTGACVSTYR-GHQDSVL----SVDSFRKL 351
           D +  + F  Q        S D  +R+W+   G      +  H   VL    S+D  R  
Sbjct: 36  DSISDIAFSPQHDFLFSVSSWDGKVRIWDAQNGVPQGKAQYEHNGPVLCTRWSLDGAR-- 93

Query: 352 IVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKL---HPKSFTCF-SGSDDMTIRMWDI 407
           I SG  D TVK++ V S     +  H   V  ++     P +  C  +GS D TI+ WD 
Sbjct: 94  IASGGCDNTVKLYDVASGQSQQIGSHNDAVKSLRFVQCGPTNTECLVTGSWDKTIKFWDT 153

Query: 408 R 408
           R
Sbjct: 154 R 154

>Sklu_2430.9 YMR102C, Contig c2430 15497-18397
          Length = 966

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 40/76 (52%), Gaps = 2/76 (2%)

Query: 334 TYRGHQDSVLSVD-SFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFT 392
           ++ GH   +L +D S    +++GS DKTVK+WH + +       H  +V CVK HP    
Sbjct: 391 SFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPNDDR 450

Query: 393 CF-SGSDDMTIRMWDI 407
            F SG  D   R+W I
Sbjct: 451 FFISGCLDHKARLWSI 466

 Score = 38.1 bits (87), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 77/183 (42%), Gaps = 36/183 (19%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF---DDQKLITGSLDKTIRVW------ 324
           TGS D TV +W     +L++    H D V  ++F   DD+  I+G LD   R+W      
Sbjct: 412 TGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDDE 470

Query: 325 --------NYVTGACVS----------TYRGHQDSVLS--VDSFRKLIVSGSADKTVKVW 364
                   + +T   VS          T+ G+   +L+  ++      +S   DK  K  
Sbjct: 471 VSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIVLLTRGLEHVYSFHLSDKQDKKGK-- 528

Query: 365 HVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQ 424
            V +R   T R +T     V        CF   +DMT+++     ++ +RVF+     +Q
Sbjct: 529 DVTTRDLPTSRTNTHHGPKV----TGIECFRAVNDMTLKLLVTSNDSKIRVFNLKDNILQ 584

Query: 425 KVI 427
           +V+
Sbjct: 585 EVL 587

>Kwal_34.15818
          Length = 349

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/248 (22%), Positives = 105/248 (42%), Gaps = 27/248 (10%)

Query: 295 LSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGACVSTYRGHQDSV--LSVDSFRK 350
           L GH   +  ++F+ +   + T + D    VW  + G  + T+ GHQ ++  + VD F +
Sbjct: 6   LKGHERSLTQVKFNREGDLIFTCAKDNVASVWYSINGERLGTFEGHQGTIWSIDVDQFTQ 65

Query: 351 LIVSGSADKTVKVWHVESRT-CYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRT 409
             V+GSAD ++K+W V+  T  +T +  T         P     FS S D  + + D   
Sbjct: 66  YAVTGSADFSIKLWKVQDGTNVFTWKTKT---------PVRRVQFSPSGDKILAVLD--- 113

Query: 410 NTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYP 469
              V  + G V  V  V       D+++                  +V A +F+      
Sbjct: 114 --GVMGYPGSV-TVYTVRRDPETKDIVDISEEPTFNILTREGFEIAAVAAWSFND----- 165

Query: 470 THLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDI--AADNFRIVSGSHDRSCKVWDLQ 527
           T++++   D  +  +   +G  I +   H + V DI  + D    ++ S D + K+ D +
Sbjct: 166 TYIVAGHKDGRVSKYEGHSGEYIDSAALHTQNVSDIQFSPDGTYFITSSRDSAAKLVDTE 225

Query: 528 TGKCMHTF 535
           T + + T+
Sbjct: 226 TLEVLKTY 233

 Score = 33.1 bits (74), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 47/105 (44%), Gaps = 14/105 (13%)

Query: 278 DSTVAIWDLATGKLIRRLSGHTDGVKALRFDD--QKLITGSLDKTIRVWNYVTGACVSTY 335
           D+  ++W    G+ +    GH   + ++  D   Q  +TGS D +I++W    G  V T+
Sbjct: 31  DNVASVWYSINGERLGTFEGHQGTIWSIDVDQFTQYAVTGSADFSIKLWKVQDGTNVFTW 90

Query: 336 RGHQDSVLSVDSFRKLIVSGSADKTVKVW-----HVESRTCYTLR 375
           +       +    R++  S S DK + V      +  S T YT+R
Sbjct: 91  K-------TKTPVRRVQFSPSGDKILAVLDGVMGYPGSVTVYTVR 128

>Kwal_14.884
          Length = 395

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 63/140 (45%), Gaps = 22/140 (15%)

Query: 292 IRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFR-- 349
           I     H+  VK L    + L++GS D+ IR+++      + T   HQ S+ ++   +  
Sbjct: 34  IFHFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGT 93

Query: 350 -------------------KLIVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHPK 389
                              K ++S S D  + +W V+    + TL+GH   +N   +HP 
Sbjct: 94  KIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPS 153

Query: 390 SFTCFSGSDDMTIRMWDIRT 409
           +    S S+D +IR+W++ T
Sbjct: 154 NRIAISVSEDHSIRLWNLMT 173

 Score = 33.5 bits (75), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 2/61 (3%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGV--WDIAADNFRIVSGSHDRSCKVWDLQTG 529
           L+S S D+ + +W VK      T  GH   +  +DI   N   +S S D S ++W+L T 
Sbjct: 115 LISASDDHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTV 174

Query: 530 K 530
           K
Sbjct: 175 K 175

>Scas_585.8
          Length = 460

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 67/151 (44%), Gaps = 10/151 (6%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGAC 331
           +G  D  + IW      +    + HT+ ++ + F  +D K +T S D  +++WN+  G  
Sbjct: 148 SGDADGGIKIWQPNFNMVKEFENAHTECIRDISFSNNDSKFVTCSDDNVLKIWNFSNGQV 207

Query: 332 VSTYRGHQDSVLSVDSFRK--LIVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHP 388
             T  GH   + S D   +  LIVS S D  VK+W   S  C  T+      V   +  P
Sbjct: 208 ERTLSGHHWDIKSCDWHPEMGLIVSASKDNLVKLWDPRSGQCISTIIKFKHTVLKTRFQP 267

Query: 389 KSFTCFSG-SDDMTIRMWDIRTN----TCVR 414
                 +  S D + R++DIR +     CVR
Sbjct: 268 TRGNLLAAISKDKSCRVFDIRHSMKELMCVR 298

 Score = 48.9 bits (115), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 39/70 (55%), Gaps = 8/70 (11%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFR-----IVSGSHDRSCKVWDL 526
            ++CS DN +K+WN   G   RT  GH    WDI + ++      IVS S D   K+WD 
Sbjct: 188 FVTCSDDNVLKIWNFSNGQVERTLSGH---HWDIKSCDWHPEMGLIVSASKDNLVKLWDP 244

Query: 527 QTGKCMHTFV 536
           ++G+C+ T +
Sbjct: 245 RSGQCISTII 254

 Score = 35.8 bits (81), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 46/230 (20%), Positives = 81/230 (35%), Gaps = 56/230 (24%)

Query: 310 QKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKL---IVSGSADKTVKVWHV 366
           ++L+  + +    +WN  T    S  + H DS +S   +      + SG AD  +K+W  
Sbjct: 103 RRLVVATYNGEFSLWN-GTSFNESLMQAH-DSAVSCIQYSHAGDWMCSGDADGGIKIWQP 160

Query: 367 ESRTCYTLR-GHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQK 425
                      HT  +  +          + SDD  +++W+       R   GH   ++ 
Sbjct: 161 NFNMVKEFENAHTECIRDISFSNNDSKFVTCSDDNVLKIWNFSNGQVERTLSGHHWDIKS 220

Query: 426 VIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWN 485
                                                    P    ++S S DN +KLW+
Sbjct: 221 C-------------------------------------DWHPEMGLIVSASKDNLVKLWD 243

Query: 486 VKTGACIRT--QFGHVEGVWDIAADNFRIVSG------SHDRSCKVWDLQ 527
            ++G CI T  +F H      +    F+   G      S D+SC+V+D++
Sbjct: 244 PRSGQCISTIIKFKHT-----VLKTRFQPTRGNLLAAISKDKSCRVFDIR 288

 Score = 32.3 bits (72), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 29/70 (41%), Gaps = 2/70 (2%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADN--FRIVSGSHDRSCKVWDLQTG 529
           + S   D  IK+W          +  H E + DI+  N   + V+ S D   K+W+   G
Sbjct: 146 MCSGDADGGIKIWQPNFNMVKEFENAHTECIRDISFSNNDSKFVTCSDDNVLKIWNFSNG 205

Query: 530 KCMHTFVGIH 539
           +   T  G H
Sbjct: 206 QVERTLSGHH 215

>ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH]
           complement(647933..649102) [1170 bp, 389 aa]
          Length = 388

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 62/131 (47%), Gaps = 14/131 (10%)

Query: 292 IRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFR-- 349
           I     H   VK L    + L++GS D+ IR+++      + T   H  S+ S+   R  
Sbjct: 34  IFHFQAHALSVKTLDISRRYLVSGSNDEHIRIYDLQKRKELGTLLNHNGSITSLRFSRAT 93

Query: 350 ----------KLIVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHPKSFTCFSGSD 398
                     K ++S S D T+ +W V+    +  L+GH   +N + +HP S    S S+
Sbjct: 94  TDKDGKQQGNKWLLSASEDHTIIIWRVKDWENFGKLKGHNARINDLDIHP-SNRVASVSE 152

Query: 399 DMTIRMWDIRT 409
           D +IR+W++ T
Sbjct: 153 DHSIRLWNLMT 163

 Score = 32.7 bits (73), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 30/59 (50%), Gaps = 3/59 (5%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGV--WDIAADNFRIVSGSHDRSCKVWDLQT 528
           LLS S D+TI +W VK         GH   +   DI   N R+ S S D S ++W+L T
Sbjct: 106 LLSASEDHTIIIWRVKDWENFGKLKGHNARINDLDIHPSN-RVASVSEDHSIRLWNLMT 163

>Kwal_55.21559
          Length = 351

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/156 (28%), Positives = 69/156 (44%), Gaps = 23/156 (14%)

Query: 274 TGSYDSTVAIW----------DLATGKLIRRLSGHTDGVKALRFDDQ--KLITGSLDKTI 321
            GS+DST++IW          D    +L+  + GH + VKA+ +      L + S DK++
Sbjct: 94  AGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSV 153

Query: 322 RVWNY----VTGACVSTYRGHQDSVLSV--DSFRKLIVSGSADKTVKVWHVES---RTCY 372
            +W          C+S  + H   V  V   S   L+ S S D T+++W  ++       
Sbjct: 154 WIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAA 213

Query: 373 TLRGHTGWVNCVKLH--PKSFTCFSGSDDMTIRMWD 406
            L GH G V C        S    S SDD T+R+W+
Sbjct: 214 VLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 65/157 (41%), Gaps = 23/157 (14%)

Query: 290 KLIRRL--SGHTDGVKALRFDDQK--LITGSLDKTIRVW----------NYVTGACVSTY 335
           +L+  L  S H   V+++ F      L  GS D TI +W          ++     ++  
Sbjct: 66  QLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAII 125

Query: 336 RGHQDSVLSVDSFRK--LIVSGSADKTVKVWHV----ESRTCYT-LRGHTGWVNCVKLHP 388
            GH++ V +V        + S S DK+V +W      E   C + L+ H   V  V  H 
Sbjct: 126 EGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHS 185

Query: 389 KSFTCFSGSDDMTIRMW--DIRTNTCVRVFHGHVGQV 423
           +     S S D TIR+W  D     C  V +GH G V
Sbjct: 186 EMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTV 222

 Score = 37.0 bits (84), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 85/218 (38%), Gaps = 30/218 (13%)

Query: 338 HQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLR-----GHTGWVNCVKLHPKSFT 392
           H D + S+D  + L+ + S+D+ +K+ ++++     +       H   V  V   P S  
Sbjct: 32  HTDKLWSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSI 91

Query: 393 CFSGSDDMTIRMW----------DIRTNTCVRVFHGHVGQVQKV----IPLTLGSDLIEX 438
             +GS D TI +W          D      + +  GH  +V+ V        L S   + 
Sbjct: 92  LAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDK 151

Query: 439 XXXXXXXXXXXXXXXXXSV---QAANFDHSLPY-PTHLL-SCSLDNTIKLW--NVKTGAC 491
                            SV    A +  H + +   HLL S S D+TI+LW  +     C
Sbjct: 152 SVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWEC 211

Query: 492 IRTQFGHVEGVW----DIAADNFRIVSGSHDRSCKVWD 525
                GH   VW    + +  + R+ S S D + +VW+
Sbjct: 212 AAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 6/60 (10%)

Query: 274 TGSYDSTVAIW--DLATGKLIRRLSGHTDGVKALRFDDQ----KLITGSLDKTIRVWNYV 327
           + SYD T+ +W  D    +    L+GH   V    F+      +L + S D T+RVWNYV
Sbjct: 192 SSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYV 251

>Kwal_27.12239
          Length = 316

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 76/157 (48%), Gaps = 15/157 (9%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGAC 331
           T S D T+ I  +  G+L  RL GHT  V ++++      L + S+D++I++W+ ++G  
Sbjct: 75  TASDDFTIIITHIVFGEL-HRLVGHTAPVTSVKYTMKGNLLCSCSMDESIKIWDILSGTL 133

Query: 332 VSTYRGHQDSVLSVD--SFRKLIV-SGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLH 387
           + T   H + V+S+D   F   I+ SGS D  ++++   +  C  TL     W +   + 
Sbjct: 134 LRTLSAHSEPVVSIDLPPFDPSILSSGSYDGLIRIFDTATGHCLKTLTYDKDWQSENGVV 193

Query: 388 PKSFTCFS--------GSDDMTIRMWDIRTNTCVRVF 416
           P S   FS         S D  +++WD      VR F
Sbjct: 194 PISQVKFSRNGKYLLVKSLDGILKIWDFVRGKVVRTF 230

 Score = 48.9 bits (115), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 74/194 (38%), Gaps = 46/194 (23%)

Query: 352 IVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNT 411
           I + S D T+ + H+     + L GHT  V  VK   K     S S D +I++WDI + T
Sbjct: 73  IATASDDFTIIITHIVFGELHRLVGHTAPVTSVKYTMKGNLLCSCSMDESIKIWDILSGT 132

Query: 412 CVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTH 471
            +R    H   V                                S+    FD     P+ 
Sbjct: 133 LLRTLSAHSEPV-------------------------------VSIDLPPFD-----PSI 156

Query: 472 LLSCSLDNTIKLWNVKTGACIRT-----QFGHVEGVWDIAADNFR-----IVSGSHDRSC 521
           L S S D  I++++  TG C++T      +    GV  I+   F      ++  S D   
Sbjct: 157 LSSGSYDGLIRIFDTATGHCLKTLTYDKDWQSENGVVPISQVKFSRNGKYLLVKSLDGIL 216

Query: 522 KVWDLQTGKCMHTF 535
           K+WD   GK + TF
Sbjct: 217 KIWDFVRGKVVRTF 230

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 55/117 (47%), Gaps = 21/117 (17%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTD--------GVKALRF--DDQKLITGSLDKTIRV 323
           +GSYD  + I+D ATG  ++ L+   D         +  ++F  + + L+  SLD  +++
Sbjct: 159 SGSYDGLIRIFDTATGHCLKTLTYDKDWQSENGVVPISQVKFSRNGKYLLVKSLDGILKI 218

Query: 324 WNYVTGACVSTYRGHQDSVLSVD-----------SFRKLIVSGSADKTVKVWHVESR 369
           W++V G  V T++  + S L              +   ++VSG+    +  W  +++
Sbjct: 219 WDFVRGKVVRTFKSGESSSLRYSCGMDFLYPQDQTVDPIVVSGTESGQIVCWDSQTK 275

>Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement
          Length = 997

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 40/58 (68%), Gaps = 2/58 (3%)

Query: 471 HLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAA--DNFRIVSGSHDRSCKVWDL 526
           +++SCS D +IKLWN+K+G  + T +GH   +W +    ++ ++VS S D +C+VWD+
Sbjct: 195 YVVSCSDDRSIKLWNLKSGELLSTGWGHTARIWQLKFIDNDTKVVSVSEDCTCRVWDI 252

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 53/106 (50%), Gaps = 5/106 (4%)

Query: 307 FDDQKLI--TGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFR--KLIVSGSADKTVK 362
           F D K+    G++   + +W+  +   V    GH+ S+  V   +  + +VS S D+++K
Sbjct: 147 FSDTKVYINAGTVMGGVFIWDLFSETKVHNLLGHEGSIFYVTLSKNGEYVVSCSDDRSIK 206

Query: 363 VWHVES-RTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDI 407
           +W+++S     T  GHT  +  +K         S S+D T R+WDI
Sbjct: 207 LWNLKSGELLSTGWGHTARIWQLKFIDNDTKVVSVSEDCTCRVWDI 252

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 48/91 (52%), Gaps = 6/91 (6%)

Query: 281 VAIWDLATGKLIRRLSGHTDGV--KALRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGH 338
           V IWDL +   +  L GH   +    L  + + +++ S D++I++WN  +G  +ST  GH
Sbjct: 163 VFIWDLFSETKVHNLLGHEGSIFYVTLSKNGEYVVSCSDDRSIKLWNLKSGELLSTGWGH 222

Query: 339 QDSVLS---VDSFRKLIVSGSADKTVKVWHV 366
              +     +D+  K +VS S D T +VW +
Sbjct: 223 TARIWQLKFIDNDTK-VVSVSEDCTCRVWDI 252

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 33/52 (63%), Gaps = 2/52 (3%)

Query: 276 SYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWN 325
           S D ++ +W+L +G+L+    GHT  +  L+F  +D K+++ S D T RVW+
Sbjct: 200 SDDRSIKLWNLKSGELLSTGWGHTARIWQLKFIDNDTKVVSVSEDCTCRVWD 251

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 36/73 (49%), Gaps = 1/73 (1%)

Query: 352 IVSGSADKTVKVWHVESRT-CYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTN 410
           I +G+    V +W + S T  + L GH G +  V L        S SDD +I++W++++ 
Sbjct: 154 INAGTVMGGVFIWDLFSETKVHNLLGHEGSIFYVTLSKNGEYVVSCSDDRSIKLWNLKSG 213

Query: 411 TCVRVFHGHVGQV 423
             +    GH  ++
Sbjct: 214 ELLSTGWGHTARI 226

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 483 LWNVKTGACIRTQFGHVEGVW--DIAADNFRIVSGSHDRSCKVWDLQTGKCMHT 534
           +W++ +   +    GH   ++   ++ +   +VS S DRS K+W+L++G+ + T
Sbjct: 165 IWDLFSETKVHNLLGHEGSIFYVTLSKNGEYVVSCSDDRSIKLWNLKSGELLST 218

>YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Protein
           containing seven WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to WD40 protein Ciao1 (human CIAO1), which
           binds and inhibits Wilms tumor suppressor protein (human
           WT1) transactivation activity [993 bp, 330 aa]
          Length = 330

 Score = 51.6 bits (122), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 67/152 (44%), Gaps = 20/152 (13%)

Query: 274 TGSYDSTVAIWDLATG-------KLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVW 324
            GS+DSTV+IW             L+  + GH + VK + +  D   L T S DK++ +W
Sbjct: 75  AGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIW 134

Query: 325 NYVTGA----CVSTYRGHQDSVLSV--DSFRKLIVSGSADKTVKVW--HVESRTCY-TLR 375
                     C+S  + H   V  V       L+ S S D TV++W  + +   C   L 
Sbjct: 135 ETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLN 194

Query: 376 GHTG--WVNCVKLHPKSFTCFSGSDDMTIRMW 405
           GH G  W +        F   SGSDD T+R+W
Sbjct: 195 GHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/264 (22%), Positives = 98/264 (37%), Gaps = 63/264 (23%)

Query: 286 LATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRV----WNYVTGACVSTYRGHQDS 341
           +A+  LI+ L  + + + +  F    L TGS D+ I++    ++  T   V     H+ +
Sbjct: 1   MASINLIKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKA 60

Query: 342 VLSVDSFR---KLIVSGSADKTVKVWHVESRTCYT--------LRGHTGWVNCVKLHPKS 390
           + SV ++R    L+ +GS D TV +W  E     T        + GH   V  V      
Sbjct: 61  IRSV-AWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDG 119

Query: 391 FTCFSGSDDMTIRMWDIRTN----TCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXX 446
           +   + S D ++ +W+   +     C+ V   H   V+ VI                   
Sbjct: 120 YYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIW------------------ 161

Query: 447 XXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTG--ACIRTQFGHVEGVWD 504
                               P    L S S D+T+++W        C+    GH   VW 
Sbjct: 162 -------------------HPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWS 202

Query: 505 IAADN----FRIVSGSHDRSCKVW 524
              D     FR+ SGS D + +VW
Sbjct: 203 SDFDKTEGVFRLCSGSDDSTVRVW 226

 Score = 33.1 bits (74), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 6/60 (10%)

Query: 274 TGSYDSTVAIWDLATG--KLIRRLSGHTDGVKALRFDDQ----KLITGSLDKTIRVWNYV 327
           + SYD TV IW       + +  L+GH   V +  FD      +L +GS D T+RVW Y+
Sbjct: 170 SSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYM 229

>Scas_397.2
          Length = 410

 Score = 52.0 bits (123), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 34/160 (21%), Positives = 64/160 (40%), Gaps = 43/160 (26%)

Query: 341 SVLSVDSFRKL-----IVSGSADKTVKVWHVESRTCYTLR-GHTGWVNCVKLHPKSFTCF 394
           +V S+D+F +       + G+ + ++ ++  +    +T    H   +  +K  P      
Sbjct: 96  NVTSIDAFARANDVASYIVGNEEGSISLYDSQFSHEWTQEDAHCSEITTLKFFPSGEVVL 155

Query: 395 SGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXX 454
           SGS DM +++W I+  +C R+F GH  ++   + +  G D +                  
Sbjct: 156 SGSSDMQLKLWSIKDASCPRIFRGHTSKITDSVLIERGRDFV------------------ 197

Query: 455 XSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRT 494
                              S SLD T+KLW   +G+ +RT
Sbjct: 198 -------------------SSSLDGTMKLWECGSGSTVRT 218

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 38/68 (55%), Gaps = 1/68 (1%)

Query: 350 KLIVSGSADKTVKVWHVESRTC-YTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIR 408
           ++++SGS+D  +K+W ++  +C    RGHT  +    L  +     S S D T+++W+  
Sbjct: 152 EVVLSGSSDMQLKLWSIKDASCPRIFRGHTSKITDSVLIERGRDFVSSSLDGTMKLWECG 211

Query: 409 TNTCVRVF 416
           + + VR F
Sbjct: 212 SGSTVRTF 219

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 37/78 (47%), Gaps = 2/78 (2%)

Query: 466 LPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWD--IAADNFRIVSGSHDRSCKV 523
            P    +LS S D  +KLW++K  +C R   GH   + D  +       VS S D + K+
Sbjct: 148 FPSGEVVLSGSSDMQLKLWSIKDASCPRIFRGHTSKITDSVLIERGRDFVSSSLDGTMKL 207

Query: 524 WDLQTGKCMHTFVGIHAP 541
           W+  +G  + TF+    P
Sbjct: 208 WECGSGSTVRTFMRRENP 225

 Score = 35.8 bits (81), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 49/96 (51%), Gaps = 8/96 (8%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGACV 332
           G+ + +++++D        +   H   +  L+F    + +++GS D  +++W+    +C 
Sbjct: 115 GNEEGSISLYDSQFSHEWTQEDAHCSEITTLKFFPSGEVVLSGSSDMQLKLWSIKDASCP 174

Query: 333 STYRGH----QDSVLSVDSFRKLIVSGSADKTVKVW 364
             +RGH     DSVL ++  R   VS S D T+K+W
Sbjct: 175 RIFRGHTSKITDSVL-IERGRDF-VSSSLDGTMKLW 208

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 31/64 (48%), Gaps = 2/64 (3%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGV--KALRFDDQKLITGSLDKTIRVWNYVTGAC 331
           +GS D  + +W +      R   GHT  +    L    +  ++ SLD T+++W   +G+ 
Sbjct: 156 SGSSDMQLKLWSIKDASCPRIFRGHTSKITDSVLIERGRDFVSSSLDGTMKLWECGSGST 215

Query: 332 VSTY 335
           V T+
Sbjct: 216 VRTF 219

>Kwal_26.7655
          Length = 743

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 66/159 (41%), Gaps = 23/159 (14%)

Query: 274 TGSYDSTVAIWDLATGKLIRR-LSGHTDGVKALRFD-----------------DQKLITG 315
           TG  D T+ +W +    L R  LS  T   +A R                   +Q +   
Sbjct: 192 TGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTVGRSVKEEPEQPIGPA 251

Query: 316 SLDKTIRVWNYVTGACVSTYRGHQDSVLSVD-SFRKLIVSGSADKTVKVWHVESRTCYTL 374
           S+D    V++ +       Y+ H   +L +D S    I++ S DKT ++WH +      +
Sbjct: 252 SMDLYAPVFHPLP---FRIYQEHTQDILDLDWSKNGFILTTSMDKTARLWHCDRPKALKV 308

Query: 375 RGHTGWVNCVKLHPKSFTCF-SGSDDMTIRMWDIRTNTC 412
             H  +V C K HP     F SG  D T+R+W I  N+ 
Sbjct: 309 FTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSV 347

 Score = 32.7 bits (73), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 4/65 (6%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF---DDQKLITGSLDKTIRVWNYVTGA 330
           T S D T  +W     K ++  + H D V   +F   DD+  I+G LD T+R+W+ +  +
Sbjct: 288 TTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNS 346

Query: 331 CVSTY 335
               Y
Sbjct: 347 VSFDY 351

>KLLA0F16038g complement(1487475..1490063) weakly similar to
           ca|CA1657|IPF16022 Candida albicans unknown function,
           hypothetical start
          Length = 862

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 50/97 (51%), Gaps = 8/97 (8%)

Query: 278 DSTVAIWDL---ATGKLIRRLSGHTDGVKALRF-----DDQKLITGSLDKTIRVWNYVTG 329
           D T+ I+D    +T +L+R L    DG+    F      DQ L + SLDKTIR ++Y TG
Sbjct: 622 DKTMQIFDKTSNSTPRLLRLLDDQGDGILVNHFYVNADSDQILCSSSLDKTIRCFSYTTG 681

Query: 330 ACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHV 366
            C++ Y  H D V+ + +     V+ + +  +  W +
Sbjct: 682 KCLNQYYAHADPVVGMTTVANKFVTVTGNGCLFSWEI 718

 Score = 30.0 bits (66), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGV--WDIAADNFRIVSGS 516
           L S SLD TI+ ++  TG C+   + H + V      A+ F  V+G+
Sbjct: 664 LCSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVANKFVTVTGN 710

>YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation factor I
           subunit 2 required for mRNA 3'-end processing, bridges
           two mRNA 3'-end processing factors, has WD (WD-40)
           repeats [1398 bp, 465 aa]
          Length = 465

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 66/151 (43%), Gaps = 10/151 (6%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGAC 331
           +G  D  + IW      +    + HT+ ++ + F  +D K +T S D  +++WN+  G  
Sbjct: 152 SGDADGMIKIWQPNFSMVKEIDAAHTESIRDMAFSSNDSKFVTCSDDNILKIWNFSNGKQ 211

Query: 332 VSTYRGHQDSVLSVDSFRK--LIVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHP 388
                GH   V S D   +  LI S S D  VK+W   S  C  ++      V   +  P
Sbjct: 212 ERVLSGHHWDVKSCDWHPEMGLIASASKDNLVKLWDPRSGNCISSILKFKHTVLKTRFQP 271

Query: 389 -KSFTCFSGSDDMTIRMWDIRTN----TCVR 414
            K     + S D + R++DIR +     CVR
Sbjct: 272 TKGNLLMAISKDKSCRVFDIRYSMKELMCVR 302

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 8/72 (11%)

Query: 470 THLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFR-----IVSGSHDRSCKVW 524
           +  ++CS DN +K+WN   G   R   GH    WD+ + ++      I S S D   K+W
Sbjct: 190 SKFVTCSDDNILKIWNFSNGKQERVLSGH---HWDVKSCDWHPEMGLIASASKDNLVKLW 246

Query: 525 DLQTGKCMHTFV 536
           D ++G C+ + +
Sbjct: 247 DPRSGNCISSIL 258

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 45/231 (19%), Positives = 83/231 (35%), Gaps = 57/231 (24%)

Query: 310 QKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSV----DSFRKLIVSGSADKTVKVWH 365
           ++L+  +      +WN  +    +  + H  +V ++    DS    ++SG AD  +K+W 
Sbjct: 106 RRLVVATYSGEFSLWNASSFTFETLMQAHDSAVTTMKYSHDS--DWMISGDADGMIKIWQ 163

Query: 366 VESRTCYTL-RGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQ 424
                   +   HT  +  +          + SDD  +++W+       RV  GH   V+
Sbjct: 164 PNFSMVKEIDAAHTESIRDMAFSSNDSKFVTCSDDNILKIWNFSNGKQERVLSGHHWDVK 223

Query: 425 KVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLW 484
                                                     P    + S S DN +KLW
Sbjct: 224 SC-------------------------------------DWHPEMGLIASASKDNLVKLW 246

Query: 485 NVKTGACIRT--QFGHVEGVWDIAADNFRIVSG------SHDRSCKVWDLQ 527
           + ++G CI +  +F H      +    F+   G      S D+SC+V+D++
Sbjct: 247 DPRSGNCISSILKFKHT-----VLKTRFQPTKGNLLMAISKDKSCRVFDIR 292

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 30/70 (42%), Gaps = 2/70 (2%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQTG 529
           ++S   D  IK+W             H E + D+A  +++ + V+ S D   K+W+   G
Sbjct: 150 MISGDADGMIKIWQPNFSMVKEIDAAHTESIRDMAFSSNDSKFVTCSDDNILKIWNFSNG 209

Query: 530 KCMHTFVGIH 539
           K      G H
Sbjct: 210 KQERVLSGHH 219

>Scas_700.27*
          Length = 433

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 75/160 (46%), Gaps = 18/160 (11%)

Query: 279 STVAIWDLATGKLIRRLSGHT-DGVKALRFDDQKLITGSLDKTIRVWN-------YVTGA 330
           +T+ I DLA GKL+  L+ H  D  + L F +  + T      IR+++       ++   
Sbjct: 143 TTIKICDLAKGKLLVTLACHIHDRNETLPFPND-IPTYFQPLNIRLYHAGTWKKIWLLEI 201

Query: 331 CVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTC-YTLRGHTGWVN---CVKL 386
            ++TY  +   +  +     LI +   D  V++W + +R    TL GH   +N   C+ +
Sbjct: 202 TMATYHEYIQMIFIL--LLNLIATAGRDSVVRLWDIRARVAVMTLIGHKNPINKVHCLPV 259

Query: 387 HPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKV 426
            P+  +C   S D TIR+WDI     ++V   H   V+ +
Sbjct: 260 DPQIVSC---STDATIRLWDIVAGKSMKVITHHKKSVRNI 296

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 50/231 (21%), Positives = 98/231 (42%), Gaps = 39/231 (16%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALR--FDDQKLITGSLDKTIRVWNYVTGAC 331
           T   DS V +WD+     +  L GH + +  +     D ++++ S D TIR+W+ V G  
Sbjct: 223 TAGRDSVVRLWDIRARVAVMTLIGHKNPINKVHCLPVDPQIVSCSTDATIRLWDIVAGKS 282

Query: 332 VSTYRGHQDSVLSVDSFR--KLIVSGSADKTVKVWHVES---RTCYTLRGHTGWVNCVKL 386
           +     H+ SV ++ +F   +  +S  +   ++ W +      T +   G  G +N + +
Sbjct: 283 MKVITHHKKSVRNI-AFHPTEFSMSSCSANDIRSWKLPEGGLLTNFNSDG-LGIINTLSI 340

Query: 387 HPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXX 446
           + +    F+GSD+  +  +D ++       H +   + K IP +L S+            
Sbjct: 341 N-QDDVLFAGSDNGMLSFYDYKSG------HKYQSMMTKEIPGSLESE------------ 381

Query: 447 XXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFG 497
                     +  + FD +      LL+   D +IK+W++ + A   T  G
Sbjct: 382 --------RGILCSTFDRT---GLRLLTGETDKSIKIWSMDSDATPETDPG 421

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/176 (22%), Positives = 66/176 (37%), Gaps = 45/176 (25%)

Query: 362 KVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVG 421
           K+W +E     T+  +  ++  + +   +    +G D + +R+WDIR    V    GH  
Sbjct: 195 KIWLLE----ITMATYHEYIQMIFILLLNLIATAGRDSV-VRLWDIRARVAVMTLIGHKN 249

Query: 422 QVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTI 481
            + KV                                     H LP    ++SCS D TI
Sbjct: 250 PINKV-------------------------------------HCLPVDPQIVSCSTDATI 272

Query: 482 KLWNVKTGACIRTQFGHVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQTGKCMHTF 535
           +LW++  G  ++    H + V +IA     F + S S +   + W L  G  +  F
Sbjct: 273 RLWDIVAGKSMKVITHHKKSVRNIAFHPTEFSMSSCSAN-DIRSWKLPEGGLLTNF 327

 Score = 36.6 bits (83), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 37/78 (47%), Gaps = 4/78 (5%)

Query: 478 DNTIKLWNVKTGACIRTQFGH---VEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHT 534
           D+ ++LW+++    + T  GH   +  V  +  D  +IVS S D + ++WD+  GK M  
Sbjct: 227 DSVVRLWDIRARVAVMTLIGHKNPINKVHCLPVDP-QIVSCSTDATIRLWDIVAGKSMKV 285

Query: 535 FVGIHAPVACVGIGDSEF 552
                  V  +    +EF
Sbjct: 286 ITHHKKSVRNIAFHPTEF 303

>AGL301C [4011] [Homologous to ScYER107C (GLE2) - SH]
           (137221..138306) [1086 bp, 361 aa]
          Length = 361

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 58/96 (60%), Gaps = 8/96 (8%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF------DDQKLITGSLDKTIRVWNYV 327
           +G  D+ + ++D+A+G+  +++  H   V+ALRF      + + ++TGS DKTI+ W+  
Sbjct: 94  SGGCDNILKLYDVASGQA-QQIGSHDSAVRALRFVQCGPSNQECIVTGSWDKTIKYWDMR 152

Query: 328 TGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKV 363
               +ST     + V ++DS +KL+V G+A++ + V
Sbjct: 153 QPQPISTV-AMPERVYALDSKQKLLVVGTAERHIVV 187

 Score = 37.7 bits (86), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 51/120 (42%), Gaps = 10/120 (8%)

Query: 299 TDGVKALRFDDQK---LITGSLDKTIRVWNYVTGACVSTYR-GHQDSVLSV--DSFRKLI 352
            D V  + F  Q+       + D T+R+W+   G      +  HQ  VL+    S    +
Sbjct: 33  NDSVSDIAFSPQQDFLFSVAAWDNTVRIWDVQNGMTQGRAQYEHQAPVLTTRWSSDGTKV 92

Query: 353 VSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKL---HPKSFTCF-SGSDDMTIRMWDIR 408
            SG  D  +K++ V S     +  H   V  ++     P +  C  +GS D TI+ WD+R
Sbjct: 93  ASGGCDNILKLYDVASGQAQQIGSHDSAVRALRFVQCGPSNQECIVTGSWDKTIKYWDMR 152

 Score = 37.4 bits (85), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 47/100 (47%), Gaps = 12/100 (12%)

Query: 275 GSYDSTVAIWDLATGKLIRRLS-GHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGAC 331
            ++D+TV IWD+  G    R    H   V   R+  D  K+ +G  D  +++++  +G  
Sbjct: 52  AAWDNTVRIWDVQNGMTQGRAQYEHQAPVLTTRWSSDGTKVASGGCDNILKLYDVASGQA 111

Query: 332 VSTYRGHQDSVLSVDSF-------RKLIVSGSADKTVKVW 364
                G  DS +    F       ++ IV+GS DKT+K W
Sbjct: 112 QQI--GSHDSAVRALRFVQCGPSNQECIVTGSWDKTIKYW 149

 Score = 33.5 bits (75), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 35/65 (53%), Gaps = 5/65 (7%)

Query: 478 DNTIKLWNVKTGACI-RTQFGHVEGVWDI--AADNFRIVSGSHDRSCKVWDLQTGKCMHT 534
           DNT+++W+V+ G    R Q+ H   V     ++D  ++ SG  D   K++D+ +G+    
Sbjct: 55  DNTVRIWDVQNGMTQGRAQYEHQAPVLTTRWSSDGTKVASGGCDNILKLYDVASGQAQQ- 113

Query: 535 FVGIH 539
            +G H
Sbjct: 114 -IGSH 117

>Scas_465.4
          Length = 1002

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 40/58 (68%), Gaps = 2/58 (3%)

Query: 471 HLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA--ADNFRIVSGSHDRSCKVWDL 526
           ++ SCS D +IKLWN++TG  + T +GH   +W++    ++ +++S S D +C+VWD+
Sbjct: 193 YITSCSDDRSIKLWNLQTGEELCTGWGHTARIWNLKFFNNDTQLISVSEDNTCRVWDI 250

 Score = 36.6 bits (83), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 66/138 (47%), Gaps = 13/138 (9%)

Query: 281 VAIWDLATGKLIRR--LSG-----HTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVS 333
           V + DL TG+++ R  L G     ++  +K    +   +  G++   + +W+      + 
Sbjct: 115 VFVCDL-TGEILSRKTLQGERSILYSGSIKEFSPEKVYISAGTVMGGVLIWDLFLETKLY 173

Query: 334 TYRGHQDSVL--SVDSFRKLIVSGSADKTVKVWHVES--RTCYTLRGHTGWVNCVKLHPK 389
              GH+ S+   ++    + I S S D+++K+W++++    C T  GHT  +  +K    
Sbjct: 174 NLVGHEGSIFYATISDNGRYITSCSDDRSIKLWNLQTGEELC-TGWGHTARIWNLKFFNN 232

Query: 390 SFTCFSGSDDMTIRMWDI 407
                S S+D T R+WDI
Sbjct: 233 DTQLISVSEDNTCRVWDI 250

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 278 DSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWN 325
           D ++ +W+L TG+ +    GHT  +  L+F  +D +LI+ S D T RVW+
Sbjct: 200 DRSIKLWNLQTGEELCTGWGHTARIWNLKFFNNDTQLISVSEDNTCRVWD 249

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 36/67 (53%), Gaps = 4/67 (5%)

Query: 467 PYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEG--VWDIAADNFR-IVSGSHDRSCKV 523
           P   ++ + ++   + +W++     +    GH EG   +   +DN R I S S DRS K+
Sbjct: 147 PEKVYISAGTVMGGVLIWDLFLETKLYNLVGH-EGSIFYATISDNGRYITSCSDDRSIKL 205

Query: 524 WDLQTGK 530
           W+LQTG+
Sbjct: 206 WNLQTGE 212

>YER066W (YER066W) [1497] chr5 (290240..290797) Protein containing
           three WD domains (WD-40 repeat), which may mediate
           protein-protein interactions, has high similarity to a
           region of S. cerevisiae Cdc4p, which is a component of
           the SCF-Cdc4p complex involved in ubiquitin-dependent
           degradation [558 bp, 185 aa]
          Length = 185

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 38/147 (25%), Positives = 64/147 (43%), Gaps = 23/147 (15%)

Query: 290 KLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWN-----------YVTGAC----- 331
           K +  LSGHTD + +  +D ++   I+ S+D TIR+W+           Y T +      
Sbjct: 2   KCLYILSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLENIRNNGECSYATNSASPCAK 61

Query: 332 ----VSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLH 387
               + T RGH+  V  +    K +VS S D +++ W   +        HT       LH
Sbjct: 62  ILGAMYTLRGHRALVGLLGLSDKFLVSASVDGSIRCWDANTYFLKHFFDHTQLNTITALH 121

Query: 388 PKSFTCFSGSDDMTIRMWDIRTNTCVR 414
                  SGS+ + + ++D+ +   VR
Sbjct: 122 VSDEVLVSGSEGL-LNIYDLNSGLLVR 147

 Score = 29.6 bits (65), Expect = 4.2,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 36/87 (41%), Gaps = 22/87 (25%)

Query: 491 CIRTQFGHVEGVWDIAADN--FRIVSGSHDRSCKVWDLQ----TGKC------------- 531
           C+    GH + ++    D+   R +S S D + ++WDL+     G+C             
Sbjct: 3   CLYILSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLENIRNNGECSYATNSASPCAKI 62

Query: 532 ---MHTFVGIHAPVACVGIGDSEFVSG 555
              M+T  G  A V  +G+ D   VS 
Sbjct: 63  LGAMYTLRGHRALVGLLGLSDKFLVSA 89

 Score = 28.9 bits (63), Expect = 7.4,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 42/106 (39%), Gaps = 21/106 (19%)

Query: 473 LSCSLDNTIKLWNVK----TGAC----------------IRTQFGHVEGVWDIAADNFRI 512
           +S S+D TI++W+++     G C                + T  GH   V  +   +  +
Sbjct: 27  ISASMDTTIRIWDLENIRNNGECSYATNSASPCAKILGAMYTLRGHRALVGLLGLSDKFL 86

Query: 513 VSGSHDRSCKVWDLQTGKCMHTFVGIHA-PVACVGIGDSEFVSGDE 557
           VS S D S + WD  T    H F       +  + + D   VSG E
Sbjct: 87  VSASVDGSIRCWDANTYFLKHFFDHTQLNTITALHVSDEVLVSGSE 132

>Kwal_27.10785
          Length = 367

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 58/96 (60%), Gaps = 8/96 (8%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF------DDQKLITGSLDKTIRVWNYV 327
           +G  D+ V ++D+++G+  +++  H   VK+LRF      + + L+TGS DKTI+ W+  
Sbjct: 96  SGGCDNAVMVFDVSSGQS-QQVGAHDAAVKSLRFVQCGPSNTECLVTGSWDKTIKYWDLR 154

Query: 328 TGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKV 363
               VST     + V ++DS +KL+V G+A++ + V
Sbjct: 155 QPQPVSTL-AMPERVYTMDSKQKLLVVGTAERHIVV 189

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 60/137 (43%), Gaps = 18/137 (13%)

Query: 285 DLATGKLIRRLSGHTDGVKALRFDDQK---LITGSLDKTIRVWNYVTGA--CVSTYRGHQ 339
           DLA   +I   +   D +  + F  Q+       S DK +RVW+   G   C + Y+ HQ
Sbjct: 23  DLANDIVINNPA--EDSISDIAFSPQQDFLFSVSSWDKKVRVWDVNGGQAQCRAEYQ-HQ 79

Query: 340 DSVL----SVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKL---HPKSFT 392
             VL    S D  +  I SG  D  V V+ V S     +  H   V  ++     P +  
Sbjct: 80  APVLATRWSTDGTK--IASGGCDNAVMVFDVSSGQSQQVGAHDAAVKSLRFVQCGPSNTE 137

Query: 393 CF-SGSDDMTIRMWDIR 408
           C  +GS D TI+ WD+R
Sbjct: 138 CLVTGSWDKTIKYWDLR 154

 Score = 33.1 bits (74), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 46/99 (46%), Gaps = 12/99 (12%)

Query: 276 SYDSTVAIWDLATGKL-IRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGACV 332
           S+D  V +WD+  G+   R    H   V A R+  D  K+ +G  D  + V++  +G   
Sbjct: 55  SWDKKVRVWDVNGGQAQCRAEYQHQAPVLATRWSTDGTKIASGGCDNAVMVFDVSSGQ-- 112

Query: 333 STYRGHQDSVLSVDSF-------RKLIVSGSADKTVKVW 364
           S   G  D+ +    F        + +V+GS DKT+K W
Sbjct: 113 SQQVGAHDAAVKSLRFVQCGPSNTECLVTGSWDKTIKYW 151

>ABL024W [568] [Homologous to ScYMR102C - SH; ScYKL121W - SH]
           complement(353684..355888) [2205 bp, 734 aa]
          Length = 734

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 38/82 (46%), Gaps = 2/82 (2%)

Query: 338 HQDSVLSVD-SFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPK-SFTCFS 395
           H   +L  D S    +++ S DKTVK+WH+   T      H  +V CV+ HP      FS
Sbjct: 213 HLQDILDCDWSKNSFLLTASMDKTVKLWHINRTTSLKTFVHPDFVTCVRFHPHDDRFFFS 272

Query: 396 GSDDMTIRMWDIRTNTCVRVFH 417
           G  D T+R W I        F+
Sbjct: 273 GCLDHTVRTWSILEGEVAEAFN 294

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 67/174 (38%), Gaps = 22/174 (12%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF---DDQKLITGSLDKTIRVWNYVTGA 330
           T S D TV +W +     ++    H D V  +RF   DD+   +G LD T+R W+ + G 
Sbjct: 230 TASMDKTVKLWHINRTTSLKTFV-HPDFVTCVRFHPHDDRFFFSGCLDHTVRTWSILEGE 288

Query: 331 CVSTYR-GHQDSVLSVDSFRKLIVSGSADKTVKVWHVES----RTCYTLRGHTGWVNCVK 385
               +  G     L V      ++ G+ +  V V H        + + L+      N  +
Sbjct: 289 VAEAFNCGDLIMALDVSPDGNWLLIGTFNGYVHVLHTNGLKLLHSFHLLQKPNETENRPR 348

Query: 386 LHPKS-------------FTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKV 426
             PK                    S+D  +R++D+ T   + +F G   +  ++
Sbjct: 349 HGPKITGVEFIRHKAYPWLGLLITSNDSRVRLFDMSTTRLLEIFRGFSNESSRI 402

 Score = 33.1 bits (74), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 4/67 (5%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDI---AADNFRIVSGSHDRSCKVWDLQT 528
           LL+ S+D T+KLW++     ++T F H + V  +     D+    SG  D + + W +  
Sbjct: 228 LLTASMDKTVKLWHINRTTSLKT-FVHPDFVTCVRFHPHDDRFFFSGCLDHTVRTWSILE 286

Query: 529 GKCMHTF 535
           G+    F
Sbjct: 287 GEVAEAF 293

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 4/58 (6%)

Query: 312 LITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFR---KLIVSGSADKTVKVWHV 366
           L+T S+DKT+++W+      + T+  H D V  V       +   SG  D TV+ W +
Sbjct: 228 LLTASMDKTVKLWHINRTTSLKTFV-HPDFVTCVRFHPHDDRFFFSGCLDHTVRTWSI 284

>Sklu_2416.5 YNL317W, Contig c2416 8692-10071
          Length = 459

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 40/72 (55%), Gaps = 8/72 (11%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFR-----IVSGSHDRSCKVWDL 526
            ++CS DN +K+WN   G   R   GH    WD+ + ++      IVSGS D   K+WD 
Sbjct: 180 FVTCSDDNILKIWNFSNGQQERVLSGHH---WDVKSCDWHPTMGLIVSGSKDNLIKLWDP 236

Query: 527 QTGKCMHTFVGI 538
           ++G+C+ T +G 
Sbjct: 237 RSGQCISTILGF 248

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 59/149 (39%), Gaps = 5/149 (3%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGACV 332
            +Y    ++W+ +T      +  H   V  + +      LI+G  D  I++W        
Sbjct: 99  ATYSGEFSLWNGSTFNFESIMQAHDSAVTTMEYSHAGDWLISGDSDGIIKIWQPNFNMVK 158

Query: 333 STYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWHVES-RTCYTLRGHTGWVNCVKLHPK 389
              + H + V  +S        V+ S D  +K+W+  + +    L GH   V     HP 
Sbjct: 159 VLDQAHMECVRDVSFSGTDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWDVKSCDWHPT 218

Query: 390 SFTCFSGSDDMTIRMWDIRTNTCVRVFHG 418
                SGS D  I++WD R+  C+    G
Sbjct: 219 MGLIVSGSKDNLIKLWDPRSGQCISTILG 247

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 76/146 (52%), Gaps = 9/146 (6%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGAC 331
           T S D+ + IW+ + G+  R LSGH   VK+  +      +++GS D  I++W+  +G C
Sbjct: 182 TCSDDNILKIWNFSNGQQERVLSGHHWDVKSCDWHPTMGLIVSGSKDNLIKLWDPRSGQC 241

Query: 332 VSTYRGHQDSVLSV---DSFRKLIVSGSADKTVKVWHVES--RTCYTLRGHTGWVNCVKL 386
           +ST  G + +++      +   L+   + DK+ K++ +    +   + R  + ++  +  
Sbjct: 242 ISTILGFKHTIIKTKFQPTKGNLLAVVAKDKSCKIFDIRQNMKELKSFRDESDYM-SLTW 300

Query: 387 HPKSFTCFS-GSDDMTIRMWDIRTNT 411
           HP + + F+ G  D +++ +D+  +T
Sbjct: 301 HPINESIFTVGCYDGSLKHFDLLQDT 326

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 51/238 (21%), Positives = 90/238 (37%), Gaps = 54/238 (22%)

Query: 310 QKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRK--LIVSGSADKTVKVWHVE 367
           ++L+  +      +WN  T    S  + H  +V +++       ++SG +D  +K+W   
Sbjct: 94  RRLVVATYSGEFSLWNGSTFNFESIMQAHDSAVTTMEYSHAGDWLISGDSDGIIKIWQPN 153

Query: 368 SRTCYTL-RGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKV 426
                 L + H   V  V          + SDD  +++W+       RV  GH       
Sbjct: 154 FNMVKVLDQAHMECVRDVSFSGTDSKFVTCSDDNILKIWNFSNGQQERVLSGH------- 206

Query: 427 IPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTH--LLSCSLDNTIKLW 484
                                         V++ ++     +PT   ++S S DN IKLW
Sbjct: 207 ---------------------------HWDVKSCDW-----HPTMGLIVSGSKDNLIKLW 234

Query: 485 NVKTGACIRTQFGHVEGVWDIAADNFRIVSG------SHDRSCKVWDL-QTGKCMHTF 535
           + ++G CI T  G       I    F+   G      + D+SCK++D+ Q  K + +F
Sbjct: 235 DPRSGQCISTILGFKH---TIIKTKFQPTKGNLLAVVAKDKSCKIFDIRQNMKELKSF 289

>Scas_721.128
          Length = 851

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 40/87 (45%), Gaps = 2/87 (2%)

Query: 332 VSTYRGHQDSVLSVD-SFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKS 390
           V  Y+ H   +L +D S    +++ S DK V +WH +  T      H  +V  V+ HPK 
Sbjct: 260 VRIYKEHSHDILDLDWSKNNFLLTASMDKLVSLWHPDRETSLKSFPHPDFVTSVRFHPKD 319

Query: 391 FTCF-SGSDDMTIRMWDIRTNTCVRVF 416
              F SG  D   RMW I  N  V  F
Sbjct: 320 DRFFVSGCLDHKCRMWSILENKVVYEF 346

 Score = 32.7 bits (73), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 33/67 (49%), Gaps = 4/67 (5%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDI---AADNFRIVSGSHDRSCKVWDLQT 528
           LL+ S+D  + LW+      +++ F H + V  +     D+   VSG  D  C++W +  
Sbjct: 281 LLTASMDKLVSLWHPDRETSLKS-FPHPDFVTSVRFHPKDDRFFVSGCLDHKCRMWSILE 339

Query: 529 GKCMHTF 535
            K ++ F
Sbjct: 340 NKVVYEF 346

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 39/182 (21%), Positives = 66/182 (36%), Gaps = 39/182 (21%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF---DDQKLITGSLDKTIRVW------ 324
           T S D  V++W       ++    H D V ++RF   DD+  ++G LD   R+W      
Sbjct: 283 TASMDKLVSLWHPDRETSLKSFP-HPDFVTSVRFHPKDDRFFVSGCLDHKCRMWSILENK 341

Query: 325 --------NYVTGACVS----------TYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHV 366
                   + +T   +S          T+ G+  ++LS    + L      DK ++    
Sbjct: 342 VVYEFDCQDLITAISISPGVGEFTIIGTFNGYI-TILSTFELKPLYTFHVLDKHMQGNSG 400

Query: 367 ESRTCYTLRGH----------TGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVF 416
              +   L G           TG    ++           S D  IR++D+  N  + VF
Sbjct: 401 NDSSFKNLLGQNLKNHHGPRVTGLQLFLEKETDDLKLLVSSTDSRIRIFDLEKNKLIEVF 460

Query: 417 HG 418
            G
Sbjct: 461 KG 462

>CAGL0J06512g complement(620516..622153) similar to sp|Q04199
           Saccharomyces cerevisiae YML102w CAC2, start by
           similarity
          Length = 545

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 43/80 (53%), Gaps = 2/80 (2%)

Query: 308 DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSV--DSFRKLIVSGSADKTVKVWH 365
           DD+ L+T S+D +++V+N  TG CV+  + H   V  V  D   + I+S S D+++ ++ 
Sbjct: 163 DDKYLVTASMDNSLKVFNVDTGNCVAFAKDHNHYVQGVTWDPLNQYIISQSVDRSINIYE 222

Query: 366 VESRTCYTLRGHTGWVNCVK 385
           +E R    +   T     +K
Sbjct: 223 IELRDSKDITSSTTSTELIK 242

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 40/65 (61%), Gaps = 6/65 (9%)

Query: 467 PYPTHLLSCSLDNTIKLWNVKTGACIRTQFGH---VEGV-WDIAADNFRIVSGSHDRSCK 522
           P   +L++ S+DN++K++NV TG C+     H   V+GV WD    N  I+S S DRS  
Sbjct: 162 PDDKYLVTASMDNSLKVFNVDTGNCVAFAKDHNHYVQGVTWDPL--NQYIISQSVDRSIN 219

Query: 523 VWDLQ 527
           +++++
Sbjct: 220 IYEIE 224

>CAGL0K03377g complement(306529..309465) similar to sp|Q03177
           Saccharomyces cerevisiae YMR102c, hypothetical start
          Length = 978

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 37/78 (47%), Gaps = 2/78 (2%)

Query: 332 VSTYRGHQDSVLSVD-SFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKS 390
           V TY+ H   VL +D S    ++S S DKT K+WH           H  +V CVK HP  
Sbjct: 405 VRTYKEHLHDVLDMDWSKNNFLISASMDKTAKLWHPSKMRSLKSFQHPDFVTCVKFHPTD 464

Query: 391 FTCF-SGSDDMTIRMWDI 407
              F SG  D   R+W I
Sbjct: 465 DRFFISGCLDQKCRLWSI 482

 Score = 29.6 bits (65), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 4/58 (6%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDI---AADNFRIVSGSHDRSCKVWDL 526
           L+S S+D T KLW+      +++ F H + V  +     D+   +SG  D+ C++W +
Sbjct: 426 LISASMDKTAKLWHPSKMRSLKS-FQHPDFVTCVKFHPTDDRFFISGCLDQKCRLWSI 482

>KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomyces
           cerevisiae YPL183c, start by similarity
          Length = 990

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 35/53 (66%), Gaps = 2/53 (3%)

Query: 276 SYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNY 326
           S D ++ IWD+ +GKL+ R  GHT  +  L+F  DD +LI+ S D T RVWNY
Sbjct: 200 SDDRSIIIWDMVSGKLLSRAWGHTARIWNLKFFNDDTQLISVSEDCTCRVWNY 252

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 53/113 (46%), Gaps = 5/113 (4%)

Query: 315 GSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFR--KLIVSGSADKTVKVWH-VESRTC 371
           G++   I VW   +   + T RGH+ S+  V +    KL+ S S D+++ +W  V  +  
Sbjct: 157 GTIMNGIIVWELDSKKKIHTLRGHEGSIFYVTTSNNGKLLASCSDDRSIIIWDMVSGKLL 216

Query: 372 YTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTN--TCVRVFHGHVGQ 422
               GHT  +  +K         S S+D T R+W+ + +  T   +F  H+ +
Sbjct: 217 SRAWGHTARIWNLKFFNDDTQLISVSEDCTCRVWNYKNDELTIKDIFESHLTK 269

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQT 528
           L SCS D +I +W++ +G  +   +GH   +W++    D+ +++S S D +C+VW+ + 
Sbjct: 196 LASCSDDRSIIIWDMVSGKLLSRAWGHTARIWNLKFFNDDTQLISVSEDCTCRVWNYKN 254

 Score = 37.7 bits (86), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 55/239 (23%), Positives = 94/239 (39%), Gaps = 47/239 (19%)

Query: 294 RLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKLIV 353
             S + + +  L   ++ LI    + T++  ++V G     Y G     + V   + L+ 
Sbjct: 100 EFSFNKEEIYLLTSYNRVLIIDPDNFTVKSTHFVEGERSILYSGS----IKVLRHKVLVN 155

Query: 354 SGSADKTVKVWHVESRT-CYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTC 412
           +G+    + VW ++S+   +TLRGH G +  V          S SDD +I +WD+ +   
Sbjct: 156 AGTIMNGIIVWELDSKKKIHTLRGHEGSIFYVTTSNNGKLLASCSDDRSIIIWDMVSGKL 215

Query: 413 VRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHL 472
           +    GH  ++     L   +D                                   T L
Sbjct: 216 LSRAWGHTARIWN---LKFFND----------------------------------DTQL 238

Query: 473 LSCSLDNTIKLWNVKTGA-CIRTQF-GHV-EGVW--DIAADNFRIVSGSHDRSCKVWDL 526
           +S S D T ++WN K     I+  F  H+ + VW  D+   N   +SG +D   KV +L
Sbjct: 239 ISVSEDCTCRVWNYKNDELTIKDIFESHLTKNVWGVDVEETNLIAISGGNDGRLKVTEL 297

 Score = 37.0 bits (84), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 51/98 (52%), Gaps = 4/98 (4%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDD--QKLITGSLDKTIRVWNYVTGACV 332
           G+  + + +W+L + K I  L GH   +  +   +  + L + S D++I +W+ V+G  +
Sbjct: 157 GTIMNGIIVWELDSKKKIHTLRGHEGSIFYVTTSNNGKLLASCSDDRSIIIWDMVSGKLL 216

Query: 333 STYRGHQDSVLSVDSFR--KLIVSGSADKTVKVWHVES 368
           S   GH   + ++  F     ++S S D T +VW+ ++
Sbjct: 217 SRAWGHTARIWNLKFFNDDTQLISVSEDCTCRVWNYKN 254

 Score = 30.0 bits (66), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 479 NTIKLWNVKTGACIRTQFGHVEGVWDIAADNF--RIVSGSHDRSCKVWDLQTGKCM 532
           N I +W + +   I T  GH   ++ +   N    + S S DRS  +WD+ +GK +
Sbjct: 161 NGIIVWELDSKKKIHTLRGHEGSIFYVTTSNNGKLLASCSDDRSIIIWDMVSGKLL 216

>Kwal_27.11126
          Length = 996

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 38/55 (69%), Gaps = 2/55 (3%)

Query: 474 SCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAA--DNFRIVSGSHDRSCKVWDL 526
           SCS D +IKLW++K+G  + T +GH   +W++    ++ +++S S D +C+VWD+
Sbjct: 198 SCSDDRSIKLWDLKSGQLLSTAWGHTARIWNLLFFDNDSKVISVSEDCTCRVWDI 252

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 53/103 (51%), Gaps = 8/103 (7%)

Query: 276 SYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGACVS 333
           S D ++ +WDL +G+L+    GHT  +  L F  +D K+I+ S D T RVW+      +S
Sbjct: 200 SDDRSIKLWDLKSGQLLSTAWGHTARIWNLLFFDNDSKVISVSEDCTCRVWDISEDNTLS 259

Query: 334 TYRGHQDSV------LSVDSFRKLIVSGSADKTVKVWHVESRT 370
               H+  +      L VD+ R +  +   D  +K+  +++++
Sbjct: 260 QASVHEGHLLKSVWGLDVDNERMIAATSGNDGRIKLTDLKAKS 302

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 56/123 (45%), Gaps = 3/123 (2%)

Query: 308 DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFR--KLIVSGSADKTVKVWH 365
           D   +  G++   + VW+  +   +  +  H+ ++  V + +  K   S S D+++K+W 
Sbjct: 150 DKVHINAGTVMDGVIVWDLESEQNLHHFTDHEGAIFFVTASKNGKYAASCSDDRSIKLWD 209

Query: 366 VES-RTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQ 424
           ++S +   T  GHT  +  +          S S+D T R+WDI  +  +     H G + 
Sbjct: 210 LKSGQLLSTAWGHTARIWNLLFFDNDSKVISVSEDCTCRVWDISEDNTLSQASVHEGHLL 269

Query: 425 KVI 427
           K +
Sbjct: 270 KSV 272

>KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces
           cerevisiae YKL213c DOA1 involved in ubiquitin-dependent
           proteolysis, start by similarity
          Length = 706

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 70/155 (45%), Gaps = 9/155 (5%)

Query: 257 GHMDGVXXXXXXXXXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGV-KALRFDDQKLITG 315
           GH   +           + S+D T  +W    G +   L GH+  V  A   +D  ++T 
Sbjct: 98  GHEGNICSLSGDFESLVSSSWDKTAKVW--TNGIVKWELKGHSASVWDAKLLNDGSVLTA 155

Query: 316 SLDKTIRVWNYVTGACVSTY-RGHQDSVLSVDSFR--KLIVSGSADKTVKVWHVESRTCY 372
           S D T+++W    G    T+ + H D V ++      K  VS S D T+K+ ++E    +
Sbjct: 156 SADTTVKLWK--NGTLAKTFDKLHSDVVRNICILDDGKHFVSCSNDGTLKLSNLEGGILH 213

Query: 373 TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDI 407
              GH  +V  VK  P S    S  +D T+R+W++
Sbjct: 214 EFIGHESFVYAVKQLP-SGDIVSCGEDRTVRIWNM 247

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 65/262 (24%), Positives = 109/262 (41%), Gaps = 51/262 (19%)

Query: 274 TGSYDSTVAIWDL-ATGKLIRRLSGHTDG-VKALRFDDQK--LITGSLDKTIRVWNYVTG 329
           + S D TV IW+L A G     ++  ++  V +L +D ++  L  G  +K I   + +  
Sbjct: 28  SASRDGTVRIWNLDADGNWEGSIAFSSEKFVNSLTYDAKQCVLFCGGQEKIIYGVSPLLA 87

Query: 330 ---ACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKL 386
                V T  GH+ ++ S+    + +VS S DKT KVW       + L+GH+  V   KL
Sbjct: 88  LGQEPVYTLVGHEGNICSLSGDFESLVSSSWDKTAKVW-TNGIVKWELKGHSASVWDAKL 146

Query: 387 HPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHG-HVGQVQKVIPLTLGSDLIEXXXXXXXX 445
                +  + S D T+++W  +  T  + F   H   V+ +  L  G             
Sbjct: 147 LNDG-SVLTASADTTVKLW--KNGTLAKTFDKLHSDVVRNICILDDGK------------ 191

Query: 446 XXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDI 505
                                    H +SCS D T+KL N++ G  +    GH   V+ +
Sbjct: 192 -------------------------HFVSCSNDGTLKLSNLE-GGILHEFIGHESFVYAV 225

Query: 506 AA-DNFRIVSGSHDRSCKVWDL 526
               +  IVS   DR+ ++W++
Sbjct: 226 KQLPSGDIVSCGEDRTVRIWNM 247

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 77/168 (45%), Gaps = 14/168 (8%)

Query: 245 WRKGIYRIQEFKGHMDGV-XXXXXXXXXXXTGSYDSTVAIWDLAT-GKLIRRLSGHTDGV 302
           W  GI +  E KGH   V            T S D+TV +W   T  K   +L  H+D V
Sbjct: 125 WTNGIVK-WELKGHSASVWDAKLLNDGSVLTASADTTVKLWKNGTLAKTFDKL--HSDVV 181

Query: 303 KAL-RFDDQK-LITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRK-LIVSGSADK 359
           + +   DD K  ++ S D T+++ N + G  +  + GH+  V +V       IVS   D+
Sbjct: 182 RNICILDDGKHFVSCSNDGTLKLSN-LEGGILHEFIGHESFVYAVKQLPSGDIVSCGEDR 240

Query: 360 TVKVWHVES--RTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMW 405
           TV++W+++   +   TL   + W   V + P       GS D  IR++
Sbjct: 241 TVRIWNMDGTIKQVITLPAISIW--TVDVLPNG-DIVVGSSDKIIRIF 285

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 66/270 (24%), Positives = 106/270 (39%), Gaps = 61/270 (22%)

Query: 290 KLIRRLSGHTDGVKAL-RFDDQKLITGSLDKTIRVWNYVT-----GACVSTYRGHQDSVL 343
           +L  +L GHT  V+++      ++ + S D T+R+WN        G+   +     +S L
Sbjct: 3   QLSAQLRGHTQDVRSVVSLSTTQVASASRDGTVRIWNLDADGNWEGSIAFSSEKFVNS-L 61

Query: 344 SVDSFRKLIVSGSADKTV----KVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDD 399
           + D+ + ++  G  +K +     +  +     YTL GH G  N   L     +  S S D
Sbjct: 62  TYDAKQCVLFCGGQEKIIYGVSPLLALGQEPVYTLVGHEG--NICSLSGDFESLVSSSWD 119

Query: 400 MTIRMWDIRTNTCVR-VFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQ 458
            T ++W   TN  V+    GH   V     L  GS                         
Sbjct: 120 KTAKVW---TNGIVKWELKGHSASVWDAKLLNDGS------------------------- 151

Query: 459 AANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRT-QFGHVEGVWDIAA--DNFRIVSG 515
                        +L+ S D T+KLW  K G   +T    H + V +I    D    VS 
Sbjct: 152 -------------VLTASADTTVKLW--KNGTLAKTFDKLHSDVVRNICILDDGKHFVSC 196

Query: 516 SHDRSCKVWDLQTGKCMHTFVGIHAPVACV 545
           S+D + K+ +L+ G  +H F+G  + V  V
Sbjct: 197 SNDGTLKLSNLE-GGILHEFIGHESFVYAV 225

>Scas_718.6*
          Length = 546

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 76/162 (46%), Gaps = 18/162 (11%)

Query: 289 GKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVD 346
           G+L    + H   + ++++  D +  I+  LD    +WN + G  +  +   Q    + +
Sbjct: 269 GRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTE 328

Query: 347 SF---------RKLIVSGSADKTVKVWHVE-SRTCYTLRGHTGWVNCVKLHPKSFTCFSG 396
           S           KL+V G  + ++ V+ ++ ++    L GH G ++C++ +  S    + 
Sbjct: 329 SLGVDIEWVDKDKLVVPG-VNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTS 387

Query: 397 SD-DMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLT-LGSDLI 436
           SD D +IR+W  +   C   F+GH    Q +I L+ +  DL+
Sbjct: 388 SDSDYSIRIWHGQKENCCNCFYGH---SQSIISLSWINDDLV 426

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 50/93 (53%), Gaps = 4/93 (4%)

Query: 278 DSTVAIWDLATGKLIRRLSGHTDGVKALRFD--DQKLITGS-LDKTIRVWNYVTGACVST 334
           + ++ ++ +   K I +L GH   +  + F+   + L+T S  D +IR+W+     C + 
Sbjct: 348 NGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNC 407

Query: 335 YRGHQDSVLSVDSFR-KLIVSGSADKTVKVWHV 366
           + GH  S++S+      L++S S D +V++W V
Sbjct: 408 FYGHSQSIISLSWINDDLVISASMDGSVRIWSV 440

>YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protein
           containing six WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to S. cerevisiae Ykl121p, which binds
           phosphatidylinositol [2505 bp, 834 aa]
          Length = 834

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 38/75 (50%), Gaps = 2/75 (2%)

Query: 335 YRGHQDSVLSVD-SFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTC 393
           Y+ H   VL ++ S    I+S S DKTVK+WH + +       H  +V CV+ HP     
Sbjct: 274 YKEHVQDVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRF 333

Query: 394 F-SGSDDMTIRMWDI 407
           F SG  D   R+W I
Sbjct: 334 FISGCLDHKCRLWSI 348

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 4/58 (6%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDI---AADNFRIVSGSHDRSCKVWDL 526
           +LS S+D T+KLW+      ++T F H + V  +     D+   +SG  D  C++W +
Sbjct: 292 ILSASMDKTVKLWHPDRKNSLKT-FIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI 348

>YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein
           containing three WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           weak similarity to a region of S. pombe Cwf1p, which is
           a putative spliceosomal subunit and component of a 40S
           snRNP-containing complex [1254 bp, 417 aa]
          Length = 417

 Score = 48.9 bits (115), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (56%), Gaps = 2/72 (2%)

Query: 466 LPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA-ADNFR-IVSGSHDRSCKV 523
            P    L+S S D  +K+W+VK G+  RT  GH   V DIA  D  R ++S S D + ++
Sbjct: 145 FPSGEALISSSQDMQLKIWSVKDGSNPRTLIGHRATVTDIAIIDRGRNVLSASLDGTIRL 204

Query: 524 WDLQTGKCMHTF 535
           W+  TG  +HTF
Sbjct: 205 WECGTGTTIHTF 216

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 68/172 (39%), Gaps = 35/172 (20%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQ--KLITGSLDKTIRVWNYVTGAC 331
           + S D  + IW +  G   R L GH   V  +   D+   +++ SLD TIR+W   TG  
Sbjct: 153 SSSQDMQLKIWSVKDGSNPRTLIGHRATVTDIAIIDRGRNVLSASLDGTIRLWECGTGTT 212

Query: 332 VSTYRGHQ---DSVLSVDSFRKLIVSGSADKTVKVWHVESRTC--YTLRGHTGWVNCVKL 386
           + T+   +   D V S+  F           T K  ++E  T   Y + GH   V  + +
Sbjct: 213 IHTFNRKENPHDGVNSIALFVGTDRQLHEISTSKKNNLEFGTYGKYVIAGHVSGV--ITV 270

Query: 387 H-----------PKSFTC---------------FSGSDDMTIRMWDIRTNTC 412
           H           P  FTC               ++G ++  +  WD+R+  C
Sbjct: 271 HNVFSKEQTIQLPSKFTCSCNSLTVDGNNANYIYAGYENGMLAQWDLRSPEC 322

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 59/146 (40%), Gaps = 22/146 (15%)

Query: 294 RLSGHT--------DGVKALRFDD-----------QKLITGSLDKTIRVWNYVTGACVST 334
           RL GH         DG K L+  D           ++ I G+ +  I+V +         
Sbjct: 72  RLDGHDFLFNTIIRDGSKMLKRADYTAVDTAKLQMRRFILGTTEGDIKVLDSNFNLQREI 131

Query: 335 YRGHQDSVLSVDSFR--KLIVSGSADKTVKVWHV-ESRTCYTLRGHTGWVNCVKLHPKSF 391
            + H   +  +  F   + ++S S D  +K+W V +     TL GH   V  + +  +  
Sbjct: 132 DQAHVSEITKLKFFPSGEALISSSQDMQLKIWSVKDGSNPRTLIGHRATVTDIAIIDRGR 191

Query: 392 TCFSGSDDMTIRMWDIRTNTCVRVFH 417
              S S D TIR+W+  T T +  F+
Sbjct: 192 NVLSASLDGTIRLWECGTGTTIHTFN 217

 Score = 36.6 bits (83), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 26/120 (21%), Positives = 40/120 (33%), Gaps = 37/120 (30%)

Query: 375 RGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSD 434
           + H   +  +K  P      S S DM +++W ++  +  R   GH   V  +  +  G +
Sbjct: 133 QAHVSEITKLKFFPSGEALISSSQDMQLKIWSVKDGSNPRTLIGHRATVTDIAIIDRGRN 192

Query: 435 LIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRT 494
                                                +LS SLD TI+LW   TG  I T
Sbjct: 193 -------------------------------------VLSASLDGTIRLWECGTGTTIHT 215

>AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146)
           [2931 bp, 976 aa]
          Length = 976

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 51/96 (53%), Gaps = 4/96 (4%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVK-ALRFDDQKLITG-SLDKTIRVWNYVTGACV 332
           G+    V +W+L TG +++RL GH   +  A+  DD +L+   S D++IRVW+  TG  V
Sbjct: 157 GTVMGGVVVWELHTGAVVQRLEGHEGSIFCAVVSDDGRLVASCSDDRSIRVWSLETGEQV 216

Query: 333 STYRGHQDSVLSVDSFRKL--IVSGSADKTVKVWHV 366
               GH   +  +   R    +VS S D T +VW V
Sbjct: 217 GIAWGHTARIWDLRFLRVADKLVSVSEDCTCRVWAV 252

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 35/55 (63%), Gaps = 6/55 (10%)

Query: 474 SCSLDNTIKLWNVKTGACIRTQFGHVEGVWDI----AADNFRIVSGSHDRSCKVW 524
           SCS D +I++W+++TG  +   +GH   +WD+     AD  ++VS S D +C+VW
Sbjct: 198 SCSDDRSIRVWSLETGEQVGIAWGHTARIWDLRFLRVAD--KLVSVSEDCTCRVW 250

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 33/52 (63%), Gaps = 2/52 (3%)

Query: 481 IKLWNVKTGACIRTQFGHVEGVW-DIAADNFRIV-SGSHDRSCKVWDLQTGK 530
           + +W + TGA ++   GH   ++  + +D+ R+V S S DRS +VW L+TG+
Sbjct: 163 VVVWELHTGAVVQRLEGHEGSIFCAVVSDDGRLVASCSDDRSIRVWSLETGE 214

 Score = 34.7 bits (78), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 38/86 (44%), Gaps = 1/86 (1%)

Query: 352 IVSGSADKTVKVWHVESRTCYT-LRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTN 410
           + +G+    V VW + +      L GH G + C  +        S SDD +IR+W + T 
Sbjct: 154 VCAGTVMGGVVVWELHTGAVVQRLEGHEGSIFCAVVSDDGRLVASCSDDRSIRVWSLETG 213

Query: 411 TCVRVFHGHVGQVQKVIPLTLGSDLI 436
             V +  GH  ++  +  L +   L+
Sbjct: 214 EQVGIAWGHTARIWDLRFLRVADKLV 239

>KLLA0C07513g complement(656060..657379) similar to sp|P39946
           Saccharomyces cerevisiae YOR269w PAC1 singleton, start
           by similarity
          Length = 439

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 75/184 (40%), Gaps = 28/184 (15%)

Query: 252 IQEFKGHMDGVXXXXXXXXXX-------XTGSYDSTVAIWDL---ATGKLIRRLSGHTDG 301
           +Q    HMDG+                  T S D    IW+L   +T   I+ L+GH   
Sbjct: 144 LQSTMAHMDGITSISISLPNENGRPAYLATTSKDLNTKIWELELDSTLSHIKTLAGHEHT 203

Query: 302 VKALRF----DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKLIVSGSA 357
           V   +F     D  L T S D  +++W+   G C+ +++ H   + S+    + +++GS 
Sbjct: 204 VSDCQFFERGADLLLATCSRDLYLKIWDISNGWCIKSFQPHTQWIRSLHVHGEFVLTGSN 263

Query: 358 DKTVKVWHVESRTCYTLR-GHTGWVNCV------------KLHPKSFT-CFSGSDDMTIR 403
           D  +++ H  S    ++  GH   V  V            +  P  F    S S D TIR
Sbjct: 264 DSAIRLTHWPSGNGLSMGIGHDFPVEKVLILIPDPQHLQPQYQPLGFQHVASASRDGTIR 323

Query: 404 MWDI 407
           +W +
Sbjct: 324 LWKV 327

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 73/179 (40%), Gaps = 40/179 (22%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVS 333
           T S D  + IWD++ G  I+    HT  +++L    + ++TGS D  IR+ ++ +G  +S
Sbjct: 220 TCSRDLYLKIWDISNGWCIKSFQPHTQWIRSLHVHGEFVLTGSNDSAIRLTHWPSGNGLS 279

Query: 334 TYRGHQDSVLSV-----------DSFRKL----IVSGSADKTVKVWHVE----------- 367
              GH   V  V             ++ L    + S S D T+++W V            
Sbjct: 280 MGIGHDFPVEKVLILIPDPQHLQPQYQPLGFQHVASASRDGTIRLWKVSLPKFIPHRPPR 339

Query: 368 -------SRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMW-----DIRTNTCVR 414
                   +    L  H  WV    L   +   FS SDD +++ W     ++ T TC +
Sbjct: 340 PNPLDTTFKVIAVLTDHNSWVR--DLRQFNDMLFSCSDDGSVKCWSLDWTNLSTTTCKK 396

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 64/284 (22%), Positives = 102/284 (35%), Gaps = 69/284 (24%)

Query: 286 LATGKLIR-----------RLSGHTDGVKALRFD-------DQKLITGSLDKTIRVWNYV 327
           L +GKL+R               H DG+ ++             L T S D   ++W   
Sbjct: 127 LDSGKLLRYDILNVELPLQSTMAHMDGITSISISLPNENGRPAYLATTSKDLNTKIWELE 186

Query: 328 TGACVS---TYRGHQDSVLSVDSFRK----LIVSGSADKTVKVWHVESRTCY-TLRGHTG 379
             + +S   T  GH+ +V     F +    L+ + S D  +K+W + +  C  + + HT 
Sbjct: 187 LDSTLSHIKTLAGHEHTVSDCQFFERGADLLLATCSRDLYLKIWDISNGWCIKSFQPHTQ 246

Query: 380 WVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXX 439
           W+  + +H +     +GS+D  IR+    +   + +  GH   V+KV+ L      ++  
Sbjct: 247 WIRSLHVHGE--FVLTGSNDSAIRLTHWPSGNGLSMGIGHDFPVEKVLILIPDPQHLQ-- 302

Query: 440 XXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVK------------ 487
                             Q   F        H+ S S D TI+LW V             
Sbjct: 303 ---------------PQYQPLGFQ-------HVASASRDGTIRLWKVSLPKFIPHRPPRP 340

Query: 488 -----TGACIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDL 526
                T   I     H   V D+   N  + S S D S K W L
Sbjct: 341 NPLDTTFKVIAVLTDHNSWVRDLRQFNDMLFSCSDDGSVKCWSL 384

 Score = 36.2 bits (82), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 39/76 (51%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKC 531
           L +CS D  +K+W++  G CI++   H + +  +      +++GS+D + ++    +G  
Sbjct: 218 LATCSRDLYLKIWDISNGWCIKSFQPHTQWIRSLHVHGEFVLTGSNDSAIRLTHWPSGNG 277

Query: 532 MHTFVGIHAPVACVGI 547
           +   +G   PV  V I
Sbjct: 278 LSMGIGHDFPVEKVLI 293

>YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translation
           initiation factor eIF3, p39 subunit, contains two WD
           (WD-40) repeats [1044 bp, 347 aa]
          Length = 347

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFR--IVSGSHDRSCKVWDLQTG 529
           L SCS D++  +W    G  + T  GH   +W I  D F    V+GS D S K+WD+  G
Sbjct: 25  LFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDVDCFTKYCVTGSADYSIKLWDVSNG 84

Query: 530 KCMHT 534
           +C+ T
Sbjct: 85  QCVAT 89

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 45/82 (54%), Gaps = 4/82 (4%)

Query: 294 RLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGACVSTYRGHQDSV--LSVDSFR 349
           +L+GH   +  ++++ +   L + S D +  VW  + G  + T  GH  ++  + VD F 
Sbjct: 5   KLTGHERPLTQVKYNKEGDLLFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDVDCFT 64

Query: 350 KLIVSGSADKTVKVWHVESRTC 371
           K  V+GSAD ++K+W V +  C
Sbjct: 65  KYCVTGSADYSIKLWDVSNGQC 86

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 41/80 (51%), Gaps = 3/80 (3%)

Query: 337 GHQDSVLSVDSFRK--LIVSGSADKTVKVWH-VESRTCYTLRGHTGWVNCVKLHPKSFTC 393
           GH+  +  V   ++  L+ S S D +  VW+ +      TL GHTG +  + +   +  C
Sbjct: 8   GHERPLTQVKYNKEGDLLFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDVDCFTKYC 67

Query: 394 FSGSDDMTIRMWDIRTNTCV 413
            +GS D +I++WD+    CV
Sbjct: 68  VTGSADYSIKLWDVSNGQCV 87

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 37/63 (58%), Gaps = 2/63 (3%)

Query: 276 SYDSTVAIWDLATGKLIRRLSGHTDGVKALRFD--DQKLITGSLDKTIRVWNYVTGACVS 333
           S DS+ ++W    G+ +  L GHT  + ++  D   +  +TGS D +I++W+   G CV+
Sbjct: 29  SKDSSASVWYSLNGERLGTLDGHTGTIWSIDVDCFTKYCVTGSADYSIKLWDVSNGQCVA 88

Query: 334 TYR 336
           T++
Sbjct: 89  TWK 91

>KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP 52 KD protein, start
           by similarity
          Length = 459

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 73/158 (46%), Gaps = 8/158 (5%)

Query: 276 SYDSTVAIWDLATGKLIRRLSGHTDGVKALRF-DDQKLI-TGSLDKTIRVWNYVTGACVS 333
           S+D T  + D      I    GH+  V +L F +D  L+ T  LD    +W+  +G  + 
Sbjct: 282 SFDKTWILIDTVKQAPILIQEGHSAEVFSLSFHNDGSLVSTAGLDAIALIWDIRSGKNIM 341

Query: 334 TYRGHQDSVLSVDSFRK--LIVSGSADKTVKVWHVESR-TCYTLRGHTGWVNCVKLHPKS 390
           + +GH   + SVD  +    + SGS D T+KVW +  +    T+  H   V+ VK + ++
Sbjct: 342 SLQGHSKPIYSVDWSQNGYQLASGSGDGTIKVWDIRKKGNVETILAHNSIVSQVKFNKQN 401

Query: 391 --FTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKV 426
             +   SG  D  + +++       R   GH+ +V  +
Sbjct: 402 GGYLVSSGY-DKKVNIFNDGNWIKERSLEGHLDKVMSI 438

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 60/123 (48%), Gaps = 14/123 (11%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQ--KLITGSLDKTIRVWNYVTGAC 331
           T   D+   IWD+ +GK I  L GH+  + ++ +     +L +GS D TI+VW+      
Sbjct: 322 TAGLDAIALIWDIRSGKNIMSLQGHSKPIYSVDWSQNGYQLASGSGDGTIKVWDIRKKGN 381

Query: 332 VSTYRGHQDSVLSVDSFRK----LIVSGSADKTVKVWH----VESRTCYTLRGHTGWVNC 383
           V T   H +S++S   F K     +VS   DK V +++    ++ R   +L GH   V  
Sbjct: 382 VETILAH-NSIVSQVKFNKQNGGYLVSSGYDKKVNIFNDGNWIKER---SLEGHLDKVMS 437

Query: 384 VKL 386
           + +
Sbjct: 438 IDI 440

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 45/96 (46%), Gaps = 3/96 (3%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK---LITGSLDKTIRVWNYVTGA 330
           +GS D T+ +WD+     +  +  H   V  ++F+ Q    L++   DK + ++N     
Sbjct: 364 SGSGDGTIKVWDIRKKGNVETILAHNSIVSQVKFNKQNGGYLVSSGYDKKVNIFNDGNWI 423

Query: 331 CVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHV 366
              +  GH D V+S+D     I S   D++V  W V
Sbjct: 424 KERSLEGHLDKVMSIDIVGPDIYSAGWDRSVNKWGV 459

 Score = 38.5 bits (88), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 42/74 (56%), Gaps = 2/74 (2%)

Query: 474 SCSLDNTIKLWNVKTGACIRTQFGHVEGVWDI--AADNFRIVSGSHDRSCKVWDLQTGKC 531
           +  LD    +W++++G  I +  GH + ++ +  + + +++ SGS D + KVWD++    
Sbjct: 322 TAGLDAIALIWDIRSGKNIMSLQGHSKPIYSVDWSQNGYQLASGSGDGTIKVWDIRKKGN 381

Query: 532 MHTFVGIHAPVACV 545
           + T +  ++ V+ V
Sbjct: 382 VETILAHNSIVSQV 395

>CAGL0L02761g complement(320826..322085) similar to sp|P18851
           Saccharomyces cerevisiae YOR212w STE4, hypothetical
           start
          Length = 419

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 56/251 (22%), Positives = 99/251 (39%), Gaps = 20/251 (7%)

Query: 295 LSGHTDGVKALRF-DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVD------S 347
             GHT  +  + F  + +++T S D T  +W+      V  Y  H   VL++       S
Sbjct: 170 FKGHTGYISGVEFVSESRVVTSSGDMTCALWDIPKAKRVREYSDHLGDVLAISIPVTNLS 229

Query: 348 FRKLIVSGSADKTVKVWHVESRTCYT-LRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWD 406
              +  S  +D    +W V S +        +   NC+K  P   +   G+DD TI ++D
Sbjct: 230 KNNMFASCGSDGYTFIWDVRSPSAVQQFSIGSCDSNCLKFFPDGNSVAVGNDDGTISLFD 289

Query: 407 IRTNTCVRVF----HGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANF 462
           +R +  + ++     G   Q + V    L S+  +                       + 
Sbjct: 290 LRADCTIALYSINDRGSPLQKENVF---LNSNEYQSSSSSPKSPISLATNYFEDRGVISL 346

Query: 463 DHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGH---VEGVWDIAADNFRIVSGSHDR 519
           D S      + SC ++   ++W+V  G  + +  GH   + GV   + D   I +GS D+
Sbjct: 347 DFS-GSGRLMYSCYINLGCQVWDVLKGEVVYSLEGHGNRLAGV-KCSPDGMAICTGSWDQ 404

Query: 520 SCKVWDLQTGK 530
           + K+W  Q  K
Sbjct: 405 TLKLWTPQYEK 415

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 69/152 (45%), Gaps = 12/152 (7%)

Query: 290 KLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLS--V 345
           K +  L GHT+ +   R+  D + +++ S D  + VW+ +TG   S        VL+  +
Sbjct: 76  KPVGILKGHTNKIADFRWSRDSKLILSASQDGFMIVWDSLTGLKRSAIPLDSQWVLTCAL 135

Query: 346 DSFRKLIVSGSADKTVKVWH------VESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDD 399
                L  S   +    ++       V+       +GHTG+++ V+   +S    S S D
Sbjct: 136 SPSGALAASAGLNNNCTIYRMPRGSAVQQNVTSIFKGHTGYISGVEFVSESRVVTS-SGD 194

Query: 400 MTIRMWDIRTNTCVRVFHGHVGQVQKV-IPLT 430
           MT  +WDI     VR +  H+G V  + IP+T
Sbjct: 195 MTCALWDIPKAKRVREYSDHLGDVLAISIPVT 226

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 283 IWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVW 324
           +WD+  G+++  L GH + +  ++   D   + TGS D+T+++W
Sbjct: 366 VWDVLKGEVVYSLEGHGNRLAGVKCSPDGMAICTGSWDQTLKLW 409

>Scas_660.7*
          Length = 603

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 67/143 (46%), Gaps = 19/143 (13%)

Query: 278 DSTVAIWDLATGKLIRRLSGHTD----GVKALR-FDDQKLITGSLDKTIRVWNYVTGACV 332
           D  +  +D  TG+ ++ +   ++    G+ AL   D+ K +T S D TIRVW+  +  CV
Sbjct: 214 DRKINCFDSKTGEFVKSIVDESEPIQGGIFALSWIDENKFVTASADATIRVWDVNSSKCV 273

Query: 333 STY---RGHQDSVLS------VDSFRKLIVSGSADKTVKVWHVESRTCYT-LRGHTGWVN 382
             +       D+VL       V S    IVS S D T+ ++ +E     T ++GH+  + 
Sbjct: 274 QKWVVTSSSDDNVLRDQQVGVVASQEGRIVSLSLDGTLNIFQLEQDNIITSIKGHSKGIT 333

Query: 383 CVKLHPKSFTCFSGSDDMTIRMW 405
            + ++P      +GS D  I  W
Sbjct: 334 ALAVNP----LITGSYDGKIMDW 352

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 42/88 (47%), Gaps = 10/88 (11%)

Query: 276 SYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTY 335
           S D T+ I+ L    +I  + GH+ G+ AL  +   LITGS D  I  W+         +
Sbjct: 306 SLDGTLNIFQLEQDNIITSIKGHSKGITALAVN--PLITGSYDGKIMDWSNKPEVA---H 360

Query: 336 RGHQDSVLSVDSFRKLIVSGSADKTVKV 363
             H + ++S+D     + +G AD+   V
Sbjct: 361 TKHNNLIVSID-----VQTGKADQISSV 383

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 274 TGSYDSTVAIWDLATG-KLIRRLSGHTDGVKALRFDD-QKLITGSLDKTIRVW 324
           TGS D+ + ++ +    K+I+RL+ H DG+ AL ++D   L++   D  I+ W
Sbjct: 546 TGSLDTNIFVYSIKRPMKIIKRLNAHKDGISALLWEDASTLVSTGADACIKKW 598

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 22/111 (19%), Positives = 55/111 (49%), Gaps = 15/111 (13%)

Query: 274 TGSYDSTVAIWDLATGKLIRR--LSGHTDG-------VKALRFDDQKLITGSLDKTIRVW 324
           T S D+T+ +WD+ + K +++  ++  +D        V  +   + ++++ SLD T+ ++
Sbjct: 255 TASADATIRVWDVNSSKCVQKWVVTSSSDDNVLRDQQVGVVASQEGRIVSLSLDGTLNIF 314

Query: 325 NYVTGACVSTYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWHVESRTCYT 373
                  +++ +GH   +  L+V+     +++GS D  +  W  +    +T
Sbjct: 315 QLEQDNIITSIKGHSKGITALAVNP----LITGSYDGKIMDWSNKPEVAHT 361

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 36/69 (52%), Gaps = 5/69 (7%)

Query: 473 LSCSLDNTIKLWNVKTGACIRTQFGHVE----GVWDIA-ADNFRIVSGSHDRSCKVWDLQ 527
           ++   D  I  ++ KTG  +++     E    G++ ++  D  + V+ S D + +VWD+ 
Sbjct: 209 ITVGSDRKINCFDSKTGEFVKSIVDESEPIQGGIFALSWIDENKFVTASADATIRVWDVN 268

Query: 528 TGKCMHTFV 536
           + KC+  +V
Sbjct: 269 SSKCVQKWV 277

>CAGL0M04081g complement(450572..451939) highly similar to sp|P42841
           Saccharomyces cerevisiae YNL317w PFS2 polyadenylation
           factor I, hypothetical start
          Length = 455

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/229 (21%), Positives = 87/229 (37%), Gaps = 53/229 (23%)

Query: 310 QKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRK--LIVSGSADKTVKVWHVE 367
           ++LI  +      +WN  +    +  + H  SV ++        ++SG AD T+K+W   
Sbjct: 95  RRLIVATFSGEFSLWNGSSFTFETIMQAHDTSVTTMKYSHAGDWMISGDADGTIKIWQPN 154

Query: 368 SRTCYTL-RGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKV 426
                 L R HT  +  V          + SDD  +++W+       RV  GH       
Sbjct: 155 FNMVKELDRIHTEGIRDVAFSNNDSKFVTCSDDNILKIWNFSNGQQERVLSGH------- 207

Query: 427 IPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNV 486
                                         V++ ++   L     ++S S DN +KLW+ 
Sbjct: 208 ---------------------------HWDVRSCDWHPELGL---IVSGSKDNLVKLWDP 237

Query: 487 KTGACIRT--QFGHVEGVWDIAADNFRIVSG------SHDRSCKVWDLQ 527
           ++G C+ T  +F H      +    F+   G      S D+SC+V+DL+
Sbjct: 238 RSGQCVSTLLKFKHT-----VLKTRFQPTKGNLLAAISKDKSCRVFDLR 281

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 40/72 (55%), Gaps = 8/72 (11%)

Query: 470 THLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFR-----IVSGSHDRSCKVW 524
           +  ++CS DN +K+WN   G   R   GH    WD+ + ++      IVSGS D   K+W
Sbjct: 179 SKFVTCSDDNILKIWNFSNGQQERVLSGHH---WDVRSCDWHPELGLIVSGSKDNLVKLW 235

Query: 525 DLQTGKCMHTFV 536
           D ++G+C+ T +
Sbjct: 236 DPRSGQCVSTLL 247

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/144 (21%), Positives = 62/144 (43%), Gaps = 5/144 (3%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGACV 332
            ++    ++W+ ++      +  H   V  +++      +I+G  D TI++W        
Sbjct: 100 ATFSGEFSLWNGSSFTFETIMQAHDTSVTTMKYSHAGDWMISGDADGTIKIWQPNFNMVK 159

Query: 333 STYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWHVES-RTCYTLRGHTGWVNCVKLHPK 389
              R H + +  ++  +     V+ S D  +K+W+  + +    L GH   V     HP+
Sbjct: 160 ELDRIHTEGIRDVAFSNNDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWDVRSCDWHPE 219

Query: 390 SFTCFSGSDDMTIRMWDIRTNTCV 413
                SGS D  +++WD R+  CV
Sbjct: 220 LGLIVSGSKDNLVKLWDPRSGQCV 243

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 69/149 (46%), Gaps = 16/149 (10%)

Query: 245 WRKGIYRIQEF-KGHMDGV--XXXXXXXXXXXTGSYDSTVAIWDLATGKLIRRLSGHTDG 301
           W+     ++E  + H +G+             T S D+ + IW+ + G+  R LSGH   
Sbjct: 151 WQPNFNMVKELDRIHTEGIRDVAFSNNDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWD 210

Query: 302 VKALRFDDQK--LITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSV---DSFRKLIVSGS 356
           V++  +  +   +++GS D  +++W+  +G CVST    + +VL      +   L+ + S
Sbjct: 211 VRSCDWHPELGLIVSGSKDNLVKLWDPRSGQCVSTLLKFKHTVLKTRFQPTKGNLLAAIS 270

Query: 357 ADKTVKVWHVESRTCYTLRGHTGWVNCVK 385
            DK+ +V        + LR     + CV+
Sbjct: 271 KDKSCRV--------FDLRASMNELMCVR 291

 Score = 35.8 bits (81), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 30/70 (42%), Gaps = 2/70 (2%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADN--FRIVSGSHDRSCKVWDLQTG 529
           ++S   D TIK+W             H EG+ D+A  N   + V+ S D   K+W+   G
Sbjct: 139 MISGDADGTIKIWQPNFNMVKELDRIHTEGIRDVAFSNNDSKFVTCSDDNILKIWNFSNG 198

Query: 530 KCMHTFVGIH 539
           +      G H
Sbjct: 199 QQERVLSGHH 208

>Kwal_55.21450
          Length = 503

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 69/152 (45%), Gaps = 21/152 (13%)

Query: 278 DSTVAIWDLATGK-LIRRLSGHTDGVKALRFDDQ--KLITGSLDKTIRVWNYVTGACVST 334
           D+ V IWDL   + L+R   GH+  V+ + F+ +  + ++ S D+ I++W+  TG     
Sbjct: 232 DNQVKIWDLYRDRELLRDYRGHSKAVRGISFNSEGSEFLSVSFDQQIKIWDTETGKVR-- 289

Query: 335 YRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRG------------HTGWVN 382
              HQ S   + +  +   S S +  V + + E R  Y LR             H   + 
Sbjct: 290 ---HQYSYSCIPNCAEFRPSNSNEFIVGLSNSEIRH-YDLRTSHKNGLVQVYDHHLSSII 345

Query: 383 CVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVR 414
            +K  P      S S+D ++R+W+ + N  ++
Sbjct: 346 ALKYFPDGSKFVSSSEDKSMRIWENQINIPIK 377

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 40/74 (54%), Gaps = 4/74 (5%)

Query: 466 LPYPTHL-LSCSLDNTIKLWNV-KTGACIRTQFGHVEGVWDIA--ADNFRIVSGSHDRSC 521
           LP   HL LS   DN +K+W++ +    +R   GH + V  I+  ++    +S S D+  
Sbjct: 219 LPKSGHLCLSAGNDNQVKIWDLYRDRELLRDYRGHSKAVRGISFNSEGSEFLSVSFDQQI 278

Query: 522 KVWDLQTGKCMHTF 535
           K+WD +TGK  H +
Sbjct: 279 KIWDTETGKVRHQY 292

 Score = 37.7 bits (86), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 40/89 (44%), Gaps = 5/89 (5%)

Query: 326 YVTGACVSTYRGHQD---SVLSVDSFRKLIVSGSADKTVKVWHV--ESRTCYTLRGHTGW 380
           Y+    + TY GH++   S+L +     L +S   D  VK+W +  +       RGH+  
Sbjct: 197 YLPKKLIHTYPGHKNGTNSILLLPKSGHLCLSAGNDNQVKIWDLYRDRELLRDYRGHSKA 256

Query: 381 VNCVKLHPKSFTCFSGSDDMTIRMWDIRT 409
           V  +  + +     S S D  I++WD  T
Sbjct: 257 VRGISFNSEGSEFLSVSFDQQIKIWDTET 285

 Score = 34.3 bits (77), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 44/96 (45%), Gaps = 7/96 (7%)

Query: 276 SYDSTVAIWDLATGKLIRRLSGH--TDGVKALRFDDQKLITGSLDKTIRVWNYVT---GA 330
           S+D  + IWD  TGK+  + S     +  +    +  + I G  +  IR ++  T     
Sbjct: 273 SFDQQIKIWDTETGKVRHQYSYSCIPNCAEFRPSNSNEFIVGLSNSEIRHYDLRTSHKNG 332

Query: 331 CVSTYRGHQDSVLSVDSFR--KLIVSGSADKTVKVW 364
            V  Y  H  S++++  F      VS S DK++++W
Sbjct: 333 LVQVYDHHLSSIIALKYFPDGSKFVSSSEDKSMRIW 368

>Sklu_2423.1 YLR409C, Contig c2423 869-3703
          Length = 944

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 37/61 (60%), Gaps = 2/61 (3%)

Query: 278 DSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGACVSTY 335
           D ++ + D  T K++R+L GH++ V A  F  D + +++ SLD TIR W+  TG C+   
Sbjct: 570 DLSIVVIDAVTQKVVRQLWGHSNRVTAFDFSPDGRWIVSASLDSTIRTWDLPTGGCIDGV 629

Query: 336 R 336
           R
Sbjct: 630 R 630

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 63/153 (41%), Gaps = 24/153 (15%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFD--DQKLITGSLDKTIRVWNYVTGAC- 331
           GS +  + +++L +G   ++   H   V  +  D  ++K+++  LD  I  +++   A  
Sbjct: 484 GSSEGGIGVYNLQSGLQRKKYRLHKKAVTGVAIDGMNRKMVSCGLDGLIGFYDFTKSAFL 543

Query: 332 --------VSTYRGHQDSVL---SVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGW 380
                   V++   H+ S L   ++D    +++     K V+           L GH+  
Sbjct: 544 GKLQLDAPVTSMVYHRSSDLFAVALDDLSIVVIDAVTQKVVR----------QLWGHSNR 593

Query: 381 VNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCV 413
           V      P      S S D TIR WD+ T  C+
Sbjct: 594 VTAFDFSPDGRWIVSASLDSTIRTWDLPTGGCI 626

 Score = 37.4 bits (85), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 65/182 (35%), Gaps = 39/182 (21%)

Query: 313 ITGSLDKTIRVWNYVTGACVSTYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWHVESRT 370
             GS +  I V+N  +G     YR H+ +V  +++D   + +VS   D  +  +      
Sbjct: 482 FVGSSEGGIGVYNLQSGLQRKKYRLHKKAVTGVAIDGMNRKMVSCGLDGLIGFYDFTKSA 541

Query: 371 CYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLT 430
                     V  +  H  S       DD++I + D  T   VR   GH  +V       
Sbjct: 542 FLGKLQLDAPVTSMVYHRSSDLFAVALDDLSIVVIDAVTQKVVRQLWGHSNRVTA----- 596

Query: 431 LGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGA 490
                                          FD S P    ++S SLD+TI+ W++ TG 
Sbjct: 597 -------------------------------FDFS-PDGRWIVSASLDSTIRTWDLPTGG 624

Query: 491 CI 492
           CI
Sbjct: 625 CI 626

 Score = 36.2 bits (82), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 3/66 (4%)

Query: 470 THLLSCSLDN-TIKLWNVKTGACIRTQFGHVEGV--WDIAADNFRIVSGSHDRSCKVWDL 526
           + L + +LD+ +I + +  T   +R  +GH   V  +D + D   IVS S D + + WDL
Sbjct: 561 SDLFAVALDDLSIVVIDAVTQKVVRQLWGHSNRVTAFDFSPDGRWIVSASLDSTIRTWDL 620

Query: 527 QTGKCM 532
            TG C+
Sbjct: 621 PTGGCI 626

>Scas_510.5
          Length = 362

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 61/101 (60%), Gaps = 8/101 (7%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF------DDQKLITGSLDKTIRVWNYV 327
           +G  D+ V ++D+A+G+  +++  H   VKA+RF      + + L+TGS DK+I+ W+  
Sbjct: 95  SGGCDNIVKLFDVASGQS-QQIGMHDAPVKAVRFVNCGPSNTECLVTGSWDKSIKYWDMR 153

Query: 328 TGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVES 368
               +ST     D V ++DS ++L+V G+A++ + + ++ +
Sbjct: 154 QPQAISTVI-MPDRVYTMDSKQQLLVVGTAERHIAIINLNN 193

 Score = 33.5 bits (75), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 50/120 (41%), Gaps = 12/120 (10%)

Query: 300 DGVKALRFDDQK---LITGSLDKTIRVWNYVTGACV--STYRGHQDSVLSV--DSFRKLI 352
           D +  + F  Q+       S D  +R+W+   G     S Y  H   VLS    +    +
Sbjct: 35  DSISDIAFSPQQDFIFSVSSWDGKVRIWDVQGGVAQGRSQYE-HAGPVLSTRWSNDGSKV 93

Query: 353 VSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKL---HPKSFTCF-SGSDDMTIRMWDIR 408
            SG  D  VK++ V S     +  H   V  V+     P +  C  +GS D +I+ WD+R
Sbjct: 94  ASGGCDNIVKLFDVASGQSQQIGMHDAPVKAVRFVNCGPSNTECLVTGSWDKSIKYWDMR 153

>CAGL0L06952g complement(780793..781836) highly similar to sp|P40217
           Saccharomyces cerevisiae YMR146c TIF34 translation
           initiation factor eIF3, start by similarity
          Length = 347

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 2/65 (3%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFRI--VSGSHDRSCKVWDLQTG 529
           L +CS D +  +W    G  + T  GH+  +W I +D+  +  V+GS D + KVW L  G
Sbjct: 25  LFTCSKDISASVWYSNNGERLGTLDGHMGSIWSIDSDHTSLYCVTGSADYTIKVWTLMNG 84

Query: 530 KCMHT 534
           +C+ T
Sbjct: 85  QCVQT 89

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKL--ITGSLDKTIRVWNYVTGAC 331
           T S D + ++W    G+ +  L GH   + ++  D   L  +TGS D TI+VW  + G C
Sbjct: 27  TCSKDISASVWYSNNGERLGTLDGHMGSIWSIDSDHTSLYCVTGSADYTIKVWTLMNGQC 86

Query: 332 VSTYR 336
           V T+ 
Sbjct: 87  VQTWN 91

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 42/81 (51%), Gaps = 4/81 (4%)

Query: 295 LSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKLI 352
           L GH   +  ++++ +   L T S D +  VW    G  + T  GH  S+ S+DS    +
Sbjct: 6   LMGHERPLTQVKYNREGDLLFTCSKDISASVWYSNNGERLGTLDGHMGSIWSIDSDHTSL 65

Query: 353 --VSGSADKTVKVWHVESRTC 371
             V+GSAD T+KVW + +  C
Sbjct: 66  YCVTGSADYTIKVWTLMNGQC 86

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 41/84 (48%), Gaps = 3/84 (3%)

Query: 337 GHQDSVLSVDSFRK--LIVSGSADKTVKVWHVES-RTCYTLRGHTGWVNCVKLHPKSFTC 393
           GH+  +  V   R+  L+ + S D +  VW+  +     TL GH G +  +     S  C
Sbjct: 8   GHERPLTQVKYNREGDLLFTCSKDISASVWYSNNGERLGTLDGHMGSIWSIDSDHTSLYC 67

Query: 394 FSGSDDMTIRMWDIRTNTCVRVFH 417
            +GS D TI++W +    CV+ ++
Sbjct: 68  VTGSADYTIKVWTLMNGQCVQTWN 91

>KLLA0E11297g complement(994770..996308) similar to sp|P38262
           Saccharomyces cerevisiae YBR103w SIF2 SIR4P interacting
           protein, start by similarity
          Length = 512

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 48/95 (50%), Gaps = 3/95 (3%)

Query: 280 TVAIWDLATGKLIRRLSGHTDGVKALRFD--DQKLITGSLDKTIRVWNYVTGACVSTYRG 337
           ++ ++ +   K + RL GHT  +  L F+  ++ L++ S D TI+VW     +  + +  
Sbjct: 321 SLLVYTIGNNKPLGRLLGHTSTITTLEFNKSNKSLLSASDDNTIKVWRGGNSSAANDFTD 380

Query: 338 HQDSVLSVDSFR-KLIVSGSADKTVKVWHVESRTC 371
           H  ++ S       LI+S + D TVKVW +   + 
Sbjct: 381 HTKTISSAHWINDDLIISTAYDGTVKVWSISKNSI 415

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/161 (19%), Positives = 67/161 (41%), Gaps = 12/161 (7%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQ--KLITGSLDKTIRVWNYVTGAC 331
           TG+    + +W+   GKL   L  H   + A++++     L+T  +   + +W+ +TG  
Sbjct: 226 TGTTSGELRLWN-KQGKLKNILDSHRSPIVAMKWNQDCTHLLTTDVSNVVILWSTLTGTQ 284

Query: 332 VSTYRGHQDSVLSVDSF---------RKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVN 382
           +  +   +  + + DS           K ++ G     +      ++    L GHT  + 
Sbjct: 285 LQHFSFKEGDIENEDSLGIDLEWVETDKFVIPGPGGSLLVYTIGNNKPLGRLLGHTSTIT 344

Query: 383 CVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQV 423
            ++ +  + +  S SDD TI++W    ++    F  H   +
Sbjct: 345 TLEFNKSNKSLLSASDDNTIKVWRGGNSSAANDFTDHTKTI 385

>KLLA0A08866g 776960..778231 weakly similar to sp|P53196
           Saccharomyces cerevisiae YGL004c singleton, hypothetical
           start
          Length = 423

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 43/86 (50%), Gaps = 3/86 (3%)

Query: 466 LPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA-ADNFR-IVSGSHDRSCKV 523
            P     LS S+D  +K+W+  TG  +RT  GH   V D A  D  R  VS S D S K+
Sbjct: 167 FPNGHGFLSSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAMVDRGRNFVSASSDGSLKL 226

Query: 524 WDLQTGKCMHTFVGIHAPVACVGIGD 549
           W+  T  C+ T +  +  + C+ + +
Sbjct: 227 WECSTSACVFT-LNSNDGINCISLAN 251

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 53/103 (51%), Gaps = 8/103 (7%)

Query: 290 KLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSV---LS 344
           ++I+    H   +   +F  +    ++ S+D  +++W+  TG  + T+ GH  SV     
Sbjct: 149 EVIKLPEAHASHITKTQFFPNGHGFLSSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAM 208

Query: 345 VDSFRKLIVSGSADKTVKVWHVESRTC-YTLRGHTGWVNCVKL 386
           VD  R   VS S+D ++K+W   +  C +TL  + G +NC+ L
Sbjct: 209 VDRGRNF-VSASSDGSLKLWECSTSACVFTLNSNDG-INCISL 249

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 2/63 (3%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDD--QKLITGSLDKTIRVWNYVTGAC 331
           + S D  + IWD +TG  +R   GHT  V      D  +  ++ S D ++++W   T AC
Sbjct: 175 SSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAMVDRGRNFVSASSDGSLKLWECSTSAC 234

Query: 332 VST 334
           V T
Sbjct: 235 VFT 237

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 26/120 (21%), Positives = 38/120 (31%), Gaps = 37/120 (30%)

Query: 375 RGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSD 434
             H   +   +  P      S S DM +++WD  T T +R F GH   V     +  G +
Sbjct: 155 EAHASHITKTQFFPNGHGFLSSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAMVDRGRN 214

Query: 435 LIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRT 494
            +                                     S S D ++KLW   T AC+ T
Sbjct: 215 FV-------------------------------------SASSDGSLKLWECSTSACVFT 237

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 34/71 (47%), Gaps = 1/71 (1%)

Query: 352 IVSGSADKTVKVWHVESRT-CYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTN 410
            +S S D  +K+W   + T   T  GHT  VN   +  +     S S D ++++W+  T+
Sbjct: 173 FLSSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAMVDRGRNFVSASSDGSLKLWECSTS 232

Query: 411 TCVRVFHGHVG 421
            CV   + + G
Sbjct: 233 ACVFTLNSNDG 243

>CAGL0A00605g complement(67281..69203) similar to sp|P53197
           Saccharomyces cerevisiae YGL003c CDH1 substrate-specific
           activator of APC-dependent proteolysis, hypothetical
           start
          Length = 640

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 68/148 (45%), Gaps = 9/148 (6%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNY-VTGACVS 333
           G  +  V I+D+   K IR LSGH D V  L +++  L +GS D+TI   +  +      
Sbjct: 394 GQGNGIVEIYDVTKEKCIRTLSGHLDRVACLSWNNHILSSGSRDRTILHRDVRMADPFFE 453

Query: 334 TYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHPKS 390
               H+  +  L  ++    + SG  D  V V+   SRT + ++  H   V  +   P  
Sbjct: 454 KIETHEQEICGLKWNTNDNKLASGGNDNMVFVYDGTSRTPFLSINEHKAAVKAMAWSPHK 513

Query: 391 ---FTCFSGSDDMTIRMWDIRTNTCVRV 415
                   G+ D T++MW++  NT V++
Sbjct: 514 QGILATGGGTADRTLKMWNV--NTSVKL 539

 Score = 37.4 bits (85), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 65/143 (45%), Gaps = 9/143 (6%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK---LITG--SLDKTIRVWNYVT 328
           +G  D+ V ++D  +      ++ H   VKA+ +   K   L TG  + D+T+++WN  T
Sbjct: 476 SGGNDNMVFVYDGTSRTPFLSINEHKAAVKAMAWSPHKQGILATGGGTADRTLKMWNVNT 535

Query: 329 GACVSTY-RGHQ--DSVLSVDSFRKLIVSGSADKTVKVWHVES-RTCYTLRGHTGWVNCV 384
              ++    G Q  + V S ++   +   G +   + +W   +      L+GH+  V  +
Sbjct: 536 SVKLNDVDTGSQVCNMVWSTNTDEIVTSHGYSKYNLTIWEASNLEPLAILKGHSFRVLHL 595

Query: 385 KLHPKSFTCFSGSDDMTIRMWDI 407
            L     T  SG+ D T+R W +
Sbjct: 596 TLSADGTTIVSGAGDETLRYWKL 618

 Score = 33.1 bits (74), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 41/89 (46%), Gaps = 3/89 (3%)

Query: 470 THLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTG 529
           +HL     +  +++++V    CIRT  GH++ V  ++ +N  + SGS DR+    D++  
Sbjct: 389 SHLAIGQGNGIVEIYDVTKEKCIRTLSGHLDRVACLSWNNHILSSGSRDRTILHRDVRMA 448

Query: 530 KCMHTFVGIHAPVACV---GIGDSEFVSG 555
                 +  H    C       D++  SG
Sbjct: 449 DPFFEKIETHEQEICGLKWNTNDNKLASG 477

>Scas_680.11
          Length = 347

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFR--IVSGSHDRSCKVWDLQTG 529
           L SCS DN   +W    G  + T  GH   +W I  D F    V+GS D S K+W ++TG
Sbjct: 25  LFSCSKDNFASVWYSVNGERLGTLNGHAGTIWSIDVDKFTEYCVTGSADYSIKMWKVETG 84

Query: 530 KCMHT 534
           + +++
Sbjct: 85  ENVYS 89

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 4/78 (5%)

Query: 295 LSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGACVSTYRGHQDSV--LSVDSFRK 350
           L GH   +  ++++ +   L + S D    VW  V G  + T  GH  ++  + VD F +
Sbjct: 6   LMGHERPLTQVKYNREGDLLFSCSKDNFASVWYSVNGERLGTLNGHAGTIWSIDVDKFTE 65

Query: 351 LIVSGSADKTVKVWHVES 368
             V+GSAD ++K+W VE+
Sbjct: 66  YCVTGSADYSIKMWKVET 83

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 38/80 (47%), Gaps = 3/80 (3%)

Query: 337 GHQDSVLSVDSFRK--LIVSGSADKTVKVWH-VESRTCYTLRGHTGWVNCVKLHPKSFTC 393
           GH+  +  V   R+  L+ S S D    VW+ V      TL GH G +  + +   +  C
Sbjct: 8   GHERPLTQVKYNREGDLLFSCSKDNFASVWYSVNGERLGTLNGHAGTIWSIDVDKFTEYC 67

Query: 394 FSGSDDMTIRMWDIRTNTCV 413
            +GS D +I+MW + T   V
Sbjct: 68  VTGSADYSIKMWKVETGENV 87

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query: 276 SYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDD--QKLITGSLDKTIRVWNYVTGACVS 333
           S D+  ++W    G+ +  L+GH   + ++  D   +  +TGS D +I++W   TG  V 
Sbjct: 29  SKDNFASVWYSVNGERLGTLNGHAGTIWSIDVDKFTEYCVTGSADYSIKMWKVETGENVY 88

Query: 334 TY 335
           ++
Sbjct: 89  SW 90

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 20/31 (64%)

Query: 374 LRGHTGWVNCVKLHPKSFTCFSGSDDMTIRM 404
           ++GH G +NCV + P+  +  SG +D  +R+
Sbjct: 289 VKGHFGPLNCVAVSPQGTSYVSGGEDGLVRL 319

>CAGL0M09845g 975007..977817 highly similar to sp|Q06078
           Saccharomyces cerevisiae YLR409c, start by similarity
          Length = 936

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 36/57 (63%), Gaps = 2/57 (3%)

Query: 278 DSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGACV 332
           D ++ + D  T K++R+L GH + + A  F  D + L++ SLD TIR W+  TG+C+
Sbjct: 562 DLSIVVVDTVTQKVVRQLWGHGNRITAFDFSPDGRWLVSASLDSTIRTWDLPTGSCI 618

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 72/183 (39%), Gaps = 41/183 (22%)

Query: 313 ITGSLDKTIRVWNYVTGACVSTYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWHV-ESR 369
             GS +  I V+N  +G     YR H+ +V  ++VD   + +VS   D  +  +   ES+
Sbjct: 474 FVGSSNGGIGVYNMQSGMLRKKYRLHKRAVTGVAVDGMNRKMVSCGLDGIIGFYDFNESK 533

Query: 370 TCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPL 429
               L+      + V  H  S  C    DD++I + D  T   VR   GH  ++      
Sbjct: 534 YLGKLQMDAPITSMV-YHRSSDLCAFALDDLSIVVVDTVTQKVVRQLWGHGNRITA---- 588

Query: 430 TLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTG 489
                                           FD S P    L+S SLD+TI+ W++ TG
Sbjct: 589 --------------------------------FDFS-PDGRWLVSASLDSTIRTWDLPTG 615

Query: 490 ACI 492
           +CI
Sbjct: 616 SCI 618

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 62/150 (41%), Gaps = 18/150 (12%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFD--DQKLITGSLDKTIRVWNYVTG--- 329
           GS +  + ++++ +G L ++   H   V  +  D  ++K+++  LD  I  +++      
Sbjct: 476 GSSNGGIGVYNMQSGMLRKKYRLHKRAVTGVAVDGMNRKMVSCGLDGIIGFYDFNESKYL 535

Query: 330 ------ACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNC 383
                 A +++   H+ S L   +   L +       V V  V  +    L GH   +  
Sbjct: 536 GKLQMDAPITSMVYHRSSDLCAFALDDLSI-------VVVDTVTQKVVRQLWGHGNRITA 588

Query: 384 VKLHPKSFTCFSGSDDMTIRMWDIRTNTCV 413
               P      S S D TIR WD+ T +C+
Sbjct: 589 FDFSPDGRWLVSASLDSTIRTWDLPTGSCI 618

 Score = 32.7 bits (73), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 3/66 (4%)

Query: 470 THLLSCSLDN-TIKLWNVKTGACIRTQFGHVEGV--WDIAADNFRIVSGSHDRSCKVWDL 526
           + L + +LD+ +I + +  T   +R  +GH   +  +D + D   +VS S D + + WDL
Sbjct: 553 SDLCAFALDDLSIVVVDTVTQKVVRQLWGHGNRITAFDFSPDGRWLVSASLDSTIRTWDL 612

Query: 527 QTGKCM 532
            TG C+
Sbjct: 613 PTGSCI 618

>ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH]
           complement(529784..531187) [1404 bp, 467 aa]
          Length = 467

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 64/144 (44%), Gaps = 11/144 (7%)

Query: 290 KLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLS--V 345
           K +  L GH + V + R+  D + +++ S D  + +W+  TG   +    H   VLS  +
Sbjct: 118 KPVTTLKGHNNKVSSFRWSSDSRTILSASQDGFMLLWDAATGLKSNAIPLHSQWVLSCAI 177

Query: 346 DSFRKLIVSGSADKTVKVWHV------ESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDD 399
                L+ S   D    ++ V      +       +GHT +++ ++    + +  + S D
Sbjct: 178 CPNGNLVASAGLDNNCTIYRVSRKDRIQQNIVSIFKGHTCYISEIEFLDDN-SILTASGD 236

Query: 400 MTIRMWDIRTNTCVRVFHGHVGQV 423
           MT  +WDI  +  +  F  H+G V
Sbjct: 237 MTCALWDITKSKRINEFADHLGDV 260

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 29/46 (63%), Gaps = 2/46 (4%)

Query: 282 AIWDLATGKLIRRLSGHTDGVK--ALRFDDQKLITGSLDKTIRVWN 325
           A+WDL  G++I +L GH+D +   A   D   + TGS D T++VW+
Sbjct: 418 AVWDLVKGEIIGKLDGHSDRISGVATSPDGLAICTGSWDMTMKVWS 463

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 54/259 (20%), Positives = 97/259 (37%), Gaps = 27/259 (10%)

Query: 290 KLIRRLSGHTDGVKALRF-DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSF 348
            ++    GHT  +  + F DD  ++T S D T  +W+      ++ +  H   VLS+ + 
Sbjct: 207 NIVSIFKGHTCYISEIEFLDDNSILTASGDMTCALWDITKSKRINEFADHLGDVLSLSAA 266

Query: 349 R-------KLIVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHPKSFTCFSGSDDM 400
                    +  SG +D  + +W     T   +       V+ VK      T  +GSDD 
Sbjct: 267 PTETEGNGNVFASGGSDGYLYIWDKRVPTSVQSFFVSDSDVSKVKFFRNGNTIATGSDDG 326

Query: 401 TIRMWDIRTN------TCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXX 454
              ++D+R++      +  R  HG     Q+     + S++                   
Sbjct: 327 CTNLYDLRSDCRIANYSLSRSIHGATPVQQQTY---IMSNMDYTAPSGTLARASPYSPAI 383

Query: 455 XSVQAANFDH------SLPYPTHLLSCSL-DNTIKLWNVKTGACIRTQFGHVEGVWDIAA 507
            +V ++  D+             LL  S  +    +W++  G  I    GH + +  +A 
Sbjct: 384 GTVSSSFIDNQGVISMDFSRSGRLLYVSYTEFGCAVWDLVKGEIIGKLDGHSDRISGVAT 443

Query: 508 --DNFRIVSGSHDRSCKVW 524
             D   I +GS D + KVW
Sbjct: 444 SPDGLAICTGSWDMTMKVW 462

 Score = 34.3 bits (77), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 42/191 (21%), Positives = 72/191 (37%), Gaps = 16/191 (8%)

Query: 252 IQEFKGHMDGVXXX--XXXXXXXXTGSYDSTVAIWDLATGKLIRRLSGHTDGVK--ALRF 307
           +   KGH + V             + S D  + +WD ATG     +  H+  V   A+  
Sbjct: 120 VTTLKGHNNKVSSFRWSSDSRTILSASQDGFMLLWDAATGLKSNAIPLHSQWVLSCAICP 179

Query: 308 DDQKLITGSLDKTIRVW-----NYVTGACVSTYRGHQDSVLSVDSF-RKLIVSGSADKTV 361
           +   + +  LD    ++     + +    VS ++GH   +  ++      I++ S D T 
Sbjct: 180 NGNLVASAGLDNNCTIYRVSRKDRIQQNIVSIFKGHTCYISEIEFLDDNSILTASGDMTC 239

Query: 362 KVWHV-ESRTCYTLRGHTGWVNCVKLHP-----KSFTCFSGSDDMTIRMWDIRTNTCVRV 415
            +W + +S+       H G V  +   P           SG  D  + +WD R  T V+ 
Sbjct: 240 ALWDITKSKRINEFADHLGDVLSLSAAPTETEGNGNVFASGGSDGYLYIWDKRVPTSVQS 299

Query: 416 FHGHVGQVQKV 426
           F      V KV
Sbjct: 300 FFVSDSDVSKV 310

 Score = 29.6 bits (65), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 58/143 (40%), Gaps = 12/143 (8%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTI--------RVWN 325
           TGS D    ++DL +   I   S       A     Q  I  ++D T           ++
Sbjct: 321 TGSDDGCTNLYDLRSDCRIANYSLSRSIHGATPVQQQTYIMSNMDYTAPSGTLARASPYS 380

Query: 326 YVTGACVSTYRGHQDSVLSVDSFR--KLIVSGSADKTVKVWH-VESRTCYTLRGHTGWVN 382
              G   S++  +Q  V+S+D  R  +L+     +    VW  V+      L GH+  ++
Sbjct: 381 PAIGTVSSSFIDNQ-GVISMDFSRSGRLLYVSYTEFGCAVWDLVKGEIIGKLDGHSDRIS 439

Query: 383 CVKLHPKSFTCFSGSDDMTIRMW 405
            V   P      +GS DMT+++W
Sbjct: 440 GVATSPDGLAICTGSWDMTMKVW 462

>Kwal_27.10385
          Length = 536

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 56/118 (47%), Gaps = 16/118 (13%)

Query: 308 DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSV--DSFRKLIVSGSADKTVKVWH 365
           DD  ++TGS+D ++R++    G CV+    H   V  V  D   + I S SAD++V V+ 
Sbjct: 147 DDNYIVTGSMDNSLRIFEVEEGTCVANAADHNHYVQGVVWDPQNEFIFSQSADRSVHVYR 206

Query: 366 VESRTCYTLRGHTGWVNCVKLHPK----SFTCFSGSDDMTIRMWDIRTNTCVRVFHGH 419
           +E       +  +G ++ +KL  K       C    D   + + ++++   V +FH  
Sbjct: 207 IE-------KTPSGSISGLKLTNKITRGDLPCRKSKDSTELELDNVKS---VFLFHNE 254

 Score = 36.2 bits (82), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 37/65 (56%), Gaps = 6/65 (9%)

Query: 467 PYPTHLLSCSLDNTIKLWNVKTGACIRTQFGH---VEG-VWDIAADNFRIVSGSHDRSCK 522
           P   ++++ S+DN+++++ V+ G C+     H   V+G VWD    N  I S S DRS  
Sbjct: 146 PDDNYIVTGSMDNSLRIFEVEEGTCVANAADHNHYVQGVVWD--PQNEFIFSQSADRSVH 203

Query: 523 VWDLQ 527
           V+ ++
Sbjct: 204 VYRIE 208

>Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement
          Length = 426

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 59/130 (45%), Gaps = 9/130 (6%)

Query: 290 KLIRRLSGHTDGVKALRF-DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVD-- 346
           K++    GHT  V  L F +++ ++T S D T  +W+      VS Y  H   VL++   
Sbjct: 168 KIVSIFKGHTCYVSDLEFINNESILTASGDMTCALWDIPKSKRVSEYSDHLGDVLTLSVP 227

Query: 347 -----SFRKLIVSGSADKTVKVWHVES-RTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDM 400
                S+  +  SG +D  V +W   S  +          ++ V+      +  +GSDD 
Sbjct: 228 PAGTTSYDSMFASGGSDGYVYLWDTRSPSSVQNFFVSDSDISTVRFFSDGNSIITGSDDG 287

Query: 401 TIRMWDIRTN 410
             R++D+R++
Sbjct: 288 IARLFDLRSD 297

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/246 (21%), Positives = 102/246 (41%), Gaps = 45/246 (18%)

Query: 295 LSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLS--VDSFRK 350
           L GH + +   R+  D + +++ S D  + +W+ ++G   +        VL+  +   R 
Sbjct: 84  LKGHNNKISDFRWSRDSKSILSASQDGFMLIWDPMSGLKKNAIPLDSQWVLACAISPSRN 143

Query: 351 LIVSGSADKTVKVWHV--ESRT----CYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRM 404
           L+ SG       ++ +  E+RT        +GHT +V+ ++      +  + S DMT  +
Sbjct: 144 LVASGGLSNNCTIYRISQENRTQQKIVSIFKGHTCYVSDLEFINNE-SILTASGDMTCAL 202

Query: 405 WDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDH 464
           WDI  +  V  +  H+G V     LTL                        SV  A    
Sbjct: 203 WDIPKSKRVSEYSDHLGDV-----LTL------------------------SVPPAG--- 230

Query: 465 SLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA--ADNFRIVSGSHDRSCK 522
           +  Y +   S   D  + LW+ ++ + ++  F     +  +   +D   I++GS D   +
Sbjct: 231 TTSYDSMFASGGSDGYVYLWDTRSPSSVQNFFVSDSDISTVRFFSDGNSIITGSDDGIAR 290

Query: 523 VWDLQT 528
           ++DL++
Sbjct: 291 LFDLRS 296

 Score = 33.9 bits (76), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 283 IWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVW 324
           +WD   G+++ RL GH+  +  +R   D   + TGS D T+++W
Sbjct: 378 VWDTLRGEIVGRLEGHSSRISGVRTSPDGMCVCTGSWDSTMKLW 421

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 52/141 (36%), Gaps = 21/141 (14%)

Query: 249 IYRIQE-----------FKGHMDGVXXXX-XXXXXXXTGSYDSTVAIWDLATGKLIRRLS 296
           IYRI +           FKGH   V            T S D T A+WD+   K +   S
Sbjct: 156 IYRISQENRTQQKIVSIFKGHTCYVSDLEFINNESILTASGDMTCALWDIPKSKRVSEYS 215

Query: 297 GHTDGVKALRFD-------DQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFR 349
            H   V  L          D    +G  D  + +W+  + + V  +      + +V  F 
Sbjct: 216 DHLGDVLTLSVPPAGTTSYDSMFASGGSDGYVYLWDTRSPSSVQNFFVSDSDISTVRFFS 275

Query: 350 --KLIVSGSADKTVKVWHVES 368
               I++GS D   +++ + S
Sbjct: 276 DGNSIITGSDDGIARLFDLRS 296

>Sklu_1659.2 YMR092C, Contig c1659 410-2251
          Length = 613

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 49/90 (54%), Gaps = 4/90 (4%)

Query: 276 SYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTY 335
           S D T+ I+ +    L+RR+ GH  G+ AL  +   L++GS D  +  W       +  Y
Sbjct: 315 SLDGTLNIFKIGEDSLVRRIEGHNKGITALVVN--PLVSGSYDGRVVQWINENEPHMENY 372

Query: 336 RGHQDSVLSVDSFRKLIVSGSADKTVKVWH 365
            G+   ++S+D+  K++ + S D T+KV++
Sbjct: 373 HGNM--IVSIDNTDKIVSTVSWDDTLKVFN 400

 Score = 33.5 bits (75), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 45/102 (44%), Gaps = 10/102 (9%)

Query: 274 TGSYDSTVAIWDLATGK------LIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYV 327
           T S D T+ +WD+ + K      L   LS    GV   +  D +++  SLD T+ ++   
Sbjct: 269 TSSADCTLKLWDVESSKCLQSWSLENTLSNQQVGVAVTK--DHEIVALSLDGTLNIFKIG 326

Query: 328 TGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESR 369
             + V    GH   + ++      +VSGS D  V  W  E+ 
Sbjct: 327 EDSLVRRIEGHNKGITAL--VVNPLVSGSYDGRVVQWINENE 366

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 40/91 (43%), Gaps = 13/91 (14%)

Query: 352 IVSGSADKTVKVWHVESRTCY-------TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRM 404
            V+ SAD T+K+W VES  C        TL      V   K H       + S D T+ +
Sbjct: 267 FVTSSADCTLKLWDVESSKCLQSWSLENTLSNQQVGVAVTKDHE----IVALSLDGTLNI 322

Query: 405 WDIRTNTCVRVFHGHVGQVQKVI--PLTLGS 433
           + I  ++ VR   GH   +  ++  PL  GS
Sbjct: 323 FKIGEDSLVRRIEGHNKGITALVVNPLVSGS 353

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 34/53 (64%), Gaps = 2/53 (3%)

Query: 274 TGSYDSTVAIWDLATG-KLIRRLSGHTDGVKALRFDDQK-LITGSLDKTIRVW 324
           TGS D+ + I+ +    K+I++L+ H DGV  +++ +++ +++  +D  I+ W
Sbjct: 556 TGSLDTHMFIYSVKRPMKIIKKLNAHKDGVSVVKWKNKETIVSAGVDACIKEW 608

>Sklu_2332.7 YER107C, Contig c2332 14211-15314 reverse complement
          Length = 367

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 55/96 (57%), Gaps = 8/96 (8%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF------DDQKLITGSLDKTIRVWNYV 327
           +G  D+ V ++D+ +G+  +++  H   ++ LRF      + + L+TGS DKTI+ W+  
Sbjct: 96  SGGCDNVVKLFDVQSGQA-QQVGAHDSAIRHLRFIQCGPTNTECLVTGSWDKTIKYWDMR 154

Query: 328 TGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKV 363
               VST     D V ++DS +KL+V  +A++ + +
Sbjct: 155 QPQPVSTLM-MPDRVYAMDSKQKLLVVATAERHIAI 189

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 62/144 (43%), Gaps = 13/144 (9%)

Query: 276 SYDSTVAIW-DLATGKLIRRLSGHTDGVKALRFDDQK---LITGSLDKTIRVWNYVTGAC 331
           S  +TVA   DLA   +I   +   D +  + F  Q+       S D  +R+W+   G  
Sbjct: 13  STSTTVATEKDLANDIVINNPA--EDSISDIAFSSQQDFLFSVSSWDNKVRIWDVNGGMA 70

Query: 332 VSTYR-GHQDSVLSV--DSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKL-- 386
               +  HQ  VL+    +    + SG  D  VK++ V+S     +  H   +  ++   
Sbjct: 71  QGRAQYEHQAPVLTTRWSNDGTKVASGGCDNVVKLFDVQSGQAQQVGAHDSAIRHLRFIQ 130

Query: 387 -HPKSFTCF-SGSDDMTIRMWDIR 408
             P +  C  +GS D TI+ WD+R
Sbjct: 131 CGPTNTECLVTGSWDKTIKYWDMR 154

>YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-binding
           protein, inhibits ARP2/3-stimulated actin nucleation,
           contains WD (WD-40) repeats [1956 bp, 651 aa]
          Length = 651

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 67/168 (39%), Gaps = 36/168 (21%)

Query: 374 LRGHTGWVNCVKLHP-KSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHV---GQVQKVIPL 429
            RGHT  V      P       SGSDD  I +WDI  N     FH HV   G+   + P+
Sbjct: 77  FRGHTAQVLDTDFDPFNDHRIASGSDDSKIGIWDIPENYK---FHDHVDEDGEPIDIKPV 133

Query: 430 TLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTH---LLSCSLDNTIKLWNV 486
                                     +  A    H L +P     L S S D T+KLWNV
Sbjct: 134 KF-----------------------LTGHARKVGHVLYHPVAENVLASSSGDYTVKLWNV 170

Query: 487 KTGACIRTQFGHVEGVWDI--AADNFRIVSGSHDRSCKVWDLQTGKCM 532
           +TG  + T   H + V  +  + D   + + + D+  +VW+++  K +
Sbjct: 171 ETGKDMIT-LKHPDMVTSMSFSYDGNYLATVARDKKLRVWNIREEKIV 217

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 73/164 (44%), Gaps = 36/164 (21%)

Query: 274 TGSYDSTVAIWDLATG----------------KLIRRLSGHTDGVKALRFD---DQKLIT 314
           +GS DS + IWD+                   K ++ L+GH   V  + +    +  L +
Sbjct: 99  SGSDDSKIGIWDIPENYKFHDHVDEDGEPIDIKPVKFLTGHARKVGHVLYHPVAENVLAS 158

Query: 315 GSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFR---KLIVSGSADKTVKVWHV-ESRT 370
            S D T+++WN  TG  + T + H D V S+ SF      + + + DK ++VW++ E + 
Sbjct: 159 SSGDYTVKLWNVETGKDMITLK-HPDMVTSM-SFSYDGNYLATVARDKKLRVWNIREEKI 216

Query: 371 CYTLRGHTG-------WV-NCVKLHPKSFTCFSGSDDMTIRMWD 406
                 HTG       W+ N  +L   + T FS   D  I +WD
Sbjct: 217 VSEGPAHTGAKNQRVVWLGNSDRL---ATTGFSKLSDRQIGIWD 257

>KLLA0B12804g 1117475..1120033 weakly similar to sp|Q03177
           Saccharomyces cerevisiae YMR102c, hypothetical start
          Length = 852

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 38/76 (50%), Gaps = 2/76 (2%)

Query: 334 TYRGHQDSVLSVD-SFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFT 392
           T+  H D +L +D S    I++GS DK+ K+WH    T      H+ +V  V+ HP+   
Sbjct: 258 TFHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRFHPEDDR 317

Query: 393 CF-SGSDDMTIRMWDI 407
            F S   D   R+W I
Sbjct: 318 FFLSACLDQKCRLWSI 333

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 4/65 (6%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF---DDQKLITGSLDKTIRVWNYVTGA 330
           TGS D +  +W  A    ++    H+D V A+RF   DD+  ++  LD+  R+W+ +   
Sbjct: 279 TGSMDKSCKLWHCARPTSLKTFV-HSDFVTAVRFHPEDDRFFLSACLDQKCRLWSILEKQ 337

Query: 331 CVSTY 335
            +  Y
Sbjct: 338 VIFEY 342

 Score = 30.4 bits (67), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query: 498 HVEGVWDIA-ADNFRIVSGSHDRSCKVWDLQTGKCMHTFV 536
           H + + DI  + N  I++GS D+SCK+W       + TFV
Sbjct: 262 HTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTFV 301

>YER107C (GLE2) [1539] chr5 complement(373444..374541) Nuclear pore
           protein required for poly(A)+ RNA export, has WD (WD-40)
           repeats, functions in the nuclear export of the small
           ribosomal subunit [1098 bp, 365 aa]
          Length = 365

 Score = 45.1 bits (105), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 60/103 (58%), Gaps = 8/103 (7%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF------DDQKLITGSLDKTIRVWNYV 327
           +G  D+ + ++D+A+G+  +++  H+  +K LRF      + + ++TGS DKTI+ W+  
Sbjct: 97  SGGCDNALKLYDIASGQ-TQQIGMHSAPIKVLRFVQCGPSNTECIVTGSWDKTIKYWDMR 155

Query: 328 TGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRT 370
               VST     + V S+D+ + L+V  +A++ + + ++ + T
Sbjct: 156 QPQPVSTVM-MPERVYSMDNKQSLLVVATAERHIAIINLANPT 197

 Score = 34.3 bits (77), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 56/136 (41%), Gaps = 16/136 (11%)

Query: 285 DLATGKLIRRLSGHTDGVKALRFDDQK---LITGSLDKTIRVWNYVTGACVSTYRGHQDS 341
           DLA   +I   S   D +  + F  Q+       S D  +R+W+   G  V   R   +S
Sbjct: 24  DLANDIVIN--SPAEDSISDIAFSPQQDFMFSASSWDGKVRIWDVQNG--VPQGRAQHES 79

Query: 342 VLSVDSFR-----KLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKL---HPKSFTC 393
              V   R       + SG  D  +K++ + S     +  H+  +  ++     P +  C
Sbjct: 80  SSPVLCTRWSNDGTKVASGGCDNALKLYDIASGQTQQIGMHSAPIKVLRFVQCGPSNTEC 139

Query: 394 F-SGSDDMTIRMWDIR 408
             +GS D TI+ WD+R
Sbjct: 140 IVTGSWDKTIKYWDMR 155

>AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH]
           complement(850726..850730,850789..852685) [1902 bp, 633
           aa]
          Length = 633

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 59/141 (41%), Gaps = 20/141 (14%)

Query: 307 FDDQKLITGSLDKTIRVW----------------NYVTGACVSTYRGHQDSVLSV---DS 347
           FD++ L++GS D  I VW                N    A V    GHQ  V  V    +
Sbjct: 92  FDERMLVSGSDDGRIGVWEIPATYSFHNAQDEDGNVEHVAPVKFLTGHQRKVGHVLYHPT 151

Query: 348 FRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDI 407
            + ++ S S D TV++W+VE  T   +  H   V  +          +   D  +R+WDI
Sbjct: 152 AQGVLASSSLDHTVRLWNVEQGTNPIVLTHPDMVTSMSFSYGGTYLATVCRDKMLRVWDI 211

Query: 408 RTNTCVRVFHGHVG-QVQKVI 427
           R    V    GH G + Q+V+
Sbjct: 212 RKGEVVSEGMGHSGPKNQRVV 232

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 64/174 (36%), Gaps = 30/174 (17%)

Query: 374 LRGHTGWVNCVKLHP-KSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLG 432
            RGHT  V      P       SGSDD  I +W+I             G V+ V P+   
Sbjct: 77  FRGHTAQVLDTDFDPFDERMLVSGSDDGRIGVWEIPATYSFHNAQDEDGNVEHVAPVKF- 135

Query: 433 SDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTH---LLSCSLDNTIKLWNVKTG 489
                                  +       H L +PT    L S SLD+T++LWNV+ G
Sbjct: 136 ----------------------LTGHQRKVGHVLYHPTAQGVLASSSLDHTVRLWNVEQG 173

Query: 490 --ACIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAP 541
               + T    V  +   +     + +   D+  +VWD++ G+ +   +G   P
Sbjct: 174 TNPIVLTHPDMVTSM-SFSYGGTYLATVCRDKMLRVWDIRKGEVVSEGMGHSGP 226

 Score = 29.3 bits (64), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 46/112 (41%), Gaps = 16/112 (14%)

Query: 278 DSTVAIWDLATGKLIRRLSGHTDGVKALRF----DDQKLITGSL----DKTIRVW---NY 326
           D  + +WD+  G+++    GH+ G K  R     +  +L T       D+ I VW   N 
Sbjct: 203 DKMLRVWDIRKGEVVSEGMGHS-GPKNQRVVWLGNSDRLATTGFSKLSDRQIAVWDAFNL 261

Query: 327 VTGACVSTYRGHQDSVLSV----DSFRKLIVSGSADKTVKVWHVESRTCYTL 374
             G     Y   Q S + +    DS + L V+G  D  ++ +  +    Y L
Sbjct: 262 EKGQLGGFYNVDQSSGILMPFYDDSNKILYVAGKGDGNIRYYEFQDDELYEL 313

>CAGL0A00561g complement(63710..64948) similar to sp|P53196
           Saccharomyces cerevisiae YGL004c, hypothetical start
          Length = 412

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/190 (22%), Positives = 75/190 (39%), Gaps = 40/190 (21%)

Query: 342 VLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRG-HTGWVNCVKLHPKSFTCFSGSDDM 400
           ++S D+    IV G +   + V+  E  +  +L G H   V  VK+ P +    SGS DM
Sbjct: 104 LISCDASTDKIVIGDSGGDINVYDHEWMSKLSLVGAHVSDVTTVKIFPSNAVLLSGSTDM 163

Query: 401 TIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAA 460
            +++W +   +  R   GH   +   I +  G                            
Sbjct: 164 QLKVWSLEDGSNPRTLKGHSAGITDTIIIERGR--------------------------- 196

Query: 461 NFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWD-IAADNFRIVSGSHDR 519
                     ++LS SLD +++LW + +G  I ++F   E   D + + +  +   S   
Sbjct: 197 ----------NVLSSSLDGSVRLWELGSGKTI-SKFCRKENTTDGVTSMSLLVGEESTSM 245

Query: 520 SCKVWDLQTG 529
           S +V D +TG
Sbjct: 246 SAQVTDRETG 255

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 39/72 (54%), Gaps = 2/72 (2%)

Query: 466 LPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWD--IAADNFRIVSGSHDRSCKV 523
            P    LLS S D  +K+W+++ G+  RT  GH  G+ D  I      ++S S D S ++
Sbjct: 150 FPSNAVLLSGSTDMQLKVWSLEDGSNPRTLKGHSAGITDTIIIERGRNVLSSSLDGSVRL 209

Query: 524 WDLQTGKCMHTF 535
           W+L +GK +  F
Sbjct: 210 WELGSGKTISKF 221

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 53/109 (48%), Gaps = 3/109 (2%)

Query: 311 KLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSF--RKLIVSGSADKTVKVWHVES 368
           K++ G     I V+++   + +S    H   V +V  F    +++SGS D  +KVW +E 
Sbjct: 113 KIVIGDSGGDINVYDHEWMSKLSLVGAHVSDVTTVKIFPSNAVLLSGSTDMQLKVWSLED 172

Query: 369 RTC-YTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVF 416
            +   TL+GH+  +    +  +     S S D ++R+W++ +   +  F
Sbjct: 173 GSNPRTLKGHSAGITDTIIIERGRNVLSSSLDGSVRLWELGSGKTISKF 221

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 67/167 (40%), Gaps = 32/167 (19%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDD--QKLITGSLDKTIRVWNYVTGAC 331
           +GS D  + +W L  G   R L GH+ G+      +  + +++ SLD ++R+W   +G  
Sbjct: 158 SGSTDMQLKVWSLEDGSNPRTLKGHSAGITDTIIIERGRNVLSSSLDGSVRLWELGSGKT 217

Query: 332 VSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVES--RTCYTLRGHTGWV----NCVK 385
           +S +   +++   V S   L+   S   + +V   E+  R  +   G   +       + 
Sbjct: 218 ISKFCRKENTTDGVTSMSLLVGEESTSMSAQVTDRETGDRLEFGTEGKQVFAGHLSGTIT 277

Query: 386 LH-----------PKSFTC-------------FSGSDDMTIRMWDIR 408
           +H           P SF                SG +D T+  WDIR
Sbjct: 278 VHDLFNKQQILQIPSSFVAPCNTIAQISEHAIVSGYEDGTVATWDIR 324

>Scas_660.8
          Length = 510

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 96/238 (40%), Gaps = 55/238 (23%)

Query: 321 IRVWNYVTGACVSTYRGHQDSVLSVDSFR---KLIVSGSADKTVKVW-HVESRTCY-TLR 375
           +++++  T   + T+   +D V S  SFR   KL+V+G A   V V+     RT   ++ 
Sbjct: 63  VQIFSSRTRQVIKTFSRFKDVVYSA-SFRSDGKLLVAGDATGLVSVYDSYNPRTILLSIN 121

Query: 376 GHTGWVNCVKLHPK-SFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSD 434
             T   +  K HP+ + T  + SDD  IR+WDI                Q  + LT  +D
Sbjct: 122 ASTHPTHVTKFHPQDNKTLITASDDRVIRLWDIS------------NAYQPQLELTGSTD 169

Query: 435 LIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLL-SCSLDNTIKLWNVK-TGACI 492
            +                             +P   H++ S S D  I+L++ + +G+  
Sbjct: 170 YVRSVT------------------------CVPSAPHMIVSGSYDGIIRLYDTRASGSSP 205

Query: 493 RTQFGHVEGVWDIAADNFRIVSGSHDRSC-----KVWDLQTGKCMHTFVGIHAPVACV 545
                H + + DI +     +S +   SC     KVWDL + K ++     +  V C+
Sbjct: 206 IYSLLHDQPIEDIIS-----ISATQIVSCGGSNFKVWDLTSNKKLYERGNFNKTVTCL 258

 Score = 34.3 bits (77), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 50/110 (45%), Gaps = 10/110 (9%)

Query: 308 DDQKLITGSLDKTIRVWN----YVTGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKV 363
           D++ LIT S D+ IR+W+    Y     ++    +  SV  V S   +IVSGS D  +++
Sbjct: 136 DNKTLITASDDRVIRLWDISNAYQPQLELTGSTDYVRSVTCVPSAPHMIVSGSYDGIIRL 195

Query: 364 WHVE---SRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTN 410
           +      S   Y+L       + + +         GS+    ++WD+ +N
Sbjct: 196 YDTRASGSSPIYSLLHDQPIEDIISISATQIVSCGGSN---FKVWDLTSN 242

>Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement
          Length = 555

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 63/147 (42%), Gaps = 7/147 (4%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNY-VTGACVS 333
           G  +  V I+D+   K IR LSGH D V  L +++  L +GS D+ I   +  +      
Sbjct: 309 GQGNGLVEIYDIVKRKCIRTLSGHMDRVACLSWNNHILTSGSRDRKILHRDVRMPEPYFE 368

Query: 334 TYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWHVESR-TCYTLRGHTGWVNCVKLHPKS 390
               H   V  L  ++    + SG  D  V V+   SR     L  HT  V  +   P  
Sbjct: 369 QVETHTQEVCGLKWNTDENRLASGGNDNVVYVYDGTSRKPTLKLAEHTAAVKAIAWSPHK 428

Query: 391 ---FTCFSGSDDMTIRMWDIRTNTCVR 414
                   G+ D  +++W++ T+T +R
Sbjct: 429 RGILATGGGTADKKMKIWNVNTSTKLR 455

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 66/143 (46%), Gaps = 9/143 (6%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK---LIT--GSLDKTIRVWNYVT 328
           +G  D+ V ++D  + K   +L+ HT  VKA+ +   K   L T  G+ DK +++WN  T
Sbjct: 391 SGGNDNVVYVYDGTSRKPTLKLAEHTAAVKAIAWSPHKRGILATGGGTADKKMKIWNVNT 450

Query: 329 GACVSTY-RGHQ--DSVLSVDSFRKLIVSGSADKTVKVWHVES-RTCYTLRGHTGWVNCV 384
              +     G Q  + + S ++   +   G +   + +W   S      L+GH+  V  +
Sbjct: 451 STKLRDIDTGSQVCNMIWSKNTNELVTSHGYSRYNLTLWDYPSMEPVAILKGHSFRVLHL 510

Query: 385 KLHPKSFTCFSGSDDMTIRMWDI 407
            L     T  SG+ D T+R W +
Sbjct: 511 TLSADGTTVVSGAGDETLRYWKL 533

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 36/75 (48%)

Query: 470 THLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTG 529
           +HL     +  ++++++    CIRT  GH++ V  ++ +N  + SGS DR     D++  
Sbjct: 304 SHLAVGQGNGLVEIYDIVKRKCIRTLSGHMDRVACLSWNNHILTSGSRDRKILHRDVRMP 363

Query: 530 KCMHTFVGIHAPVAC 544
           +     V  H    C
Sbjct: 364 EPYFEQVETHTQEVC 378

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 49/100 (49%), Gaps = 5/100 (5%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKAL-RFDDQKLIT--GSLDKTIRVWNYVTGAC 331
           G+ D  + IW++ T   +R +   +     +   +  +L+T  G     + +W+Y +   
Sbjct: 437 GTADKKMKIWNVNTSTKLRDIDTGSQVCNMIWSKNTNELVTSHGYSRYNLTLWDYPSMEP 496

Query: 332 VSTYRGHQDSVL--SVDSFRKLIVSGSADKTVKVWHVESR 369
           V+  +GH   VL  ++ +    +VSG+ D+T++ W +  R
Sbjct: 497 VAILKGHSFRVLHLTLSADGTTVVSGAGDETLRYWKLFDR 536

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 26/119 (21%), Positives = 48/119 (40%), Gaps = 6/119 (5%)

Query: 312 LITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTC 371
           L  G  +  + +++ V   C+ T  GH D V  +     ++ SGS D+  K+ H + R  
Sbjct: 306 LAVGQGNGLVEIYDIVKRKCIRTLSGHMDRVACLSWNNHILTSGSRDR--KILHRDVRMP 363

Query: 372 YT----LRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKV 426
                 +  HT  V  +K +       SG +D  + ++D  +         H   V+ +
Sbjct: 364 EPYFEQVETHTQEVCGLKWNTDENRLASGGNDNVVYVYDGTSRKPTLKLAEHTAAVKAI 422

>CAGL0J10340g complement(1008637..1009653) highly similar to
           sp|P53011 Saccharomyces cerevisiae YGL100w SEH1 nuclear
           pore protein, start by similarity
          Length = 338

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 76/163 (46%), Gaps = 26/163 (15%)

Query: 296 SGHTDGVKALRFD--DQKLITGSLDKTIRVWNYVTGA----CVSTYRGHQDSVLSVD--- 346
           +GH D V  + +D   + + T S D+ I+V+     A       ++R H  S++S+D   
Sbjct: 6   TGHEDIVHDVAYDFYGRTMATCSSDQHIKVFKLDKDATRWEVNDSWRAHDSSIVSLDWAS 65

Query: 347 -SFRKLIVSGSADKTVKVWHVE-----------SRTCYTLRGHTGWVNCVKLHPK--SFT 392
             + ++I S S DKT+K+W  +           +R C TL    G + CVK  P      
Sbjct: 66  PEYGRIIASASYDKTIKIWEEDPNQEECSGRRWTRLC-TLNDSKGSLYCVKFAPSHLGLR 124

Query: 393 CFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDL 435
             S  +D  +RM+D    + +R +     +V KV+P+   ++L
Sbjct: 125 IASIGNDGIMRMYDALDPSNLRSW-TMTAEV-KVLPVAPANNL 165

>Scas_719.30
          Length = 940

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 36/57 (63%), Gaps = 2/57 (3%)

Query: 278 DSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGACV 332
           D ++ + D  T +++R+  GH++ + AL F  D + +++ SLD TIR W+  TG C+
Sbjct: 565 DLSIVLIDAVTQRVVRQFWGHSNRITALDFSPDGRWIVSASLDSTIRTWDLPTGGCI 621

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 34/151 (22%), Positives = 66/151 (43%), Gaps = 20/151 (13%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFD--DQKLITGSLDKTIRVWNYVTGACV 332
           GS +  ++++++ +G L ++   H   V  +  D  ++K+++  LD  +  +++      
Sbjct: 479 GSSNGGISVFNMQSGILRKKYRLHKKTVTGIALDGMNRKMVSCGLDGIVGFYDF----NK 534

Query: 333 STYRGHQDSVLSVDS-FRKLIVSGSAD---------KTVKVWHVESRTCYTLRGHTGWVN 382
           ST+ G     L +D+   K++   S+D           V +  V  R      GH+  + 
Sbjct: 535 STFLGK----LQLDAPITKMVYHRSSDLFALILDDLSIVLIDAVTQRVVRQFWGHSNRIT 590

Query: 383 CVKLHPKSFTCFSGSDDMTIRMWDIRTNTCV 413
            +   P      S S D TIR WD+ T  C+
Sbjct: 591 ALDFSPDGRWIVSASLDSTIRTWDLPTGGCI 621

 Score = 37.7 bits (86), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 67/180 (37%), Gaps = 39/180 (21%)

Query: 315 GSLDKTIRVWNYVTGACVSTYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWHVESRTCY 372
           GS +  I V+N  +G     YR H+ +V  +++D   + +VS   D  V  +     T  
Sbjct: 479 GSSNGGISVFNMQSGILRKKYRLHKKTVTGIALDGMNRKMVSCGLDGIVGFYDFNKSTFL 538

Query: 373 TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLG 432
                   +  +  H  S       DD++I + D  T   VR F GH  +          
Sbjct: 539 GKLQLDAPITKMVYHRSSDLFALILDDLSIVLIDAVTQRVVRQFWGHSNR---------- 588

Query: 433 SDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACI 492
                                   + A +F    P    ++S SLD+TI+ W++ TG CI
Sbjct: 589 ------------------------ITALDFS---PDGRWIVSASLDSTIRTWDLPTGGCI 621

 Score = 33.9 bits (76), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 3/64 (4%)

Query: 472 LLSCSLDN-TIKLWNVKTGACIRTQFGHVEGV--WDIAADNFRIVSGSHDRSCKVWDLQT 528
           L +  LD+ +I L +  T   +R  +GH   +   D + D   IVS S D + + WDL T
Sbjct: 558 LFALILDDLSIVLIDAVTQRVVRQFWGHSNRITALDFSPDGRWIVSASLDSTIRTWDLPT 617

Query: 529 GKCM 532
           G C+
Sbjct: 618 GGCI 621

>KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1
           Kluyveromyces lactis heterotrimeric G protein beta
           subunit, start by similarity
          Length = 436

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 61/142 (42%), Gaps = 11/142 (7%)

Query: 292 IRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLS--VDS 347
           +R L GH + +  +++  D   +++ S D  I +W+  TG   S        VLS  +  
Sbjct: 79  VRTLKGHNNKISDVKWSQDSASVLSSSQDGFIIIWDPFTGLKKSAIPLLSQWVLSSAISP 138

Query: 348 FRKLIVSGSADKTVKVWHV------ESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMT 401
              L+ S   D    V+ V      +       +GHT +++  +   +  T  + S DMT
Sbjct: 139 SGNLVASAGLDNHCSVYRVSRDNRIQQNVISIFKGHTCYISATEFLDER-TILTASGDMT 197

Query: 402 IRMWDIRTNTCVRVFHGHVGQV 423
             MWDI  +  V  F  H+G V
Sbjct: 198 CAMWDIPKSKRVTEFIDHLGDV 219

 Score = 42.4 bits (98), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 30/136 (22%), Positives = 62/136 (45%), Gaps = 9/136 (6%)

Query: 290 KLIRRLSGHTDGVKALRF-DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVD-- 346
            +I    GHT  + A  F D++ ++T S D T  +W+      V+ +  H   VL++D  
Sbjct: 166 NVISIFKGHTCYISATEFLDERTILTASGDMTCAMWDIPKSKRVTEFIDHLGDVLTMDLP 225

Query: 347 -----SFRKLIVSGSADKTVKVWHV-ESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDM 400
                 +    ++G +D    +W V +  +  +       V+ +K      +  +GSDD 
Sbjct: 226 PANTGRYGHNFITGGSDGYAYLWDVRQPNSAQSFFISDSDVSAIKFFNNGESFMAGSDDG 285

Query: 401 TIRMWDIRTNTCVRVF 416
           + R++D+R++  +  +
Sbjct: 286 SARLFDLRSDCQISTY 301

 Score = 36.2 bits (82), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 278 DSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYV 327
           D   A+WD+  G++I ++ GH + + A++   D   +++ S D T++VW  V
Sbjct: 383 DYGCAVWDIIKGEMIGKVDGHRNRINAVKTSPDGMAVVSSSWDMTLKVWTPV 434

 Score = 33.1 bits (74), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 3/67 (4%)

Query: 342 VLSVD--SFRKLIVSGSADKTVKVWHV-ESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSD 398
           V+S+D  S  +L+ +  AD    VW + +      + GH   +N VK  P      S S 
Sbjct: 365 VISIDFSSSGRLMYACYADYGCAVWDIIKGEMIGKVDGHRNRINAVKTSPDGMAVVSSSW 424

Query: 399 DMTIRMW 405
           DMT+++W
Sbjct: 425 DMTLKVW 431

>Scas_571.4
          Length = 601

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 63/165 (38%), Gaps = 30/165 (18%)

Query: 374 LRGHTGWVNCVKLHP-KSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLG 432
            RGH G V      P   F   S SDD  I +W+I  N  +R +     +   + P  + 
Sbjct: 85  FRGHKGQVLDTDFDPFNDFKIASASDDGKIGIWNIPMNYSMRTYRDSENKPMDIRPSKI- 143

Query: 433 SDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYP---THLLSCSLDNTIKLWNVKTG 489
                                  S       H L +P     L S SLD T+K+WN+K G
Sbjct: 144 ----------------------LSGHTRKVGHVLFHPRIRNVLASSSLDFTVKIWNIKKG 181

Query: 490 ACIRTQFGHVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQTGKCM 532
             I T   H + V  +A   D   + + + ++   +WD+ + + +
Sbjct: 182 KVIGT-LQHSDMVTAMAFDPDGAYLATITRNKKLTIWDIASKQIV 225

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/141 (21%), Positives = 56/141 (39%), Gaps = 20/141 (14%)

Query: 307 FDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSV-------------------DS 347
           F+D K+ + S D  I +WN      + TYR  ++  + +                     
Sbjct: 100 FNDFKIASASDDGKIGIWNIPMNYSMRTYRDSENKPMDIRPSKILSGHTRKVGHVLFHPR 159

Query: 348 FRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDI 407
            R ++ S S D TVK+W+++         H+  V  +   P      + + +  + +WDI
Sbjct: 160 IRNVLASSSLDFTVKIWNIKKGKVIGTLQHSDMVTAMAFDPDGAYLATITRNKKLTIWDI 219

Query: 408 RTNTCVRVFHGHVG-QVQKVI 427
            +   V     H G + Q+V+
Sbjct: 220 ASKQIVSQTKSHQGPKNQRVV 240

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGAC 331
           + S D TV IW++  GK+I  L  H+D V A+ FD     L T + +K + +W+  +   
Sbjct: 166 SSSLDFTVKIWNIKKGKVIGTLQ-HSDMVTAMAFDPDGAYLATITRNKKLTIWDIASKQI 224

Query: 332 VSTYRGHQ 339
           VS  + HQ
Sbjct: 225 VSQTKSHQ 232

>Kwal_26.8628
          Length = 422

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/136 (21%), Positives = 60/136 (44%), Gaps = 9/136 (6%)

Query: 290 KLIRRLSGHTDGVKALRF-DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSV--- 345
           +++    GHT  V  + F ++  +IT S D T  +W+      ++ +  H   VL++   
Sbjct: 166 QIVSMFKGHTCYVSQVEFFENNSIITASGDMTCALWDIPKAKRIAEFSDHLGDVLALALP 225

Query: 346 ----DSFRKLIVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHPKSFTCFSGSDDM 400
                +   +  SG +D  V +W   +R    +       ++ +K     +   +G+DD 
Sbjct: 226 PPHAQTSSPIFASGGSDGYVYIWDTRARAAAQSFFVSESDISTLKFFNNGYAIVTGADDG 285

Query: 401 TIRMWDIRTNTCVRVF 416
             RM+D+R++  V  +
Sbjct: 286 VARMFDMRSDCAVASY 301

 Score = 37.4 bits (85), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 32/139 (23%), Positives = 61/139 (43%), Gaps = 11/139 (7%)

Query: 295 LSGHTDGVK--ALRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLS--VDSFRK 350
           L+GH + +   A   D + +++ S D  + VW+   G   +        VL+  ++S   
Sbjct: 82  LNGHNNKISDFAWSSDSRSILSASQDGFMIVWDASLGFKKNAIPLDSQWVLTCAINSSGN 141

Query: 351 LIVSGSADKTVKVWH------VESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRM 404
           L+ S     +  ++       V+ +     +GHT +V+ V+    + +  + S DMT  +
Sbjct: 142 LVASAGLTNSCTIYRISQENRVQQQIVSMFKGHTCYVSQVEFFENN-SIITASGDMTCAL 200

Query: 405 WDIRTNTCVRVFHGHVGQV 423
           WDI     +  F  H+G V
Sbjct: 201 WDIPKAKRIAEFSDHLGDV 219

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 4/49 (8%)

Query: 283 IWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVW--NYV 327
           IWD    +++ +L GH+  +  ++   D   + TGS D T+++W  NY+
Sbjct: 374 IWDTLRAEIVGKLEGHSSRISGVKTSPDGMAVCTGSWDATLKLWSPNYM 422

>KLLA0F22000g complement(2044973..2047354) similar to sp|P42935
           Saccharomyces cerevisiae YGR200c ELP2 90 kDa subunit of
           elongator and elongating RNA polymerase II holoenzyme
           singleton, start by similarity
          Length = 793

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/203 (21%), Positives = 70/203 (34%), Gaps = 72/203 (35%)

Query: 280 TVAIW---DLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYV------- 327
           T+A+W   D +   + + L GHT  V  +RF      +++ S D  +RVWN+        
Sbjct: 34  TIALWKSMDTSHHGVFKTLKGHTAEVTCVRFVKGTDMMVSASEDFEVRVWNFPKLREGHM 93

Query: 328 -TGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVW---------------------- 364
               C+   + H+ ++      + L+V G AD ++ VW                      
Sbjct: 94  DEVECIQVIKHHKHTITVFAVLKNLLVVGCADGSISVWSFIEDQYVLQEEFSVQKGVFPL 153

Query: 365 ----HVESRTCYTL------------------------------RGHTGWVNCVKLH--- 387
               H   +T + L                               GH  W+  +      
Sbjct: 154 CLSMHEIEKTQFILAIGGTNVNVFIYSLVSNSEGVSKLEFATKLEGHEDWIKSLVFRETV 213

Query: 388 PKSFTCFSGSDDMTIRMWDIRTN 410
           P  +   SGS D  IR+W IRTN
Sbjct: 214 PGDYLLASGSQDRYIRLWRIRTN 236

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/136 (22%), Positives = 57/136 (41%), Gaps = 13/136 (9%)

Query: 294 RLSGHTDGVKALRF-----DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSV-LSVDS 347
           +L GH D +K+L F      D  L +GS D+ IR+W   T   + T    +  + L  + 
Sbjct: 196 KLEGHEDWIKSLVFRETVPGDYLLASGSQDRYIRLWRIRTNEKIDTSEEDEKKLTLLSNK 255

Query: 348 FRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDI 407
             K  +S          HV       + GH  W++ ++ H       + + D  + +W+ 
Sbjct: 256 IYKFDISADV-------HVAINFEALIMGHDDWISSLQWHKTKLQLLTSTADTAVMVWEP 308

Query: 408 RTNTCVRVFHGHVGQV 423
            T + + +    +G++
Sbjct: 309 DTISGIWICSSRLGEL 324

 Score = 37.0 bits (84), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 9/77 (11%)

Query: 352 IVSGSADKTVKVWHVESRTCY----TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDI 407
           +V+  A KT+ +W     + +    TL+GHT  V CV+    +    S S+D  +R+W+ 
Sbjct: 26  VVAYGAGKTIALWKSMDTSHHGVFKTLKGHTAEVTCVRFVKGTDMMVSASEDFEVRVWNF 85

Query: 408 RTNTCVRVFHGHVGQVQ 424
                 ++  GH+ +V+
Sbjct: 86  P-----KLREGHMDEVE 97

>Scas_615.11
          Length = 349

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 70/165 (42%), Gaps = 34/165 (20%)

Query: 275 GSYDSTVAIW-------------------DLATGKLIRRLSGHTDGVKALRF--DDQKLI 313
           GS+DSTV+IW                   +     L+  + GH + VK + +  D   L 
Sbjct: 78  GSFDSTVSIWTREDDLEEEEDDDEGEGTTNSLEMDLLAIIEGHENEVKGIAWSHDGALLS 137

Query: 314 TGSLDKTIRVWNYVTGA----CVSTYRGHQDSVLSVDSFRKL--IVSGSADKTVKVW--H 365
           + S DK++ +W          C+S  + H   V  V    +L  + S S D T+++W  +
Sbjct: 138 SCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDY 197

Query: 366 VESRTCYT-LRGHTGWVNCVKLHP----KSFTCFSGSDDMTIRMW 405
            +   C   L GH G V C         +S    SGSDD T+R+W
Sbjct: 198 DDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 61/277 (22%), Positives = 93/277 (33%), Gaps = 80/277 (28%)

Query: 290 KLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGAC---VSTYRGHQDSV---- 342
           KL + L    D + +L +    L TGS D+ I++ N VT A    VS      D+V    
Sbjct: 4   KLAKSLKLQNDKLWSLDYSHGLLATGSTDRKIKIIN-VTNAPRGQVSLMDVLDDTVHKKA 62

Query: 343 ---LSVDSFRKLIVSGSADKTVKVW--------------------HVESRTCYTLRGHTG 379
              ++      L+ +GS D TV +W                     +E      + GH  
Sbjct: 63  IRCVAWRPHSNLLAAGSFDSTVSIWTREDDLEEEEDDDEGEGTTNSLEMDLLAIIEGHEN 122

Query: 380 WVNCVKLHPKSFTCFSGSDDMTIRMWDIRTN----TCVRVFHGHVGQVQKVIPLTLGSDL 435
            V  +          S S D ++ +W+   +     C+ V   H   V+ V+        
Sbjct: 123 EVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVV-------- 174

Query: 436 IEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNV--KTGACIR 493
                                     +   LP    L S S D+TI+LW        C  
Sbjct: 175 --------------------------WHPELPL---LASSSYDDTIRLWKDYDDDWECAA 205

Query: 494 TQFGHVEGVW------DIAADNFRIVSGSHDRSCKVW 524
              GH   VW          ++ R+ SGS D + +VW
Sbjct: 206 VLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242

>Kwal_33.15475
          Length = 783

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/154 (22%), Positives = 64/154 (41%), Gaps = 15/154 (9%)

Query: 277 YDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK-----LITGSLDKTIRVWNYVTGAC 331
           Y  T+    L   +L   L GH D VKA+ F ++      L TGS D+ IR+W   T   
Sbjct: 176 YSFTLQDGTLNNFQLAAELEGHEDWVKAMDFYEESPGNMLLATGSQDRYIRLWRIRTNEL 235

Query: 332 VSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCY--TLRGHTGWVNCVKLHPK 389
           +             D F+  ++     K      ++    +   + GH  W++C+K H +
Sbjct: 236 IDNS--------DEDEFKLNLLGNKQSKFFITPDLKVAINFDALIVGHDDWISCLKWHKE 287

Query: 390 SFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQV 423
                + + D  + +W+   ++ V +    +G++
Sbjct: 288 RPQLLASTADTAVMVWEPDADSGVWICASRLGEL 321

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 48/117 (41%), Gaps = 10/117 (8%)

Query: 280 TVAIW---DLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTG----- 329
           T+A+W   D A   + R L GH   V  ++F      +++ S D  +R+W +        
Sbjct: 34  TIALWKPLDPAHHGVYRTLKGHNAEVTCVKFVPGTNLMVSSSEDSQVRLWAFEEKDQDAL 93

Query: 330 ACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKL 386
            CV     H+ ++ S+     ++  G AD +V +W  E+     L       N   L
Sbjct: 94  KCVQVIDHHKHTITSLSVISNILSVGCADGSVSLWLTENNQAILLHSFNLQTNVYPL 150

 Score = 36.2 bits (82), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 34/77 (44%), Gaps = 9/77 (11%)

Query: 352 IVSGSADKTVKVWH----VESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMW-- 405
           I++ +  KT+ +W            TL+GH   V CVK  P +    S S+D  +R+W  
Sbjct: 26  ILAFAGGKTIALWKPLDPAHHGVYRTLKGHNAEVTCVKFVPGTNLMVSSSEDSQVRLWAF 85

Query: 406 ---DIRTNTCVRVFHGH 419
              D     CV+V   H
Sbjct: 86  EEKDQDALKCVQVIDHH 102

>CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces
           cerevisiae YBR103w SIF2 SIR4P interacting protein, start
           by similarity
          Length = 535

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 46/85 (54%), Gaps = 3/85 (3%)

Query: 283 IWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGACVSTYRGHQD 340
           ++ ++  + I +L GH   +  L F+ +   L + + D TIRVW+   G  +  + GH  
Sbjct: 343 VYTMSDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQ 402

Query: 341 SVLSVDSFRK-LIVSGSADKTVKVW 364
           +++S+      +++S S D +VK+W
Sbjct: 403 TIVSLKWVNNDMLISASMDGSVKLW 427

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 34/173 (19%), Positives = 70/173 (40%), Gaps = 21/173 (12%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFD--DQKLITGSLDKTIRVWNYVTGAC 331
           TG  +  + +W+   GKL    + H   + A+ ++  +   I+   D    +W+  +G  
Sbjct: 239 TGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSGVV 297

Query: 332 VSTYRGH-----------QDSVLSVDSF----RKLIVSGSADKTVKVWHVESRTCYTLRG 376
           +  +               + +  VD+      K ++ G     +     +SR    L G
Sbjct: 298 LQHFESKANQINGNNNNNSNQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKLVG 357

Query: 377 HTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPL 429
           H G ++ ++ + ++    S +DD TIR+W       +  F+GH    Q ++ L
Sbjct: 358 HRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGH---TQTIVSL 407

 Score = 37.7 bits (86), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 35/67 (52%), Gaps = 3/67 (4%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA-ADNFRIVSGSHDRSCKVWDLQTGK 530
           L S + DNTI++W+   G  I   +GH + +  +   +N  ++S S D S K+WD   GK
Sbjct: 374 LASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWD--CGK 431

Query: 531 CMHTFVG 537
            +    G
Sbjct: 432 KLQEITG 438

 Score = 33.1 bits (74), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 278 DSTVAIWDLATGKLIRRLSGHTDGVKALRF-DDQKLITGSLDKTIRVWN 325
           D+T+ +W    G  I    GHT  + +L++ ++  LI+ S+D ++++W+
Sbjct: 380 DNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWD 428

>AER081C [2586] [Homologous to ScYLR409C - SH] (785301..788372)
           [3072 bp, 1023 aa]
          Length = 1023

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 37/61 (60%), Gaps = 2/61 (3%)

Query: 278 DSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGACVSTY 335
           D ++ + D  T +++R+L GH++ + A  F  D + +++ SLD T+R W+  TG C+   
Sbjct: 652 DFSIQVIDSVTQRVVRQLWGHSNRITAFDFSPDGRWIVSASLDSTLRTWDLPTGTCIDGV 711

Query: 336 R 336
           R
Sbjct: 712 R 712

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 63/143 (44%), Gaps = 4/143 (2%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFD--DQKLITGSLDKTIRVWNYVTGACV 332
           GS +  +++++L +G   +    H   V  L  D  ++K+++  LD  +  +++ T + +
Sbjct: 566 GSSNGGISVYNLQSGIKRKVYKMHKGSVTGLAVDGMNRKMVSCGLDGLVGFYDFTTNSFL 625

Query: 333 STYR-GHQDSVLSVDSFRKLIVSGSADKTVKVW-HVESRTCYTLRGHTGWVNCVKLHPKS 390
              + G   + L      +L      D +++V   V  R    L GH+  +      P  
Sbjct: 626 GKLQLGAPITQLVYHRASELFAVALDDFSIQVIDSVTQRVVRQLWGHSNRITAFDFSPDG 685

Query: 391 FTCFSGSDDMTIRMWDIRTNTCV 413
               S S D T+R WD+ T TC+
Sbjct: 686 RWIVSASLDSTLRTWDLPTGTCI 708

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 68/182 (37%), Gaps = 39/182 (21%)

Query: 313 ITGSLDKTIRVWNYVTGACVSTYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWHVESRT 370
           + GS +  I V+N  +G     Y+ H+ SV  L+VD   + +VS   D  V  +   + +
Sbjct: 564 LIGSSNGGISVYNLQSGIKRKVYKMHKGSVTGLAVDGMNRKMVSCGLDGLVGFYDFTTNS 623

Query: 371 CYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLT 430
                     +  +  H  S       DD +I++ D  T   VR   GH  ++       
Sbjct: 624 FLGKLQLGAPITQLVYHRASELFAVALDDFSIQVIDSVTQRVVRQLWGHSNRITA----- 678

Query: 431 LGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGA 490
                                          FD S P    ++S SLD+T++ W++ TG 
Sbjct: 679 -------------------------------FDFS-PDGRWIVSASLDSTLRTWDLPTGT 706

Query: 491 CI 492
           CI
Sbjct: 707 CI 708

 Score = 36.6 bits (83), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 37/66 (56%), Gaps = 3/66 (4%)

Query: 470 THLLSCSLDN-TIKLWNVKTGACIRTQFGHVEGV--WDIAADNFRIVSGSHDRSCKVWDL 526
           + L + +LD+ +I++ +  T   +R  +GH   +  +D + D   IVS S D + + WDL
Sbjct: 643 SELFAVALDDFSIQVIDSVTQRVVRQLWGHSNRITAFDFSPDGRWIVSASLDSTLRTWDL 702

Query: 527 QTGKCM 532
            TG C+
Sbjct: 703 PTGTCI 708

>KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces
           cerevisiae YLR409c singleton, start by similarity
          Length = 942

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 36/57 (63%), Gaps = 2/57 (3%)

Query: 278 DSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGACV 332
           D ++ + D  T K++R+L GH++ + +  F  D + +++ SLD TIR W+  TG C+
Sbjct: 566 DLSIVVVDSVTQKVVRQLWGHSNRISSFDFSPDGRWIVSSSLDSTIRTWDLPTGGCI 622

 Score = 37.7 bits (86), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 68/182 (37%), Gaps = 39/182 (21%)

Query: 313 ITGSLDKTIRVWNYVTGACVSTYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWHVESRT 370
           + GS +  I V N  +G     YR H+ +V  +++D   + +VS   D  V  +     T
Sbjct: 478 LVGSSNGGISVHNLQSGQKRKVYRLHKKAVTGIAMDGMNRKMVSCGLDGIVGFYDFSKST 537

Query: 371 CYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLT 430
                     +  +  H  S       DD++I + D  T   VR   GH  ++       
Sbjct: 538 FLGKLKLDSPITSMVYHRSSDLFALALDDLSIVVVDSVTQKVVRQLWGHSNRI------- 590

Query: 431 LGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGA 490
                                        ++FD S P    ++S SLD+TI+ W++ TG 
Sbjct: 591 -----------------------------SSFDFS-PDGRWIVSSSLDSTIRTWDLPTGG 620

Query: 491 CI 492
           CI
Sbjct: 621 CI 622

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 64/151 (42%), Gaps = 20/151 (13%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFD--DQKLITGSLDKTIRVWNYVTGACV 332
           GS +  +++ +L +G+  +    H   V  +  D  ++K+++  LD  +  +++      
Sbjct: 480 GSSNGGISVHNLQSGQKRKVYRLHKKAVTGIAMDGMNRKMVSCGLDGIVGFYDF----SK 535

Query: 333 STYRGHQDSVLSVDS-FRKLIVSGSAD---------KTVKVWHVESRTCYTLRGHTGWVN 382
           ST+ G     L +DS    ++   S+D           V V  V  +    L GH+  ++
Sbjct: 536 STFLGK----LKLDSPITSMVYHRSSDLFALALDDLSIVVVDSVTQKVVRQLWGHSNRIS 591

Query: 383 CVKLHPKSFTCFSGSDDMTIRMWDIRTNTCV 413
                P      S S D TIR WD+ T  C+
Sbjct: 592 SFDFSPDGRWIVSSSLDSTIRTWDLPTGGCI 622

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 3/66 (4%)

Query: 470 THLLSCSLDN-TIKLWNVKTGACIRTQFGHVEGV--WDIAADNFRIVSGSHDRSCKVWDL 526
           + L + +LD+ +I + +  T   +R  +GH   +  +D + D   IVS S D + + WDL
Sbjct: 557 SDLFALALDDLSIVVVDSVTQKVVRQLWGHSNRISSFDFSPDGRWIVSSSLDSTIRTWDL 616

Query: 527 QTGKCM 532
            TG C+
Sbjct: 617 PTGGCI 622

>Sklu_1645.2 YGL116W, Contig c1645 887-2650 reverse complement
          Length = 587

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 71/152 (46%), Gaps = 20/152 (13%)

Query: 274 TGSYDSTVAIWDLATG--KLIRRLSGHTDGVKALRF--DDQKLIT---GSLDKTIRVWNY 326
           +GS D++V IWD  T   + ++R   HT  VKA+ +  D   L+    G  DK I  WN 
Sbjct: 392 SGSNDNSVMIWDTRTSMPQFVKR--NHTAAVKAISWCPDVPNLLATGGGQTDKYIHFWNT 449

Query: 327 VTGACVSTYR-GHQDSVL------SVDSFRKLIVS--GSADKTVKVWHVESR--TCYTLR 375
            TGA VS+   G Q S L      + D   + IV+  G+ +  + V++ E+R      ++
Sbjct: 450 TTGARVSSINTGSQVSSLQWGQSYNGDIMNREIVATGGNPENAISVYNYETRFKVAEIVQ 509

Query: 376 GHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDI 407
            H   +   +L P   T  +   D  ++ + +
Sbjct: 510 AHDSRICSSQLSPDGTTLATVGGDENLKFYKV 541

 Score = 35.8 bits (81), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 68/158 (43%), Gaps = 16/158 (10%)

Query: 275 GSYDSTVAIWDLATGKLIRRL-SGHTDGVKALRFDDQKLITGSLDKTIRVWNY-VTGACV 332
           G  D    IWD+ T  L+R + SG    + +  + D  +  G+    I++ +  +    V
Sbjct: 309 GKSDGNTEIWDVETMSLVRTMRSGLGVRIGSQSWLDTLVACGTKSGEIQINDVRIKNHIV 368

Query: 333 STYRGHQDSVLSVDSFRK---LIVSGSADKTVKVWHVESRTC---YTLRGHTGWVNCVKL 386
           S ++ H   V  + S+RK    + SGS D +V +W  ++RT    +  R HT  V  +  
Sbjct: 369 SAWQEHSGEVCGL-SYRKDGLQLASGSNDNSVMIW--DTRTSMPQFVKRNHTAAVKAISW 425

Query: 387 HPKSFTCFS---GSDDMTIRMWDIRTNTCVRVFHGHVG 421
            P      +   G  D  I  W+  T T  RV   + G
Sbjct: 426 CPDVPNLLATGGGQTDKYIHFWN--TTTGARVSSINTG 461

 Score = 33.5 bits (75), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 33/154 (21%), Positives = 62/154 (40%), Gaps = 5/154 (3%)

Query: 278 DSTVAIWDLATG--KLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTY 335
           +S++ +W+  +G   L+      T        DD  +  G  D    +W+  T + V T 
Sbjct: 270 ESSLYLWNGESGDVTLLTEFEAETISSVTWSDDDCHVSIGKSDGNTEIWDVETMSLVRTM 329

Query: 336 R-GHQDSVLSVDSFRKLIVSGSADKTVKVWHV--ESRTCYTLRGHTGWVNCVKLHPKSFT 392
           R G    + S      L+  G+    +++  V  ++      + H+G V  +        
Sbjct: 330 RSGLGVRIGSQSWLDTLVACGTKSGEIQINDVRIKNHIVSAWQEHSGEVCGLSYRKDGLQ 389

Query: 393 CFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKV 426
             SGS+D ++ +WD RT+    V   H   V+ +
Sbjct: 390 LASGSNDNSVMIWDTRTSMPQFVKRNHTAAVKAI 423

>ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH]
           (128830..130335) [1506 bp, 501 aa]
          Length = 501

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 63/135 (46%), Gaps = 8/135 (5%)

Query: 280 TVAIWDLATGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGACVSTYRG 337
           ++ ++++   K I +L GH+  +  + +++    L++ S D T+RVW          + G
Sbjct: 304 SILVFNIGISKPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYG 363

Query: 338 HQDSVLS---VDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCV-KLHPKSFTC 393
           H  S+ S   VD     I+S S D +++VW + S +        G  N    L P     
Sbjct: 364 HSQSITSAHWVDD--DTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKF 421

Query: 394 FSGSDDMTIRMWDIR 408
            +G+ D  + ++DI+
Sbjct: 422 ATGTLDGEVMVYDIQ 436

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 58/269 (21%), Positives = 112/269 (41%), Gaps = 58/269 (21%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGAC 331
           TG     + +W +  GKL   LS H   +  +++  D+  ++T   D    VWN ++G  
Sbjct: 211 TGVESGELRLWSVE-GKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTA 269

Query: 332 VSTYR----GHQDSVLSVDSF----RKLIVSGSADKTVKVWHVE-SRTCYTLRGHTGWVN 382
           V  +     G ++S L VD+      K  + G    ++ V+++  S+    LRGH+  + 
Sbjct: 270 VQHFSFKEAGTEES-LGVDATWIDQDKFAIPG-IQGSILVFNIGISKPIGKLRGHSKTLT 327

Query: 383 CVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXX 442
            +  +  +    S SDD T+R+W         VF+GH                       
Sbjct: 328 TIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGH----------------------- 364

Query: 443 XXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGV 502
                          Q+    H +   T ++S S+D +I++W++ + + + +    V+GV
Sbjct: 365 --------------SQSITSAHWVDDDT-IISTSMDGSIRVWSLASNSTVAS--ATVDGV 407

Query: 503 WD----IAADNFRIVSGSHDRSCKVWDLQ 527
            +    ++ D  +  +G+ D    V+D+Q
Sbjct: 408 PNFTGALSPDQGKFATGTLDGEVMVYDIQ 436

>Scas_719.52
          Length = 628

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 65/169 (38%), Gaps = 38/169 (22%)

Query: 374 LRGHTGWVNCVKLHP-KSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLG 432
            RGHT  V      P       S SDD  I +W I  +   + +    G+ + + P+   
Sbjct: 77  FRGHTAQVLDTDFDPFNDHIIASSSDDSKIGIWKIPEDYSFQHYLDPDGEPKNIKPVKF- 135

Query: 433 SDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTH---LLSCSLDNTIKLWNVKTG 489
                                  S  +    H L +P     L S SLD T+KLWN++TG
Sbjct: 136 ----------------------LSGHSRKVGHVLFHPVAENVLASSSLDYTVKLWNIETG 173

Query: 490 ACIRTQFGHVEGVWDIAADNFRIVSGSH------DRSCKVWDLQTGKCM 532
             + T   H + V  ++        G+H      D+  +VWD++ GK +
Sbjct: 174 EAVIT-LKHPDMVTSMSFS----YGGNHLATVCRDKKLRVWDIREGKIV 217

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 70/164 (42%), Gaps = 36/164 (21%)

Query: 274 TGSYDSTVAIWDLATG----------------KLIRRLSGHTDGVKALRFD---DQKLIT 314
           + S DS + IW +                   K ++ LSGH+  V  + F    +  L +
Sbjct: 99  SSSDDSKIGIWKIPEDYSFQHYLDPDGEPKNIKPVKFLSGHSRKVGHVLFHPVAENVLAS 158

Query: 315 GSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFR---KLIVSGSADKTVKVWHV-ESRT 370
            SLD T+++WN  TG  V T + H D V S+ SF      + +   DK ++VW + E + 
Sbjct: 159 SSLDYTVKLWNIETGEAVITLK-HPDMVTSM-SFSYGGNHLATVCRDKKLRVWDIREGKI 216

Query: 371 CYTLRGHTG-------WV-NCVKLHPKSFTCFSGSDDMTIRMWD 406
                 H G       W+ N  +L   + T FS   D  I +WD
Sbjct: 217 VSEGPAHAGAKNQRVVWLGNSDRL---ATTGFSRLSDRQIGIWD 257

 Score = 33.9 bits (76), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 34/78 (43%), Gaps = 1/78 (1%)

Query: 351 LIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTN 410
           ++ S S D TVK+W++E+        H   V  +          +   D  +R+WDIR  
Sbjct: 155 VLASSSLDYTVKLWNIETGEAVITLKHPDMVTSMSFSYGGNHLATVCRDKKLRVWDIREG 214

Query: 411 TCVRVFHGHVG-QVQKVI 427
             V     H G + Q+V+
Sbjct: 215 KIVSEGPAHAGAKNQRVV 232

>Kwal_47.17555
          Length = 417

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 53/97 (54%), Gaps = 7/97 (7%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGAC 331
           TG     ++I+D +  ++ R L GH   +  ++F    + L++GS D  ++VW+ + G+ 
Sbjct: 124 TGDQGGIISIYD-SQAEVTRTLEGHYAEITDVKFFPSGEVLLSGSADMQLKVWSTLDGSN 182

Query: 332 VSTYRGHQDSVLS---VDSFRKLIVSGSADKTVKVWH 365
             T +GH  +V +   +D  R  ++S S D ++K+W 
Sbjct: 183 PRTLKGHTSTVTALGIIDRGRN-VMSSSKDGSLKLWE 218

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 45/96 (46%), Gaps = 3/96 (3%)

Query: 334 TYRGHQDSVLSVDSFR--KLIVSGSADKTVKVWH-VESRTCYTLRGHTGWVNCVKLHPKS 390
           T  GH   +  V  F   ++++SGSAD  +KVW  ++     TL+GHT  V  + +  + 
Sbjct: 143 TLEGHYAEITDVKFFPSGEVLLSGSADMQLKVWSTLDGSNPRTLKGHTSTVTALGIIDRG 202

Query: 391 FTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKV 426
               S S D ++++W+  +   +  F     Q   V
Sbjct: 203 RNVMSSSKDGSLKLWECGSGETIHSFARKTDQSDPV 238

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 31/76 (40%)

Query: 351 LIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTN 410
           L  +G     + ++  ++    TL GH   +  VK  P      SGS DM +++W     
Sbjct: 121 LYATGDQGGIISIYDSQAEVTRTLEGHYAEITDVKFFPSGEVLLSGSADMQLKVWSTLDG 180

Query: 411 TCVRVFHGHVGQVQKV 426
           +  R   GH   V  +
Sbjct: 181 SNPRTLKGHTSTVTAL 196

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 38/73 (52%), Gaps = 2/73 (2%)

Query: 466 LPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAA-DNFR-IVSGSHDRSCKV 523
            P    LLS S D  +K+W+   G+  RT  GH   V  +   D  R ++S S D S K+
Sbjct: 157 FPSGEVLLSGSADMQLKVWSTLDGSNPRTLKGHTSTVTALGIIDRGRNVMSSSKDGSLKL 216

Query: 524 WDLQTGKCMHTFV 536
           W+  +G+ +H+F 
Sbjct: 217 WECGSGETIHSFA 229

>YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the
           trimeric G protein that mediates signal transduction by
           pheromones, member of the WD (WD-40) repeat family [1272
           bp, 423 aa]
          Length = 423

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 52/257 (20%), Positives = 105/257 (40%), Gaps = 52/257 (20%)

Query: 295 LSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLS--VDSFRK 350
           L GH + +   R+  D +++++ S D  + +W+  +G   +        VLS  +     
Sbjct: 88  LKGHNNKISDFRWSRDSKRILSASQDGFMLIWDSASGLKQNAIPLDSQWVLSCAISPSST 147

Query: 351 LIVSGSADKTVKVWHV--ESRTCYTL----RGHTGWVNCVKLHPKSFTCFSGSDDMTIRM 404
           L+ S   +    ++ V  E+R    +    +GHT +++ ++    +    + S DMT  +
Sbjct: 148 LVASAGLNNNCTIYRVSKENRVAQNVASIFKGHTCYISDIEFTDNAH-ILTASGDMTCAL 206

Query: 405 WDIRTNTCVRVFHGHVGQVQKV-IPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFD 463
           WDI     VR +  H+G V  + IP                             +  N +
Sbjct: 207 WDIPKAKRVREYSDHLGDVLALAIP-----------------------------EEPNSE 237

Query: 464 HSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAA-----DNFRIVSGSHD 518
           +S        SC  D    +W+ ++ + +++ + +     DI A     D   IV+GS +
Sbjct: 238 NS---SNTFASCGSDGYTYIWDSRSPSAVQSFYVNDS---DINALRFFKDGMSIVAGSDN 291

Query: 519 RSCKVWDLQTGKCMHTF 535
            +  ++DL++   + TF
Sbjct: 292 GAINMYDLRSDCSIATF 308

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 51/256 (19%), Positives = 92/256 (35%), Gaps = 39/256 (15%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVS 333
           T S D T A+WD+   K +R  S H   V AL   ++                       
Sbjct: 197 TASGDMTCALWDIPKAKRVREYSDHLGDVLALAIPEEP---------------------- 234

Query: 334 TYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHPKSFT 392
                 +S  S ++F     S  +D    +W   S +   +   +   +N ++      +
Sbjct: 235 ------NSENSSNTF----ASCGSDGYTYIWDSRSPSAVQSFYVNDSDINALRFFKDGMS 284

Query: 393 CFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKV-IPLTLGSDLIEXXXXXXXXXXXXXX 451
             +GSD+  I M+D+R++  +  F    G  ++   P  + +++                
Sbjct: 285 IVAGSDNGAINMYDLRSDCSIATFSLFRGYEERTPTPTYMAANMEYNTAQSPQTLKSTSS 344

Query: 452 XXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGH---VEGVWDIAAD 508
               +    + D S      + SC  D    +W+V  G  +    GH   V GV   + D
Sbjct: 345 SYLDNQGVVSLDFSAS-GRLMYSCYTDIGCVVWDVLKGEIVGKLEGHGGRVTGVRS-SPD 402

Query: 509 NFRIVSGSHDRSCKVW 524
              + +GS D + K+W
Sbjct: 403 GLAVCTGSWDSTMKIW 418

>Scas_702.16
          Length = 816

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 46/111 (41%), Gaps = 19/111 (17%)

Query: 308 DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVE 367
           D +++ TG LD  IR+W                   SVDS ++++   S    V +    
Sbjct: 28  DGKRVATGGLDGKIRIW-------------------SVDSIKQIVKILSLKDEVPIDKEL 68

Query: 368 SRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHG 418
            +   ++  HTG V C+K  P      SGSDD  + +W +     ++   G
Sbjct: 69  KKPLASMSRHTGSVTCLKFSPNGKYLASGSDDRILLIWTLDEERPIQPIFG 119

 Score = 33.9 bits (76), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 48/112 (42%), Gaps = 20/112 (17%)

Query: 274 TGSYDSTVAIWDLATGKLI----------------RRLSGHTDGVKAL--RFDDQKLITG 315
           +GS D  + IW L   + I                +RL  H + ++ +    D   L++ 
Sbjct: 96  SGSDDRILLIWTLDEERPIQPIFGGESEKERWAVRKRLVAHDNDIQDICWAPDSSLLVSV 155

Query: 316 SLDKTIRVWNYVTGACVSTYRGHQDSVLSV--DSFRKLIVSGSADKTVKVWH 365
            LD+ + +WN +T   +  +  HQ  V  V  D   K   + S D+T+K++ 
Sbjct: 156 GLDRAVIIWNGITFEKLKRFDVHQSHVKGVIFDPANKYFATASDDRTMKIFR 207

>Scas_512.3
          Length = 534

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 37/60 (61%), Gaps = 2/60 (3%)

Query: 309 DQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSV--DSFRKLIVSGSADKTVKVWHV 366
           D+ +++GS+D +IRV++  +G  + TY  H   V  V  D   + I+S SAD++V ++ +
Sbjct: 158 DRYVVSGSMDNSIRVFDIESGKLLGTYADHNHYVQGVTWDPLNEFILSQSADRSVNIYQI 217

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 69/162 (42%), Gaps = 14/162 (8%)

Query: 373 TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVG-QVQKVIPLTL 431
           +L  H   +N VK +       S  DD  I +W  +    V   +G     V   +P   
Sbjct: 62  SLTQHEQAINVVKFNSPGTILASAGDDGQILLWKQQD---VNEQNGETAAPVDSSVPKPF 118

Query: 432 GS---DLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKT 488
           GS   D  E                  S +  + D S P   +++S S+DN+I+++++++
Sbjct: 119 GSTFEDDEENNKESWFVWKRLRAPGSNSSEIYDLDWS-PCDRYVVSGSMDNSIRVFDIES 177

Query: 489 GACIRTQFGH---VEGV-WDIAADNFRIVSGSHDRSCKVWDL 526
           G  + T   H   V+GV WD    N  I+S S DRS  ++ +
Sbjct: 178 GKLLGTYADHNHYVQGVTWDPL--NEFILSQSADRSVNIYQI 217

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 11/84 (13%)

Query: 350 KLIVSGSADKTVKVWHVES-RTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIR----M 404
           + +VSGS D +++V+ +ES +   T   H  +V  V   P +    S S D ++     +
Sbjct: 159 RYVVSGSMDNSIRVFDIESGKLLGTYADHNHYVQGVTWDPLNEFILSQSADRSVNIYQII 218

Query: 405 WDIRTNTC------VRVFHGHVGQ 422
           WD  +NT        R+  G + Q
Sbjct: 219 WDSDSNTIDKLKLKNRIMKGELPQ 242

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 12/56 (21%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFD--DQKLITGSLDKTIRVWNYV 327
           +GS D+++ ++D+ +GKL+   + H   V+ + +D  ++ +++ S D+++ ++  +
Sbjct: 163 SGSMDNSIRVFDIESGKLLGTYADHNHYVQGVTWDPLNEFILSQSADRSVNIYQII 218

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 19/24 (79%)

Query: 512 IVSGSHDRSCKVWDLQTGKCMHTF 535
           +VSGS D S +V+D+++GK + T+
Sbjct: 161 VVSGSMDNSIRVFDIESGKLLGTY 184

>Sklu_675.1 YMR146C, Contig c675 761-1687
          Length = 308

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 51/248 (20%), Positives = 103/248 (41%), Gaps = 27/248 (10%)

Query: 295 LSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGACVSTYRGHQDSV--LSVDSFRK 350
           L GH   +  ++++ +   + + + D    VW  + G  + T+ GH  ++  + VD F +
Sbjct: 6   LKGHERSLTQVKYNREGDLIFSCAKDSVASVWYAINGERLGTFEGHMGTIWSIDVDQFTE 65

Query: 351 LIVSGSADKTVKVWHV-ESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRT 409
             V+GSAD +VK+W V +    YT +  T         P     FS + D  + + D   
Sbjct: 66  YAVTGSADFSVKLWKVCDGSNVYTWKTKT---------PVRRVEFSPAGDKILAVLD--- 113

Query: 410 NTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYP 469
              V  + G V  V  V+  T  ++++                   SV +  F+      
Sbjct: 114 --GVMGYAGSV-TVYDVVRNTETNEIVNINEEPVFEILTHDDFGIASVASWGFEGK---- 166

Query: 470 THLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDI--AADNFRIVSGSHDRSCKVWDLQ 527
            ++++   D  +  ++ + G  + +   H + V DI  + D    ++ S D + K+ D+ 
Sbjct: 167 -YIVAGHKDGKVSKYDGENGEYLDSLELHEQSVSDIQFSPDRTYFITSSRDSASKLVDVT 225

Query: 528 TGKCMHTF 535
           +   + T+
Sbjct: 226 SFDVLKTY 233

>Kwal_33.13515
          Length = 398

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 43/90 (47%), Gaps = 3/90 (3%)

Query: 285 DLATGKLIRRLSGHTDGVKALRFD--DQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSV 342
           ++A  KL  R  GHT  +  ++ D  ++ L+ GSLD     W+  +  C     G   S+
Sbjct: 222 EMAAVKLKVRACGHTGAITCMKLDPDNRFLVAGSLDTICSFWDLSSMCCERVINGFDTSI 281

Query: 343 LSVDSFRKLIVSG-SADKTVKVWHVESRTC 371
           L +D  R  +  G  +D   +++ +ES  C
Sbjct: 282 LDLDLSRDGVAVGLCSDNQTRIYLIESGAC 311

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 66/161 (40%), Gaps = 26/161 (16%)

Query: 279 STVAIWDLATGKLIRRL-SGHTDGVKALRFDDQKLITGSL-----------DKTIRVWNY 326
           S ++IWD +TG LI+   +G + G     +       G+L           DK   + + 
Sbjct: 121 SRISIWDASTGALIKSFETGLSSGNYKCYYSPNGKWFGALVENGEFCLFDVDKNYELCS- 179

Query: 327 VTGACVSTYRGHQDSVLSV--DSFRKLIVSGSADKTVKVWHVES-------RTCYTLRGH 377
           V+  C        + V ++      K + +G     + ++ VE        R C    GH
Sbjct: 180 VSQLCAGENLASLNKVTALQWSHDGKWLYAGFESGEIVLFEVEMAAVKLKVRAC----GH 235

Query: 378 TGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHG 418
           TG + C+KL P +    +GS D     WD+ +  C RV +G
Sbjct: 236 TGAITCMKLDPDNRFLVAGSLDTICSFWDLSSMCCERVING 276

>Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement
          Length = 509

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 48/98 (48%), Gaps = 3/98 (3%)

Query: 280 TVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGACVSTYRG 337
           ++ ++ +   K I +L GHT  +  L +  D++ L++ S DKT+R W        + + G
Sbjct: 317 SILVFSIGESKPIGKLVGHTKTLTVLCYNSDNKLLLSASDDKTLRTWRGGNANSSNCFYG 376

Query: 338 HQDSVLSVDSF-RKLIVSGSADKTVKVWHVESRTCYTL 374
           H  S+   D      ++S S D +V+VW V+      L
Sbjct: 377 HTQSITYADWLDDDRLISTSMDGSVRVWSVKQNALVGL 414

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 55/287 (19%), Positives = 107/287 (37%), Gaps = 56/287 (19%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGAC 331
           TG  +  + +W    G L    + H   V ++ +  D   ++T  +D    VWN +TG  
Sbjct: 224 TGVENGELRMWSFR-GILQNVFNFHRSPVVSIEWNADSTHVLTSDVDNITIVWNALTGTA 282

Query: 332 VSTY-----RGHQDSVLSVDSFR--KLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCV 384
           +  +      G++   + V+     K ++ G     +     ES+    L GHT  +  +
Sbjct: 283 LQHFDLKDTTGNESLGIDVEWIETDKFVIPGLQGSILVFSIGESKPIGKLVGHTKTLTVL 342

Query: 385 KLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXX 444
             +  +    S SDD T+R W          F+GH   +         +D ++       
Sbjct: 343 CYNSDNKLLLSASDDKTLRTWRGGNANSSNCFYGHTQSITY-------ADWLDDD----- 390

Query: 445 XXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGV-- 502
                                      L+S S+D ++++W+VK  A +      V+GV  
Sbjct: 391 --------------------------RLISTSMDGSVRVWSVKQNALVGLSV--VDGVPI 422

Query: 503 --WDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGI 547
               +++D  +  +G+ D    V++++  K +        P+  V I
Sbjct: 423 FCGTLSSDKQKFATGTLDGEVSVYNVK--KLLEVLDADEKPIGPVRI 467

>Kwal_23.4118
          Length = 939

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 36/61 (59%), Gaps = 2/61 (3%)

Query: 278 DSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGACVSTY 335
           D ++ + D  T K++R+L GH++ + +  F  D + +I+ SLD T R W+  TG C+   
Sbjct: 565 DFSIVVVDAVTQKVVRQLWGHSNRISSFDFSPDGRWIISTSLDGTARTWDLPTGCCIDGI 624

Query: 336 R 336
           R
Sbjct: 625 R 625

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 33/154 (21%), Positives = 65/154 (42%), Gaps = 26/154 (16%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFD--DQKLITGSLDKTIRVWNYVTG--- 329
           GS +  + +++L +G   ++   H   V  +  D  ++K+++  LD  +  +++      
Sbjct: 479 GSSNGGIGVYNLQSGLPRKKYRLHKKAVSGIAVDGMNRKMVSCGLDGIVGFYDFSKSSYL 538

Query: 330 ------ACVSTYRGHQDS---VLSVDSFRKLIVSGSADKTVK-VWHVESRTCYTLRGHTG 379
                 A V++   H+ S    L++D F  ++V     K V+ +W           GH+ 
Sbjct: 539 GKLQLDAPVTSMVYHRSSDLFALALDDFSIVVVDAVTQKVVRQLW-----------GHSN 587

Query: 380 WVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCV 413
            ++     P      S S D T R WD+ T  C+
Sbjct: 588 RISSFDFSPDGRWIISTSLDGTARTWDLPTGCCI 621

 Score = 33.5 bits (75), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 3/66 (4%)

Query: 470 THLLSCSLDN-TIKLWNVKTGACIRTQFGHVEGV--WDIAADNFRIVSGSHDRSCKVWDL 526
           + L + +LD+ +I + +  T   +R  +GH   +  +D + D   I+S S D + + WDL
Sbjct: 556 SDLFALALDDFSIVVVDAVTQKVVRQLWGHSNRISSFDFSPDGRWIISTSLDGTARTWDL 615

Query: 527 QTGKCM 532
            TG C+
Sbjct: 616 PTGCCI 621

>YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in
           telomere silencing, interacts with Sir4p and targets
           Sir4p from telomeres to other sites, component of Set3p
           complex, has WD (WD-40) repeats [1608 bp, 535 aa]
          Length = 535

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 46/90 (51%), Gaps = 7/90 (7%)

Query: 288 TGKLIRRLSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSV 345
           TGKLI    GH   +  L F+D    L++ S D T+R+W+   G   + + GH  S++S 
Sbjct: 352 TGKLI----GHHGPISVLEFNDTNKLLLSASDDGTLRIWHGGNGNSQNCFYGHSQSIVSA 407

Query: 346 DSF-RKLIVSGSADKTVKVWHVESRTCYTL 374
                  ++S S D +V++W ++  T   L
Sbjct: 408 SWVGDDKVISCSMDGSVRLWSLKQNTLLAL 437

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 54/279 (19%), Positives = 108/279 (38%), Gaps = 68/279 (24%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGAC 331
           TG  +  + +W+  TG L+  L+ H   + ++++  D   +I+  ++    +WN ++G  
Sbjct: 237 TGVENGELRLWN-KTGALLNVLNFHRAPIVSVKWNKDGTHIISMDVENVTILWNVISGTV 295

Query: 332 VSTYRGHQ-------------DSVLSVD----SFRKLIVSGSADKTVKVWHVESRT-CYT 373
           +  +   +             D  L VD       K ++ G     + V+ +  +T    
Sbjct: 296 MQHFELKETGGSSINAENHSGDGSLGVDVEWVDDDKFVIPGPK-GAIFVYQITEKTPTGK 354

Query: 374 LRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLT-LG 432
           L GH G ++ ++ +  +    S SDD T+R+W          F+GH    Q ++  + +G
Sbjct: 355 LIGHHGPISVLEFNDTNKLLLSASDDGTLRIWHGGNGNSQNCFYGH---SQSIVSASWVG 411

Query: 433 SDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACI 492
            D                                     ++SCS+D +++LW++K    +
Sbjct: 412 DD------------------------------------KVISCSMDGSVRLWSLKQNTLL 435

Query: 493 RTQFGHVEGV----WDIAADNFRIVSGSHDRSCKVWDLQ 527
                 V+GV      I+ D  +      D    V+DL+
Sbjct: 436 ALSI--VDGVPIFAGRISQDGQKYAVAFMDGQVNVYDLK 472

>Scas_605.18
          Length = 424

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 51/259 (19%), Positives = 102/259 (39%), Gaps = 34/259 (13%)

Query: 290 KLIRRLSGHTDGVKALRF-DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSV--- 345
            ++    GHT  +  + F D+  +IT S D T  +W+      V  Y  H   VL++   
Sbjct: 171 NVVSIFKGHTCYISDIEFLDNSHIITSSGDMTCALWDIPKAKRVREYADHLGDVLALALP 230

Query: 346 ------DSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGW---VNCVKLHPKSFTCFSG 396
                 ++   +  S  +D    +W  ++RT   ++        VN ++      +  +G
Sbjct: 231 PPSADENTGANIFASCGSDGYTYIW--DTRTSAAVQKFFASDTDVNAIQFFKDGNSIVTG 288

Query: 397 SDDMTIRMWDIRTNTCVRVFHGHVGQVQKVI--PLTLGSDLIEXXXXXXXXXXXXXXXXX 454
            DD  I M+D+R++  +  +    G +QK I  P  + S++                   
Sbjct: 289 GDDGVINMFDLRSDCAIASYSLQQG-IQKEIRDPTYMSSNM-------EYSRGSPQSPIS 340

Query: 455 XSVQAANFDH----SLPYPTH---LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDI-- 505
            ++ ++  D+    SL +      + +C  D    +W+V     +    GH   V  +  
Sbjct: 341 TAISSSYLDNQGVVSLDFSNSGRLMFACYTDLGCIIWDVLKAEIVGKLEGHSNRVSSVRT 400

Query: 506 AADNFRIVSGSHDRSCKVW 524
           + D   + +GS D + ++W
Sbjct: 401 SPDGLGVCTGSWDSTMRIW 419

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 51/253 (20%), Positives = 93/253 (36%), Gaps = 43/253 (16%)

Query: 295 LSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLS--VDSFRK 350
           L GH + +   R+  D + +++ S D  + +W+  +G   +        VLS  +     
Sbjct: 87  LKGHNNKISDFRWSRDSKSILSASQDGFMLIWDTASGLKRNAIPLDSQWVLSCALSPSGN 146

Query: 351 LIVSGSADKTVKVWHV------ESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRM 404
           L  S   +    ++ V      +       +GHT +++ ++    S    + S DMT  +
Sbjct: 147 LAASAGLNNNCTIYRVSKENRVQQNVVSIFKGHTCYISDIEFLDNSH-IITSSGDMTCAL 205

Query: 405 WDIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDH 464
           WDI     VR +  H+G    V+ L L     +                      AN   
Sbjct: 206 WDIPKAKRVREYADHLGD---VLALALPPPSADENT------------------GANI-- 242

Query: 465 SLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA--ADNFRIVSGSHDRSCK 522
                    SC  D    +W+ +T A ++  F     V  I    D   IV+G  D    
Sbjct: 243 -------FASCGSDGYTYIWDTRTSAAVQKFFASDTDVNAIQFFKDGNSIVTGGDDGVIN 295

Query: 523 VWDLQTGKCMHTF 535
           ++DL++   + ++
Sbjct: 296 MFDLRSDCAIASY 308

 Score = 36.6 bits (83), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 31/49 (63%), Gaps = 4/49 (8%)

Query: 283 IWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVW--NYV 327
           IWD+   +++ +L GH++ V ++R   D   + TGS D T+R+W  NY+
Sbjct: 376 IWDVLKAEIVGKLEGHSNRVSSVRTSPDGLGVCTGSWDSTMRIWSPNYM 424

>Kwal_47.17567
          Length = 590

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 61/142 (42%), Gaps = 7/142 (4%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTG-ACVS 333
           G  +  V I+D+   K IR + GH D V  L +++  L +GS D+ I   +  T  +   
Sbjct: 344 GQTNGLVNIFDVEKKKCIRTIPGHIDRVACLSWNNHILTSGSRDRRILHRDVRTPQSSFE 403

Query: 334 TYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHPKS 390
             R H   V  L  +     + SG  D  V V+   SR  +  L  HT  V  +   P  
Sbjct: 404 EIRTHNQEVCGLKWNVEDNKLASGGNDNAVFVYDGTSRLPFLKLEEHTAAVKAMAWSPHR 463

Query: 391 ---FTCFSGSDDMTIRMWDIRT 409
                   G+ D  +++W+++T
Sbjct: 464 RGILATGGGTADKRLKIWNVKT 485

 Score = 37.4 bits (85), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 43/89 (48%), Gaps = 3/89 (3%)

Query: 470 THLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTG 529
           +HL     +  + +++V+   CIRT  GH++ V  ++ +N  + SGS DR     D++T 
Sbjct: 339 SHLAVGQTNGLVNIFDVEKKKCIRTIPGHIDRVACLSWNNHILTSGSRDRRILHRDVRTP 398

Query: 530 KCMHTFVGIHAPVACV---GIGDSEFVSG 555
           +     +  H    C     + D++  SG
Sbjct: 399 QSSFEEIRTHNQEVCGLKWNVEDNKLASG 427

 Score = 37.0 bits (84), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 63/143 (44%), Gaps = 9/143 (6%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK---LITG--SLDKTIRVWNYVT 328
           +G  D+ V ++D  +     +L  HT  VKA+ +   +   L TG  + DK +++WN  T
Sbjct: 426 SGGNDNAVFVYDGTSRLPFLKLEEHTAAVKAMAWSPHRRGILATGGGTADKRLKIWNVKT 485

Query: 329 GAC---VSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVES-RTCYTLRGHTGWVNCV 384
                 V T     + + S ++   +   G +   + +W   +      L+GH+  V  +
Sbjct: 486 SVKLHDVDTASQVCNMIWSKNTNEIITSHGYSKYNLTLWDGNTLEPMAILKGHSFRVLHM 545

Query: 385 KLHPKSFTCFSGSDDMTIRMWDI 407
            L     T  SG+ D T+R W +
Sbjct: 546 TLSTDGTTVVSGAGDETLRYWKL 568

 Score = 32.7 bits (73), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 32/144 (22%), Positives = 60/144 (41%), Gaps = 18/144 (12%)

Query: 279 STVAIWDLATGKLIRRLSGHTDGVKALRFDDQK------------LITGSLDKTIRVWNY 326
           S+  +  +A GK I     +T+ V  L   D +            L  G  +  + +++ 
Sbjct: 296 SSTDVLAVALGKSIFLTDNNTNEVTQLSTTDNEYTSLSWVGAGSHLAVGQTNGLVNIFDV 355

Query: 327 VTGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYT----LRGHTGWVN 382
               C+ T  GH D V  +     ++ SGS D+  ++ H + RT  +    +R H   V 
Sbjct: 356 EKKKCIRTIPGHIDRVACLSWNNHILTSGSRDR--RILHRDVRTPQSSFEEIRTHNQEVC 413

Query: 383 CVKLHPKSFTCFSGSDDMTIRMWD 406
            +K + +     SG +D  + ++D
Sbjct: 414 GLKWNVEDNKLASGGNDNAVFVYD 437

>YGL116W (CDC20) [1869] chr7 (289810..291642) Activator of anaphase
           promoting complex (APC), required for microtubule
           function at mitosis and for exit from anaphase, contains
           WD (WD-40) repeats [1833 bp, 610 aa]
          Length = 610

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 65/159 (40%), Gaps = 19/159 (11%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALR---FDDQKLITG--SLDKTIRVWNYVT 328
           +G  D+TV IWD  T         HT  VKAL    +    L +G    DK I  WN +T
Sbjct: 402 SGGNDNTVMIWDTRTSLPQFSKKTHTAAVKALSWCPYSPNILASGGGQTDKHIHFWNSIT 461

Query: 329 GACV-STYRGHQDSVL---------SVDSFRKLIVS--GSADKTVKVWHVES--RTCYTL 374
           GA V S   G Q S L         +     K IV+  G+ +  + V++ E+  +    +
Sbjct: 462 GARVGSINTGSQVSSLHWGQSHTSTNGGMMNKEIVATGGNPENAISVYNYETKFKVAEVV 521

Query: 375 RGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCV 413
             H   + C +L P   T  +   D  ++ + I    C 
Sbjct: 522 HAHEARICCSQLSPDGTTLATVGGDENLKFYKIFDPRCT 560

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 71/165 (43%), Gaps = 19/165 (11%)

Query: 275 GSYDSTVAIWDLATGKLIRRL-SGHTDGVKALRFDDQKLITGSLDKTIRVWNY-VTGACV 332
           G  D    IWD+ T  LIR + SG    + +L + D  + TGS    I++ +  +    V
Sbjct: 319 GKEDGNTEIWDVETMSLIRTMRSGLGVRIGSLSWLDTLIATGSRSGEIQINDVRIKQHIV 378

Query: 333 STYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWHVESRTC---YTLRGHTGWVNCVKLH 387
           ST+  H   V  LS  S    + SG  D TV +W  ++RT    ++ + HT  V  +   
Sbjct: 379 STWAEHTGEVCGLSYKSDGLQLASGGNDNTVMIW--DTRTSLPQFSKKTHTAAVKALSWC 436

Query: 388 PKSFTCFS---GSDDMTIRMWDIRT-------NTCVRVFHGHVGQ 422
           P S    +   G  D  I  W+  T       NT  +V   H GQ
Sbjct: 437 PYSPNILASGGGQTDKHIHFWNSITGARVGSINTGSQVSSLHWGQ 481

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 56/138 (40%), Gaps = 5/138 (3%)

Query: 278 DSTVAIWDLATG--KLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTY 335
           D+ + +W+  TG   L+      T        DD  +  G  D    +W+  T + + T 
Sbjct: 280 DTALYLWNATTGDVSLLTDFENTTICSVTWSDDDCHISIGKEDGNTEIWDVETMSLIRTM 339

Query: 336 R-GHQDSVLSVDSFRKLIVSGSADKTVKV--WHVESRTCYTLRGHTGWVNCVKLHPKSFT 392
           R G    + S+     LI +GS    +++    ++     T   HTG V  +        
Sbjct: 340 RSGLGVRIGSLSWLDTLIATGSRSGEIQINDVRIKQHIVSTWAEHTGEVCGLSYKSDGLQ 399

Query: 393 CFSGSDDMTIRMWDIRTN 410
             SG +D T+ +WD RT+
Sbjct: 400 LASGGNDNTVMIWDTRTS 417

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 34/69 (49%), Gaps = 6/69 (8%)

Query: 471 HLLSCSLDNTIKLWNVKTG-ACIRTQFGHV---EGVWDIAADNFRIVSGSHDRSCKVWDL 526
           ++L+ +LD  + LWN  TG   + T F +       W  + D+  I  G  D + ++WD+
Sbjct: 273 NVLAIALDTALYLWNATTGDVSLLTDFENTTICSVTW--SDDDCHISIGKEDGNTEIWDV 330

Query: 527 QTGKCMHTF 535
           +T   + T 
Sbjct: 331 ETMSLIRTM 339

>CAGL0F07337g complement(714870..716735) similar to sp|P26309
           Saccharomyces cerevisiae YGL116w CDC20 cell division
           control protein, hypothetical start
          Length = 621

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 64/151 (42%), Gaps = 17/151 (11%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFD--DQKLIT---GSLDKTIRVWNYVT 328
           +G  D+T+ IWD  T         H+  VKAL +   +  L+    G  D+ I  WN  T
Sbjct: 394 SGGNDNTMMIWDTRTSMPQFVKKDHSAAVKALAWSPTNAGLLASGGGQTDQQIHFWNSTT 453

Query: 329 GACVSTYR-GHQDSVL----SVDSFRKLIVS-----GSADKTVKVWHVESR--TCYTLRG 376
           GA + T   G Q S L    S D+   + V      GS D ++ +++ E+R      +  
Sbjct: 454 GAKLHTINTGSQVSSLHWGQSYDTKGNMNVEIVATGGSPDNSISIYNYETRYKVAEVVHA 513

Query: 377 HTGWVNCVKLHPKSFTCFSGSDDMTIRMWDI 407
           H   + C KL P      +   D  ++ + I
Sbjct: 514 HDARICCSKLSPDGTVLATIGGDENLKFYKI 544

 Score = 33.9 bits (76), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 47/122 (38%), Gaps = 3/122 (2%)

Query: 308 DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDS-FRKLIVSG--SADKTVKVW 364
           DD  +  G  D    +W+  T   V T R   +  +   S    L+ +G  S +  +   
Sbjct: 304 DDCHISIGKSDGNTEIWDVETSTLVRTMRSKLNVRIGSQSWLETLLATGFRSGEIQINDV 363

Query: 365 HVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQ 424
            ++     T   HTG V  +          SG +D T+ +WD RT+    V   H   V+
Sbjct: 364 RIKDHIVNTWDEHTGEVCGLSYKADGLQLASGGNDNTMMIWDTRTSMPQFVKKDHSAAVK 423

Query: 425 KV 426
            +
Sbjct: 424 AL 425

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 66/169 (39%), Gaps = 27/169 (15%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK-----LITGSLDKTIRVWNY-VT 328
           G  D    IWD+ T  L+R +    +    +R   Q      L TG     I++ +  + 
Sbjct: 311 GKSDGNTEIWDVETSTLVRTMRSKLN----VRIGSQSWLETLLATGFRSGEIQINDVRIK 366

Query: 329 GACVSTYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWHVESRTC---YTLRGHTGWVNC 383
              V+T+  H   V  LS  +    + SG  D T+ +W  ++RT    +  + H+  V  
Sbjct: 367 DHIVNTWDEHTGEVCGLSYKADGLQLASGGNDNTMMIW--DTRTSMPQFVKKDHSAAVKA 424

Query: 384 VKLHPKSFTCFS---GSDDMTIRMWDIRT-------NTCVRVFHGHVGQ 422
           +   P +    +   G  D  I  W+  T       NT  +V   H GQ
Sbjct: 425 LAWSPTNAGLLASGGGQTDQQIHFWNSTTGAKLHTINTGSQVSSLHWGQ 473

>YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa
           subunit of elongator and elongating RNA polymerase II
           holoenzyme, has WD (WD-40) repeats [2367 bp, 788 aa]
          Length = 788

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 46/93 (49%), Gaps = 8/93 (8%)

Query: 280 TVAIWDLATGK---LIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGA---C 331
           T+A+WD        +   L GH   V  +RF  D   +++ S D  +++W +   +   C
Sbjct: 37  TIALWDPIEPNNKGVYATLKGHEAEVTCVRFVPDSDFMVSASEDHHVKIWKFTDYSHLQC 96

Query: 332 VSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVW 364
           + T + +  +++++ +   LI  G AD T+ +W
Sbjct: 97  IQTIQHYSKTIVALSALPSLISVGCADGTISIW 129

 Score = 36.6 bits (83), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 5/83 (6%)

Query: 327 VTGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVW---HVESRTCY-TLRGHTGWVN 382
           +T   +      Q  V  +   +K++  G A KT+ +W      ++  Y TL+GH   V 
Sbjct: 5   ITPEAIFIGANKQTQVSDIHKVKKIVAFG-AGKTIALWDPIEPNNKGVYATLKGHEAEVT 63

Query: 383 CVKLHPKSFTCFSGSDDMTIRMW 405
           CV+  P S    S S+D  +++W
Sbjct: 64  CVRFVPDSDFMVSASEDHHVKIW 86

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 31/143 (21%), Positives = 65/143 (45%), Gaps = 18/143 (12%)

Query: 290 KLIRRLSGHTDGVKALRFDDQK------LITGSLDKTIRVWNYVTGACV--STYRGHQDS 341
           +++  L GH D VK+L F  Q+      L +GS D+ IR+W       +  S     + +
Sbjct: 193 RVVAELEGHEDWVKSLAFRHQETPGDYLLCSGSQDRYIRLWRIRINDLIDDSEEDSKKLT 252

Query: 342 VLSVDSFRKLIVSGSADKTVKV-WHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDM 400
           +LS   ++  I     D  ++V  + E+     + GH  W++ ++ H       + + D 
Sbjct: 253 LLSNKQYKFQI-----DDELRVGINFEA----LIMGHDDWISSLQWHESRLQLLAATADT 303

Query: 401 TIRMWDIRTNTCVRVFHGHVGQV 423
           ++ +W+    + + V    +G++
Sbjct: 304 SLMVWEPDETSGIWVCSLRLGEM 326

>AFL009C [3184] [Homologous to ScYGL004C - SH] (420007..421248)
           [1242 bp, 413 aa]
          Length = 413

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 41/84 (48%), Gaps = 3/84 (3%)

Query: 337 GHQDSVLSVDSFR--KLIVSGSADKTVKVWHVESRTC-YTLRGHTGWVNCVKLHPKSFTC 393
           GH   + S+  F   K+++S S D  +K+W     T   TL GHT  +    L  +    
Sbjct: 144 GHSGHITSLHYFPSGKVLLSASIDMQLKIWSAADGTNPRTLFGHTAPITGCGLIERGRNV 203

Query: 394 FSGSDDMTIRMWDIRTNTCVRVFH 417
            S S D ++R+W+  + + +R FH
Sbjct: 204 LSSSKDGSVRLWECGSGSMLRAFH 227

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 35/74 (47%), Gaps = 2/74 (2%)

Query: 464 HSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVW--DIAADNFRIVSGSHDRSC 521
           H  P    LLS S+D  +K+W+   G   RT FGH   +    +      ++S S D S 
Sbjct: 153 HYFPSGKVLLSASIDMQLKIWSAADGTNPRTLFGHTAPITGCGLIERGRNVLSSSKDGSV 212

Query: 522 KVWDLQTGKCMHTF 535
           ++W+  +G  +  F
Sbjct: 213 RLWECGSGSMLRAF 226

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/139 (22%), Positives = 51/139 (36%), Gaps = 37/139 (26%)

Query: 355 GSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVR 414
           G  +  + + + E   C +L GH+G +  +   P      S S DM +++W     T  R
Sbjct: 123 GDTEGRLTLHNAEFSDCRSLDGHSGHITSLHYFPSGKVLLSASIDMQLKIWSAADGTNPR 182

Query: 415 VFHGHVGQVQKVIPLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLS 474
              GH        P+T G  LIE                                 ++LS
Sbjct: 183 TLFGHTA------PIT-GCGLIERGR------------------------------NVLS 205

Query: 475 CSLDNTIKLWNVKTGACIR 493
            S D +++LW   +G+ +R
Sbjct: 206 SSKDGSVRLWECGSGSMLR 224

 Score = 32.7 bits (73), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 23/102 (22%), Positives = 47/102 (46%), Gaps = 8/102 (7%)

Query: 293 RRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFR- 349
           R L GH+  + +L +    + L++ S+D  +++W+   G    T  GH   +        
Sbjct: 140 RSLDGHSGHITSLHYFPSGKVLLSASIDMQLKIWSAADGTNPRTLFGHTAPITGCGLIER 199

Query: 350 -KLIVSGSADKTVKVWHVES----RTCYTLRGHTGWVNCVKL 386
            + ++S S D +V++W   S    R  +    H+  VN +++
Sbjct: 200 GRNVLSSSKDGSVRLWECGSGSMLRAFHRRDRHSDGVNALQV 241

>CAGL0C01441g complement(156930..159947) similar to tr|Q08924
           Saccharomyces cerevisiae YPL183c, start by similarity
          Length = 1005

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 72/157 (45%), Gaps = 18/157 (11%)

Query: 281 VAIWDLATGKLI--RRLSG-----HTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVS 333
           V I DL TGK++  ++L G     ++  +K +   + ++  G++     VW+      + 
Sbjct: 115 VLITDL-TGKVVEEKKLVGERSILYSGSIKVISESEVQINAGTVMGGAIVWDLYKEELIH 173

Query: 334 TYRGHQDSVLSVDS--FRKLIVSGSADKTVKVWHVESRTCYTLR-GHTGWVNCVKLHPKS 390
              GH+ S+  + S    KLI S S D+++++W  E+    ++   HT  +  +K     
Sbjct: 174 NLTGHEGSIFYIQSSEHNKLIASCSDDRSIRLWDRETGKELSIGWSHTARIWNLKFFNND 233

Query: 391 FTCFSGSDDMTIRMWDIRTN-------TCVRVFHGHV 420
               S S+D T R+W+I  N           +F GH+
Sbjct: 234 ENLVSVSEDCTCRVWNIIPNDISGYELQISNIFEGHL 270

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNF--RIVSGSHDRSCKVWDL 526
           + SCS D +I+LW+ +TG  +   + H   +W++   N    +VS S D +C+VW++
Sbjct: 194 IASCSDDRSIRLWDRETGKELSIGWSHTARIWNLKFFNNDENLVSVSEDCTCRVWNI 250

 Score = 34.3 bits (77), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 278 DSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYV 327
           D ++ +WD  TGK +     HT  +  L+F  +D+ L++ S D T RVWN +
Sbjct: 200 DRSIRLWDRETGKELSIGWSHTARIWNLKFFNNDENLVSVSEDCTCRVWNII 251

 Score = 29.6 bits (65), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 483 LWNVKTGACIRTQFGHVEGVWDIAAD--NFRIVSGSHDRSCKVWDLQTGK 530
           +W++     I    GH   ++ I +   N  I S S DRS ++WD +TGK
Sbjct: 163 VWDLYKEELIHNLTGHEGSIFYIQSSEHNKLIASCSDDRSIRLWDRETGK 212

>Kwal_27.12586
          Length = 509

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 61/156 (39%), Gaps = 12/156 (7%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGAC 331
           TG     + +W     KL      H   +  +++  D    +T  +D    VWN  TG  
Sbjct: 223 TGVESGEIRLW-THDAKLQNAFDFHKSSIVTIKWNSDATHFLTYDVDNVAIVWNAQTGTA 281

Query: 332 VSTY----RGHQDSVLSVDSF----RKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNC 383
           +  +     G  DS L VD+      K ++ G           ESR    L GH+  +  
Sbjct: 282 LQQFSFRENGTVDS-LGVDASWIGPDKFVIPGPQGSIYICGMGESRPLGKLNGHSATITA 340

Query: 384 VKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGH 419
              + ++    SGSDD T+R+W   + +    F G+
Sbjct: 341 FDFNSENNMLLSGSDDKTLRVWRSGSLSSSNCFMGN 376

 Score = 36.2 bits (82), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 46/97 (47%), Gaps = 3/97 (3%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGV-KALRFDDQKLITGSLDKTIRVWNYVTGA-- 330
           +GS D T+ +W   +        G+T G+  A   DD K+I  SLD ++R+W+++T    
Sbjct: 352 SGSDDKTLRVWRSGSLSSSNCFMGNTLGITSAFWIDDDKVIATSLDGSVRLWSHLTNTLQ 411

Query: 331 CVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVE 367
            +S   G      S+   +     G  D  V V+++E
Sbjct: 412 AISMVDGVPIFCGSLSPDKLKFAIGKMDGEVTVYNIE 448

>ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH]
           complement(387122..388393) [1272 bp, 423 aa]
          Length = 423

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 67/152 (44%), Gaps = 26/152 (17%)

Query: 274 TGSYDSTVAIWDLATGKLIRR-LSGHTDGVKALR---FDDQKLITGSLDKTIRVWN---- 325
           +GS D+TVA+WD+   K  +  L+ H D V  ++   F+     T S DKT++V +    
Sbjct: 204 SGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVR 263

Query: 326 ------YVTGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVE--SRTCYTLRGH 377
                   T +  +T    + S       R L+ +   D  + ++ +   S   + + GH
Sbjct: 264 LEPVKKLPTASPFNTLSFSKHS-------RNLLAAAGVDSQIYLYDMRDMSSPLHVMSGH 316

Query: 378 TGWVNCVKLHPKS--FTCFSGSDDMTIRMWDI 407
              V  V+  P +    C SGSD   I +WD+
Sbjct: 317 QDSVTTVEFSPHTDGIICSSGSDRRAI-IWDL 347

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 3/60 (5%)

Query: 352 IVSGSADKTVKVWHVES--RTCYTLRGHTGWVNCVKLHPKSFTCF-SGSDDMTIRMWDIR 408
           ++SGS D TV +W +E+  +    L  H   VN VK H      F + S+D T+++ D R
Sbjct: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261

>Sklu_1870.2 YLR055C, Contig c1870 1126-2835 reverse complement
          Length = 569

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 39/76 (51%), Gaps = 3/76 (3%)

Query: 289 GKLIRRLSGHTDGVKALRFDDQ--KLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVD 346
           G +    S HT  V  LR +D+  K I+G  DK I  W+  TG CV+ ++G    + S++
Sbjct: 266 GSISHYFSKHTSVVNQLRLNDKEDKFISGGWDKQILEWDLNTGDCVNEFKGSVAQLSSLE 325

Query: 347 SFRKLIVSGSADKTVK 362
            FR L  +   D  V+
Sbjct: 326 -FRPLFSTVDIDSLVE 340

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 29/62 (46%)

Query: 365 HVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQ 424
           ++E    +    HT  VN ++L+ K     SG  D  I  WD+ T  CV  F G V Q+ 
Sbjct: 263 YMEGSISHYFSKHTSVVNQLRLNDKEDKFISGGWDKQILEWDLNTGDCVNEFKGSVAQLS 322

Query: 425 KV 426
            +
Sbjct: 323 SL 324

 Score = 30.0 bits (66), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 20/35 (57%)

Query: 511 RIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACV 545
           + +SG  D+    WDL TG C++ F G  A ++ +
Sbjct: 290 KFISGGWDKQILEWDLNTGDCVNEFKGSVAQLSSL 324

>YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protein
           containing five WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           low similarity to a region of S. pombe Tup11p, which is
           a transcriptional repressor functioning redundantly with
           Tup12p [3042 bp, 1013 aa]
          Length = 1013

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 38/58 (65%), Gaps = 2/58 (3%)

Query: 471 HLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAA--DNFRIVSGSHDRSCKVWDL 526
           ++ SCS D +I+LW+++TG  +   + H   +W++    ++ +++S S D +C+VW++
Sbjct: 193 YVASCSDDRSIRLWDLETGKQLSVGWSHTARIWNLMFFDNDSKLISVSEDCTCRVWNI 250

 Score = 37.0 bits (84), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 276 SYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYV 327
           S D ++ +WDL TGK +     HT  +  L F  +D KLI+ S D T RVWN +
Sbjct: 198 SDDRSIRLWDLETGKQLSVGWSHTARIWNLMFFDNDSKLISVSEDCTCRVWNII 251

 Score = 36.6 bits (83), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 1/84 (1%)

Query: 354 SGSADKTVKVWHVESRT-CYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTC 412
           +G+    V +W + S T  + L GH G +  V L        S SDD +IR+WD+ T   
Sbjct: 154 AGTVMGGVIIWDLFSETKIHNLLGHEGSIFYVNLSNNGRYVASCSDDRSIRLWDLETGKQ 213

Query: 413 VRVFHGHVGQVQKVIPLTLGSDLI 436
           + V   H  ++  ++     S LI
Sbjct: 214 LSVGWSHTARIWNLMFFDNDSKLI 237

 Score = 36.2 bits (82), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 47/95 (49%), Gaps = 7/95 (7%)

Query: 281 VAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSL--DKTIRVWNYVTGACVSTYRGH 338
           V IWDL +   I  L GH   +  +   +      S   D++IR+W+  TG  +S    H
Sbjct: 161 VIIWDLFSETKIHNLLGHEGSIFYVNLSNNGRYVASCSDDRSIRLWDLETGKQLSVGWSH 220

Query: 339 QD---SVLSVDSFRKLIVSGSADKTVKVWH-VESR 369
                +++  D+  KLI S S D T +VW+ +ESR
Sbjct: 221 TARIWNLMFFDNDSKLI-SVSEDCTCRVWNIIESR 254

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 481 IKLWNVKTGACIRTQFGHVEGVW--DIAADNFRIVSGSHDRSCKVWDLQTGK 530
           + +W++ +   I    GH   ++  +++ +   + S S DRS ++WDL+TGK
Sbjct: 161 VIIWDLFSETKIHNLLGHEGSIFYVNLSNNGRYVASCSDDRSIRLWDLETGK 212

>KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777.1
           Kluyveromyces lactis CRN1 homologue, start by similarity
          Length = 707

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 69/161 (42%), Gaps = 30/161 (18%)

Query: 274 TGSYDSTVAIWDLATG----------------KLIRRLSGHTDGVKALRFD---DQKLIT 314
           +GS D  + IW++                   K +R LSGH+  V  L F    +  L +
Sbjct: 111 SGSDDGKIGIWEIPEDYGLHEYVDEEGNPKDLKPVRMLSGHSRKVGHLLFHPLAENILAS 170

Query: 315 GSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFR---KLIVSGSADKTVKVWHVESRTC 371
            SLD T+++W+ ++   V     H D V S+ SF    K +V+ S DK ++VW V +   
Sbjct: 171 SSLDYTVKIWD-ISQEEVKFTLKHPDMVTSM-SFSYDGKHLVTVSRDKKLRVWDVRAEKI 228

Query: 372 YTL-RGHTGWVN-----CVKLHPKSFTCFSGSDDMTIRMWD 406
            +    H+G  N            + T FS   D  I +WD
Sbjct: 229 VSEGPAHSGAKNQRVVWLGDTDKVATTGFSRLSDRQIGVWD 269

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 66/165 (40%), Gaps = 30/165 (18%)

Query: 374 LRGHTGWVNCVKLHP-KSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLG 432
            RGHT  V      P       SGSDD  I +W+I  +  +  +    G  + + P+ + 
Sbjct: 89  FRGHTAQVLDTDFSPFNDHIVASGSDDGKIGIWEIPEDYGLHEYVDEEGNPKDLKPVRM- 147

Query: 433 SDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTH---LLSCSLDNTIKLWNVKTG 489
                                  S  +    H L +P     L S SLD T+K+W++ + 
Sbjct: 148 ----------------------LSGHSRKVGHLLFHPLAENILASSSLDYTVKIWDI-SQ 184

Query: 490 ACIRTQFGHVEGVWDI--AADNFRIVSGSHDRSCKVWDLQTGKCM 532
             ++    H + V  +  + D   +V+ S D+  +VWD++  K +
Sbjct: 185 EEVKFTLKHPDMVTSMSFSYDGKHLVTVSRDKKLRVWDVRAEKIV 229

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 54/142 (38%), Gaps = 22/142 (15%)

Query: 307 FDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKL--------------- 351
           F+D  + +GS D  I +W       +  Y   + +   +   R L               
Sbjct: 104 FNDHIVASGSDDGKIGIWEIPEDYGLHEYVDEEGNPKDLKPVRMLSGHSRKVGHLLFHPL 163

Query: 352 ----IVSGSADKTVKVWHV-ESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWD 406
               + S S D TVK+W + +    +TL+ H   V  +          + S D  +R+WD
Sbjct: 164 AENILASSSLDYTVKIWDISQEEVKFTLK-HPDMVTSMSFSYDGKHLVTVSRDKKLRVWD 222

Query: 407 IRTNTCVRVFHGHVG-QVQKVI 427
           +R    V     H G + Q+V+
Sbjct: 223 VRAEKIVSEGPAHSGAKNQRVV 244

>AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH]
           (409496..411169) [1674 bp, 557 aa]
          Length = 557

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 79/188 (42%), Gaps = 24/188 (12%)

Query: 236 RERFKVESNWRKGIYRIQEFKGHMDGVXXXXXXXXXXXTGSYDSTVAIWDLATGKLIRRL 295
           R +  + S W K    +   K   DG+           +G  D+TV IWD    + +   
Sbjct: 334 RVKDHIVSTWEKHTSEVCGIKFRQDGLQLA--------SGGNDNTVMIWDTRQDEPLWVK 385

Query: 296 SGHTDGVKALRF--DDQKLIT---GSLDKTIRVWNYVTGACV-STYRGHQDSVLS----- 344
             H   VKA+ +  D   L+    GSLD+ I  WN  TGA + S   G Q S L      
Sbjct: 386 RNHNAAVKAITWHPDVVNLLATGGGSLDRHIHFWNTTTGARIGSINTGSQVSSLHWGQSY 445

Query: 345 VDSF--RKLIVS-GSADKTVKVWHVES--RTCYTLRGHTGWVNCVKLHPKSFTCFSGSDD 399
            DS   R+++ + GS D ++ +++ +S  +     + H   +   +L P   T  +   D
Sbjct: 446 EDSHMNREIVATGGSPDNSISIYNYDSKVKVAEITQAHESRIVSSQLSPDGTTIATVGGD 505

Query: 400 MTIRMWDI 407
             ++ + +
Sbjct: 506 ENLKFYRV 513

 Score = 37.4 bits (85), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 34/156 (21%), Positives = 65/156 (41%), Gaps = 5/156 (3%)

Query: 276 SYDSTVAIWDLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGACVS 333
           + D ++ +W+  TG++       T+ + ++ +  DD  +  G  D    +W+  T + V 
Sbjct: 240 ALDQSIYLWNGETGEVSLLTEFETETITSVVWSNDDCHISIGKDDGNTEIWDVETMSHVR 299

Query: 334 TYRGHQD-SVLSVDSFRKLIVSGSADKTVKV--WHVESRTCYTLRGHTGWVNCVKLHPKS 390
           T R      + S D    ++  G+    ++V    V+     T   HT  V  +K     
Sbjct: 300 TMRSSLGVRICSQDWLDTVVCIGAKSGEIQVNDVRVKDHIVSTWEKHTSEVCGIKFRQDG 359

Query: 391 FTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKV 426
               SG +D T+ +WD R +  + V   H   V+ +
Sbjct: 360 LQLASGGNDNTVMIWDTRQDEPLWVKRNHNAAVKAI 395

 Score = 34.3 bits (77), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 48/99 (48%), Gaps = 14/99 (14%)

Query: 471 HLLSCSLDNTIKLWNVKTG-ACIRTQFGHVEGVWDI--AADNFRIVSGSHDRSCKVWDLQ 527
           ++L+ +LD +I LWN +TG   + T+F   E +  +  + D+  I  G  D + ++WD++
Sbjct: 235 NVLAIALDQSIYLWNGETGEVSLLTEF-ETETITSVVWSNDDCHISIGKDDGNTEIWDVE 293

Query: 528 TG---KCMHTFVGIHA-------PVACVGIGDSEFVSGD 556
           T    + M + +G+          V C+G    E    D
Sbjct: 294 TMSHVRTMRSSLGVRICSQDWLDTVVCIGAKSGEIQVND 332

>YMR092C (AIP1) [4050] chr13 complement(451631..453478) Actin
           interacting protein, contains eight WD (WD-40) repeats
           [1848 bp, 615 aa]
          Length = 615

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 60/141 (42%), Gaps = 19/141 (13%)

Query: 278 DSTVAIWDLATGKLIRRLSGHTDGVKALRF-----DDQKLITGSLDKTIRVWNYVTGACV 332
           D  ++ +D  +G+ ++ +    + V+   F     D QK  T   D TIRVW+  T  CV
Sbjct: 228 DRKISCFDGKSGEFLKYIEDDQEPVQGGIFALSWLDSQKFATVGADATIRVWDVTTSKCV 287

Query: 333 STYR-------GHQDSVLSVDSFRKLIVSGSADKTVKVWHV-ESRTCYTLRGHTGWVNCV 384
             +          Q  V++  + R  I+S S D T+  + +       T+ GH   +  +
Sbjct: 288 QKWTLDKQQLGNQQVGVVATGNGR--IISLSLDGTLNFYELGHDEVLKTISGHNKGITAL 345

Query: 385 KLHPKSFTCFSGSDDMTIRMW 405
            ++P      SGS D  I  W
Sbjct: 346 TVNP----LISGSYDGRIMEW 362

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 48/89 (53%), Gaps = 8/89 (8%)

Query: 276 SYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTY 335
           S D T+  ++L   ++++ +SGH  G+ AL  +   LI+GS D  I  W     +  S +
Sbjct: 316 SLDGTLNFYELGHDEVLKTISGHNKGITALTVN--PLISGSYDGRIMEW-----SSSSMH 368

Query: 336 RGHQDSVLSVDSFRKLIVSG-SADKTVKV 363
           + H + ++S+D+ +    S  S D T+KV
Sbjct: 369 QDHSNLIVSLDNSKAQEYSSISWDDTLKV 397

 Score = 32.7 bits (73), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 274 TGSYDSTVAIWDLATG-KLIRRLSGHTDGVKALRFDD-QKLITGSLDKTIRVWNYV 327
           TGS D+ + I+ +    K+I+ L+ H DGV  L ++    L++   D  I+ WN V
Sbjct: 558 TGSLDTNIFIYSVKRPMKIIKALNAHKDGVNNLLWETPSTLVSSGADACIKRWNVV 613

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 39/87 (44%), Gaps = 7/87 (8%)

Query: 457 VQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACI------RTQFGHVEGVWDIAADNF 510
           VQ   F  S        +   D TI++W+V T  C+      + Q G+ + V  +A  N 
Sbjct: 252 VQGGIFALSWLDSQKFATVGADATIRVWDVTTSKCVQKWTLDKQQLGN-QQVGVVATGNG 310

Query: 511 RIVSGSHDRSCKVWDLQTGKCMHTFVG 537
           RI+S S D +   ++L   + + T  G
Sbjct: 311 RIISLSLDGTLNFYELGHDEVLKTISG 337

>YLR409C (UTP21) [3786] chr12 complement(934411..937230) Member of
           the Utp21-specific WD40 associated domain containing
           family, contains seven WD domains (WD-40 repeat), which
           may mediate protein-protein interactions, has high
           similarity to uncharacterized C. albicans Orf6.6423p
           [2820 bp, 939 aa]
          Length = 939

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/153 (20%), Positives = 64/153 (41%), Gaps = 24/153 (15%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFD--DQKLITGSLDKTIRVWNYVTG--- 329
           GS + ++ I+++ +G L ++   H   V  +  D  ++K+++  LD  +  +++      
Sbjct: 478 GSSNGSITIYNMQSGILRKKYKLHKRAVTGISLDGMNRKMVSCGLDGIVGFYDFNKSTLL 537

Query: 330 ------ACVSTYRGHQDS---VLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGW 380
                 A ++    H+ S    L++D    +++            V  R    L GH+  
Sbjct: 538 GKLKLDAPITAMVYHRSSDLFALALDDLSIVVIDA----------VTQRVVRQLWGHSNR 587

Query: 381 VNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCV 413
           +      P+     S S D TIR WD+ T  C+
Sbjct: 588 ITAFDFSPEGRWIVSASLDSTIRTWDLPTGGCI 620

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 67/180 (37%), Gaps = 39/180 (21%)

Query: 315 GSLDKTIRVWNYVTGACVSTYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWHVESRTCY 372
           GS + +I ++N  +G     Y+ H+ +V  +S+D   + +VS   D  V  +     T  
Sbjct: 478 GSSNGSITIYNMQSGILRKKYKLHKRAVTGISLDGMNRKMVSCGLDGIVGFYDFNKSTLL 537

Query: 373 TLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLG 432
                   +  +  H  S       DD++I + D  T   VR   GH  ++         
Sbjct: 538 GKLKLDAPITAMVYHRSSDLFALALDDLSIVVIDAVTQRVVRQLWGHSNRITA------- 590

Query: 433 SDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACI 492
                                        FD S P    ++S SLD+TI+ W++ TG CI
Sbjct: 591 -----------------------------FDFS-PEGRWIVSASLDSTIRTWDLPTGGCI 620

 Score = 33.9 bits (76), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 35/64 (54%), Gaps = 3/64 (4%)

Query: 472 LLSCSLDN-TIKLWNVKTGACIRTQFGHVEGV--WDIAADNFRIVSGSHDRSCKVWDLQT 528
           L + +LD+ +I + +  T   +R  +GH   +  +D + +   IVS S D + + WDL T
Sbjct: 557 LFALALDDLSIVVIDAVTQRVVRQLWGHSNRITAFDFSPEGRWIVSASLDSTIRTWDLPT 616

Query: 529 GKCM 532
           G C+
Sbjct: 617 GGCI 620

>CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces
           cerevisiae YGR200c subunit of elongating RNA polymerase
           II holoenzyme, start by similarity
          Length = 793

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 69/150 (46%), Gaps = 18/150 (12%)

Query: 286 LATGKLIR------RLSGHTDGVKALRFDDQK------LITGSLDKTIRVWNYVTGACVS 333
           L+ GK+I        L GH D VK+++F  Q+      L +GS D+ IR+W   T   + 
Sbjct: 185 LSEGKVIENFNLAAELEGHEDWVKSIQFRHQETPGDYLLCSGSQDRYIRIWRIRTNDLID 244

Query: 334 TYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTC 393
                 ++ L++ S ++     S D  + + + E+     + GH  WV+ ++ H      
Sbjct: 245 DSED-DETKLTLLSSKQHKFHISEDLRIGI-NFEA----LIIGHDDWVSSLQWHESKLQL 298

Query: 394 FSGSDDMTIRMWDIRTNTCVRVFHGHVGQV 423
            + + D  + +W+   ++ V V    +G++
Sbjct: 299 LASTADTAVMIWEPDESSGVWVCSSRLGEM 328

 Score = 37.4 bits (85), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 35/74 (47%), Gaps = 5/74 (6%)

Query: 339 QDSVLSVDSFRKLIVSGSADKTVKVWHVESRTC----YTLRGHTGWVNCVKLHPKSFTCF 394
           Q  V S +  R ++  G A K + +W+     C     TL+GH   V CVK  P +    
Sbjct: 16  QTQVCSYNKARNVLAFG-AGKNIALWNPLDADCRGIYATLKGHEAEVTCVKFMPGTDILV 74

Query: 395 SGSDDMTIRMWDIR 408
           S S+D  +++W  +
Sbjct: 75  SASEDHHVKLWKYK 88

 Score = 36.6 bits (83), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 42/208 (20%), Positives = 69/208 (33%), Gaps = 74/208 (35%)

Query: 280 TVAIW---DLATGKLIRRLSGHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGA---- 330
            +A+W   D     +   L GH   V  ++F      L++ S D  +++W Y        
Sbjct: 36  NIALWNPLDADCRGIYATLKGHEAEVTCVKFMPGTDILVSASEDHHVKLWKYKAPESEEL 95

Query: 331 -CVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESR-------------------T 370
            C+ T   +  +++S+++   LIV GSA   V +W  E+                     
Sbjct: 96  ECIQTITHYSHTIVSIETLAGLIVIGSAGGLVSIWVPETEGSDTYIISHEYSLPRNVFPL 155

Query: 371 CYTLRGHTG-----------------------------------------WVNCVKLH-- 387
           C++L    G                                         WV  ++    
Sbjct: 156 CFSLSNVVGNKYLLAIGGTTVKIFIYSFVLSEGKVIENFNLAAELEGHEDWVKSIQFRHQ 215

Query: 388 --PKSFTCFSGSDDMTIRMWDIRTNTCV 413
             P  +   SGS D  IR+W IRTN  +
Sbjct: 216 ETPGDYLLCSGSQDRYIRIWRIRTNDLI 243

>ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH]
           (1158218..1159258) [1041 bp, 346 aa]
          Length = 346

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 38/76 (50%), Gaps = 4/76 (5%)

Query: 295 LSGHTDGVKALRFDDQK--LITGSLDKTIRVWNYVTGACVSTYRGHQDSV--LSVDSFRK 350
           L GH   +  ++++ +   + T   D    VW  + G  + T  GH  S+  + VD   +
Sbjct: 6   LMGHERSLTQVKYNREGDLIFTSGKDNVASVWYAMNGERLGTLEGHNGSIWSIDVDQHTE 65

Query: 351 LIVSGSADKTVKVWHV 366
             V+GSAD +VKVW V
Sbjct: 66  YAVTGSADFSVKVWRV 81

 Score = 36.6 bits (83), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 2/65 (3%)

Query: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFR--IVSGSHDRSCKVWDLQTG 529
           + +   DN   +W    G  + T  GH   +W I  D      V+GS D S KVW ++ G
Sbjct: 25  IFTSGKDNVASVWYAMNGERLGTLEGHNGSIWSIDVDQHTEYAVTGSADFSVKVWRVRDG 84

Query: 530 KCMHT 534
              H+
Sbjct: 85  SIAHS 89

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 36/75 (48%), Gaps = 3/75 (4%)

Query: 337 GHQDSVLSVDSFRK--LIVSGSADKTVKVWH-VESRTCYTLRGHTGWVNCVKLHPKSFTC 393
           GH+ S+  V   R+  LI +   D    VW+ +      TL GH G +  + +   +   
Sbjct: 8   GHERSLTQVKYNREGDLIFTSGKDNVASVWYAMNGERLGTLEGHNGSIWSIDVDQHTEYA 67

Query: 394 FSGSDDMTIRMWDIR 408
            +GS D ++++W +R
Sbjct: 68  VTGSADFSVKVWRVR 82

 Score = 29.6 bits (65), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 15/59 (25%), Positives = 29/59 (49%), Gaps = 2/59 (3%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDD--QKLITGSLDKTIRVWNYVTGA 330
           T   D+  ++W    G+ +  L GH   + ++  D   +  +TGS D +++VW    G+
Sbjct: 27  TSGKDNVASVWYAMNGERLGTLEGHNGSIWSIDVDQHTEYAVTGSADFSVKVWRVRDGS 85

>CAGL0J04818g 455846..457810 highly similar to sp|Q06440
           Saccharomyces cerevisiae YLR429w CRN1, start by
           similarity
          Length = 654

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 67/165 (40%), Gaps = 31/165 (18%)

Query: 374 LRGHTGWVNCVKLHP-KSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLG 432
            RGHT  V      P       S SDD  I +WDI  +  + +  G   +++ + P    
Sbjct: 77  FRGHTAQVLDTDFDPFDDNRVASSSDDGKIGIWDIPQDYSI-LKSGDNEEIKDIEPTKF- 134

Query: 433 SDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTH---LLSCSLDNTIKLWNVKTG 489
                                  +  +    H L +PT    L S SLD T+++WNV+TG
Sbjct: 135 ----------------------LTGHSRKVGHILYHPTAKDVLASSSLDYTVRIWNVETG 172

Query: 490 ACIRTQFGHVEGVWDI--AADNFRIVSGSHDRSCKVWDLQTGKCM 532
             I  +  H + V  +  + D   + + + D+  +VW+++  K +
Sbjct: 173 EDIY-KLKHPDMVTSMSFSYDGTHLATVARDKKLRVWNVREEKVV 216

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 69/163 (42%), Gaps = 35/163 (21%)

Query: 274 TGSYDSTVAIWDLATGKLIRR---------------LSGHTDGVKALRFDDQK---LITG 315
           + S D  + IWD+     I +               L+GH+  V  + +       L + 
Sbjct: 99  SSSDDGKIGIWDIPQDYSILKSGDNEEIKDIEPTKFLTGHSRKVGHILYHPTAKDVLASS 158

Query: 316 SLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFR---KLIVSGSADKTVKVWHV-ESRTC 371
           SLD T+R+WN  TG  +   + H D V S+ SF      + + + DK ++VW+V E +  
Sbjct: 159 SLDYTVRIWNVETGEDIYKLK-HPDMVTSM-SFSYDGTHLATVARDKKLRVWNVREEKVV 216

Query: 372 YTLRGHTG-------WV-NCVKLHPKSFTCFSGSDDMTIRMWD 406
                H G       W+ N  +L   + T FS   D  I +WD
Sbjct: 217 SEGAAHAGAKNQRVVWLGNSERL---ATTGFSKLSDRQIGIWD 256

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 61/146 (41%), Gaps = 31/146 (21%)

Query: 307 FDDQKLITGSLDKTIRVWN-----------------------YVTGACVSTYRGHQDSVL 343
           FDD ++ + S D  I +W+                       ++TG   S   GH   +L
Sbjct: 92  FDDNRVASSSDDGKIGIWDIPQDYSILKSGDNEEIKDIEPTKFLTGH--SRKVGH---IL 146

Query: 344 SVDSFRKLIVSGSADKTVKVWHVES-RTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTI 402
              + + ++ S S D TV++W+VE+    Y L+ H   V  +          + + D  +
Sbjct: 147 YHPTAKDVLASSSLDYTVRIWNVETGEDIYKLK-HPDMVTSMSFSYDGTHLATVARDKKL 205

Query: 403 RMWDIRTNTCVRVFHGHVG-QVQKVI 427
           R+W++R    V     H G + Q+V+
Sbjct: 206 RVWNVREEKVVSEGAAHAGAKNQRVV 231

>Scas_659.9
          Length = 475

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 42/92 (45%), Gaps = 12/92 (13%)

Query: 297 GHTDGVKALRFDDQ---KLITGSLDKTIRVWNYVTGACVSTYRGHQDSV---------LS 344
           GH DGV  +  + +   KL TGS D  ++ WN  T   + +++ H   +         LS
Sbjct: 65  GHRDGVYVIAKNYKNLNKLATGSADGVVKYWNMSTREELCSFKAHYGLITGLCVTPEHLS 124

Query: 345 VDSFRKLIVSGSADKTVKVWHVESRTCYTLRG 376
                  ++S S DKTVK+W V S     L+ 
Sbjct: 125 KQKNENFMLSCSDDKTVKLWSVNSEDYANLKN 156

 Score = 36.2 bits (82), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 7/59 (11%)

Query: 311 KLITGSLDKTIRVWNYVTGACVSTYRGHQ-----DSVLSVDSFRKLIVSGSADKTVKVW 364
           +++TGS DKTIR++N   G     Y   +         S+D+  K IVSGS D  V++W
Sbjct: 313 EIVTGSYDKTIRIFNTTHGHSREIYHTKRMQHVFQVKFSMDA--KYIVSGSDDGNVRLW 369

 Score = 36.2 bits (82), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 44/84 (52%), Gaps = 11/84 (13%)

Query: 337 GHQDSVLSV-DSFRKL--IVSGSADKTVKVWHVESRTCY-TLRGHTGWVNCVKLHPKSFT 392
           GH+D V  +  +++ L  + +GSAD  VK W++ +R    + + H G +  + + P+  +
Sbjct: 65  GHRDGVYVIAKNYKNLNKLATGSADGVVKYWNMSTREELCSFKAHYGLITGLCVTPEHLS 124

Query: 393 -------CFSGSDDMTIRMWDIRT 409
                    S SDD T+++W + +
Sbjct: 125 KQKNENFMLSCSDDKTVKLWSVNS 148

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 41/81 (50%), Gaps = 8/81 (9%)

Query: 331 CVSTYRGHQDSVLSVDSFRKL---IVSGSADKTVKVW---HVESRTCYTLRGHTGWVNCV 384
            ++ ++ H  +V+ VD F      IV+GS DKT++++   H  SR  Y  +     V  V
Sbjct: 291 ALNVFKDHVSAVMDVD-FSPTGDEIVTGSYDKTIRIFNTTHGHSREIYHTK-RMQHVFQV 348

Query: 385 KLHPKSFTCFSGSDDMTIRMW 405
           K    +    SGSDD  +R+W
Sbjct: 349 KFSMDAKYIVSGSDDGNVRLW 369

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 32/157 (20%), Positives = 62/157 (39%), Gaps = 11/157 (7%)

Query: 279 STVAIWDLATGKLIRRLSGHTDGVKALRFDDQK---LITGSLDKTIRVW----NYVTGAC 331
           + + +WD    K +  LS   D +  ++F+  +   L +   D ++ ++    N  T   
Sbjct: 193 AKIQLWDSNRSKPLTDLSWGADNISTVKFNQNETDILASAGSDNSLVLYDLRTNSPTQKI 252

Query: 332 VSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSF 391
           V T R +      +++F  ++ +   +         SR     + H   V  V   P   
Sbjct: 253 VQTMRTNAICWNPMEAFNFVVANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTGD 312

Query: 392 TCFSGSDDMTIRMWDIRTNTCVRVFHG----HVGQVQ 424
              +GS D TIR+++        ++H     HV QV+
Sbjct: 313 EIVTGSYDKTIRIFNTTHGHSREIYHTKRMQHVFQVK 349

>Sklu_2435.13 YPR137W, Contig c2435 18346-20073
          Length = 575

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 46/223 (20%), Positives = 76/223 (34%), Gaps = 48/223 (21%)

Query: 304 ALRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVD--SFRKLIVSGSADKTV 361
           A R +  +L     D  +R +     + +    GHQD V+ +   S  + +  GS D+T 
Sbjct: 289 AFRKNSDQLFASCADYKVRTYAINQFSQLEVLYGHQDLVVDISALSMERCVTVGSRDRTA 348

Query: 362 KVWHVESRTCYTLRG-------------------HTGWVNCVKLH--PK-----SFTC-- 393
            +W +   T  T RG                     G +   K    PK     S  C  
Sbjct: 349 MLWKIADETRLTFRGGEDPERLLKRWLKQNSKELENGEIEPAKEEDAPKFYGEGSIDCVC 408

Query: 394 -------FSGSDDMTIRMWDIRTNTCV---RVFHGHVGQVQKVIPLTLGSDLIEXXXXXX 443
                   +GSD+  I +W +     +   RV HG       +IPL   + +        
Sbjct: 409 MVDDSHFITGSDNGNISLWSLSKKKPIFTQRVAHG-------IIPLPASTQISAEASEVT 461

Query: 444 XXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNV 486
                            +  H++PY    +S S + ++KLW +
Sbjct: 462 CQQQLQDKNLTHPYWITSL-HAIPYSNVFVSGSWNGSLKLWKI 503

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 48/110 (43%), Gaps = 5/110 (4%)

Query: 327 VTGACVSTYRGHQDSVLSVDSFR--KLIVSGSADKTVKVWHVESRTCYTL---RGHTGWV 381
            T    +T  GH D +L+V +    K +V+G  D+ + VW  ES +   +   +   G V
Sbjct: 226 TTNEYENTTEGHYDEILTVAASPDGKYVVTGGRDRKLIVWSTESLSPVKVIPTKDRRGEV 285

Query: 382 NCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTL 431
             +     S   F+   D  +R + I   + + V +GH   V  +  L++
Sbjct: 286 LSLAFRKNSDQLFASCADYKVRTYAINQFSQLEVLYGHQDLVVDISALSM 335

>CAGL0K05599g 544932..547064 similar to tr|Q08496 Saccharomyces
           cerevisiae YOR080w, hypothetical start
          Length = 710

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 41/74 (55%), Gaps = 6/74 (8%)

Query: 101 SNDKLRKLM---LEGMLLKSCFPQLSFISTQLQKLIKIDFISALPEEVALKILGYLDCQS 157
           +N+K RKL+   LE + LK    Q    + +   + +IDFI  LP E+ LKIL  +  + 
Sbjct: 184 TNEKKRKLIDPILEQVQLKK---QKESDAEEYFNIKEIDFIEKLPIELTLKILRKIRPRQ 240

Query: 158 LCSAAAVCRRWQEL 171
           L     VCR+W+E+
Sbjct: 241 LAELMLVCRKWREV 254

>AFL007C [3186] [Homologous to ScYGL003C (CDH1) - SH]
           (424004..425659) [1656 bp, 551 aa]
          Length = 551

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 66/143 (46%), Gaps = 9/143 (6%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLIT-----GSLDKTIRVWNYVT 328
           +G  D+ V ++D  + K + + + H   VKA+ +   +  T     G+ D+ +++WN  +
Sbjct: 387 SGGNDNVVYVYDGPSKKPVLKFTEHNAAVKAMAWSPHRRATLATGGGTADRRLKIWNVNS 446

Query: 329 GACVSTY-RGHQ--DSVLSVDSFRKLIVSGSADKTVKVWHVES-RTCYTLRGHTGWVNCV 384
           G  ++    G Q  + V S ++   +   G +   + +W   +      L+GH+  V  +
Sbjct: 447 GVRLNDVDTGSQVCNMVWSKNTDEIVTSHGYSKFNLTLWDCPTLEPLAVLKGHSFRVLHL 506

Query: 385 KLHPKSFTCFSGSDDMTIRMWDI 407
            L     T  SG+ D T+R W +
Sbjct: 507 TLSTDGTTIVSGAGDETLRYWKL 529

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 59/144 (40%), Gaps = 13/144 (9%)

Query: 281 VAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNY-VTGACVSTYRGHQ 339
           V + D+   K IR LSGH D V  L ++   L +GS D  I   +  +      T   H 
Sbjct: 311 VELHDVVKQKCIRTLSGHLDRVACLSWNQHILSSGSKDHKILHRDVRMPEHYFETANTHS 370

Query: 340 DSVL----SVDSFRKLIVSGSADKTVKVWHVES-RTCYTLRGHTGWVNCVKLHP---KSF 391
             V     +VD  R  + SG  D  V V+   S +       H   V  +   P    + 
Sbjct: 371 QEVCGLKWNVDENR--LASGGNDNVVYVYDGPSKKPVLKFTEHNAAVKAMAWSPHRRATL 428

Query: 392 TCFSGSDDMTIRMWDIRTNTCVRV 415
               G+ D  +++W++  N+ VR+
Sbjct: 429 ATGGGTADRRLKIWNV--NSGVRL 450

>YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of
           the WD (WD-40) repeat family that binds to substrates
           (CLB2, CLB3, CDC5, HSL1) of the anaphase promoting
           complex (APC) and targets them for degradation [1701 bp,
           566 aa]
          Length = 566

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 60/143 (41%), Gaps = 7/143 (4%)

Query: 275 GSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNY-VTGACVS 333
           G  +  V I+D+   K IR LSGH D V  L +++  L +GS D  I   +  +      
Sbjct: 320 GQANGLVEIYDVMKRKCIRTLSGHIDRVACLSWNNHVLTSGSRDHRILHRDVRMPDPFFE 379

Query: 334 TYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWHVESRT-CYTLRGHTGWVNCVKLHPKS 390
           T   H   V  L  +     + SG  D  V V+   S++   T   H   V  +   P  
Sbjct: 380 TIESHTQEVCGLKWNVADNKLASGGNDNVVHVYEGTSKSPILTFDEHKAAVKAMAWSPHK 439

Query: 391 FTCFS---GSDDMTIRMWDIRTN 410
               +   G+ D  +++W++ T+
Sbjct: 440 RGVLATGGGTADRRLKIWNVNTS 462

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 63/143 (44%), Gaps = 9/143 (6%)

Query: 274 TGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDDQK---LITG--SLDKTIRVWNYVT 328
           +G  D+ V +++  +   I     H   VKA+ +   K   L TG  + D+ +++WN  T
Sbjct: 402 SGGNDNVVHVYEGTSKSPILTFDEHKAAVKAMAWSPHKRGVLATGGGTADRRLKIWNVNT 461

Query: 329 GACVSTY-RGHQ--DSVLSVDSFRKLIVSGSADKTVKVWHVESR-TCYTLRGHTGWVNCV 384
              +S    G Q  + V S ++   +   G +   + +W   S      L+GH+  V  +
Sbjct: 462 SIKMSDIDSGSQICNMVWSKNTNELVTSHGYSKYNLTLWDCNSMDPIAILKGHSFRVLHL 521

Query: 385 KLHPKSFTCFSGSDDMTIRMWDI 407
            L     T  SG+ D T+R W +
Sbjct: 522 TLSNDGTTVVSGAGDETLRYWKL 544

 Score = 32.7 bits (73), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 40/89 (44%), Gaps = 3/89 (3%)

Query: 470 THLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTG 529
           +HL     +  +++++V    CIRT  GH++ V  ++ +N  + SGS D      D++  
Sbjct: 315 SHLAVGQANGLVEIYDVMKRKCIRTLSGHIDRVACLSWNNHVLTSGSRDHRILHRDVRMP 374

Query: 530 KCMHTFVGIHAPVACV---GIGDSEFVSG 555
                 +  H    C     + D++  SG
Sbjct: 375 DPFFETIESHTQEVCGLKWNVADNKLASG 403

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/119 (21%), Positives = 51/119 (42%), Gaps = 6/119 (5%)

Query: 312 LITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRT- 370
           L  G  +  + +++ +   C+ T  GH D V  +     ++ SGS D   ++ H + R  
Sbjct: 317 LAVGQANGLVEIYDVMKRKCIRTLSGHIDRVACLSWNNHVLTSGSRDH--RILHRDVRMP 374

Query: 371 ---CYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKV 426
                T+  HT  V  +K +       SG +D  + +++  + + +  F  H   V+ +
Sbjct: 375 DPFFETIESHTQEVCGLKWNVADNKLASGGNDNVVHVYEGTSKSPILTFDEHKAAVKAM 433

>YKL018W (SWD2) [3238] chr11 (403745..404734) Component of SET1 and
           COMPASS complex and pre-mRNA cleavage factor II complex
           [990 bp, 329 aa]
          Length = 329

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 57/115 (49%), Gaps = 9/115 (7%)

Query: 302 VKALRFDD--QKLITGSLDKTIRVWNYVTGACVSTYRGHQ---DSVLSVDSFRKLIVSGS 356
           V +L FDD  Q L+T S + T+++++      + T    +    S +   +  + I S S
Sbjct: 30  VTSLNFDDNGQFLLTSSSNDTMQLYSATNCKFLDTIASKKYGCHSAIFTHAQNECIYS-S 88

Query: 357 ADKTVKVWHVESRTCYTLR---GHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIR 408
             K   + ++   T   LR   GH   VN +K++P + T  S S D ++R+WD++
Sbjct: 89  TMKNFDIKYLNLETNQYLRYFSGHGALVNDLKMNPVNDTFLSSSYDESVRLWDLK 143

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 481 IKLWNVKTGACIRTQFGHVEGVWDIAAD--NFRIVSGSHDRSCKVWDLQTGK 530
           IK  N++T   +R   GH   V D+  +  N   +S S+D S ++WDL+  K
Sbjct: 95  IKYLNLETNQYLRYFSGHGALVNDLKMNPVNDTFLSSSYDESVRLWDLKISK 146

>KLLA0F15598g 1439610..1441046 highly similar to sp|P33750
           Saccharomyces cerevisiae YLL011w SOF1 involved in 18S
           pre-rRNA production singleton, start by similarity
          Length = 478

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 65/156 (41%), Gaps = 13/156 (8%)

Query: 281 VAIWDLATGKLIRRLSGHTDGVKALRFDDQKL----ITGSLDKTIRVW----NYVTGACV 332
           + +WD    K I  LS   D +  +RF+  ++     TGS D ++ ++    N  T   V
Sbjct: 194 IELWDTNRSKPISNLSWGADNINHVRFNQNEVDILASTGS-DNSVVLYDLRTNSPTQKIV 252

Query: 333 STYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFT 392
            T R +      V++F  +I +   +         S+  +  + H   V  V   P    
Sbjct: 253 QTMRTNSICWNPVEAFNFVIANEDHNAYYYDMRNMSKALHVFKDHVSAVMDVDFSPTGDE 312

Query: 393 CFSGSDDMTIRMWDIRTNTCVRVFHG----HVGQVQ 424
             +GS D TIR++ ++      ++H     H+ QV+
Sbjct: 313 VVTGSYDKTIRIYQVKHGHSREIYHTKRMQHIFQVK 348

 Score = 37.0 bits (84), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 70/146 (47%), Gaps = 22/146 (15%)

Query: 274 TGSYDSTVAIWDLATG----KLIRRLSGHT---DGVKALRFDDQKLITGSLDKTIRVWNY 326
           TGS D++V ++DL T     K+++ +  ++   + V+A  F     +  + D     ++ 
Sbjct: 231 TGS-DNSVVLYDLRTNSPTQKIVQTMRTNSICWNPVEAFNF-----VIANEDHNAYYYDM 284

Query: 327 VT-GACVSTYRGHQDSVLSVDSFRKL---IVSGSADKTVKVWHVE---SRTCYTLRGHTG 379
                 +  ++ H  +V+ VD F      +V+GS DKT++++ V+   SR  Y  +    
Sbjct: 285 RNMSKALHVFKDHVSAVMDVD-FSPTGDEVVTGSYDKTIRIYQVKHGHSREIYHTK-RMQ 342

Query: 380 WVNCVKLHPKSFTCFSGSDDMTIRMW 405
            +  VK    S    SGSDD  +R+W
Sbjct: 343 HIFQVKYTMDSKYIVSGSDDGNVRLW 368

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 37/83 (44%), Gaps = 11/83 (13%)

Query: 297 GHTDGVKALRFDDQ---KLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSV-------- 345
           GH DGV  +  +     KL T S D  I+ WN  T   +S+++ H   V  +        
Sbjct: 65  GHRDGVYTIAKNYNVLNKLATASGDGVIKYWNMSTREELSSFKAHYGMVTGLCVTPSYLS 124

Query: 346 DSFRKLIVSGSADKTVKVWHVES 368
                 ++S   DKTVK+W V S
Sbjct: 125 PQRENFMLSCGDDKTVKLWSVNS 147

 Score = 33.1 bits (74), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 7/63 (11%)

Query: 311 KLITGSLDKTIRVWNYVTGACVSTYRGHQDSVL-----SVDSFRKLIVSGSADKTVKVWH 365
           +++TGS DKTIR++    G     Y   +   +     ++DS  K IVSGS D  V++W 
Sbjct: 312 EVVTGSYDKTIRIYQVKHGHSREIYHTKRMQHIFQVKYTMDS--KYIVSGSDDGNVRLWR 369

Query: 366 VES 368
            ++
Sbjct: 370 AKA 372

>Kwal_14.1710
          Length = 574

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 69/152 (45%), Gaps = 20/152 (13%)

Query: 274 TGSYDSTVAIWDLATG--KLIRRLSGHTDGVKALRF--DDQKLIT---GSLDKTIRVWNY 326
           +GS D+TVAIWD  T   + I+R   HT  VKAL +  D   L+    G  DK I  WN 
Sbjct: 379 SGSNDNTVAIWDTRTSLPQHIKRQ--HTAAVKALAWSPDISNLLATGGGQTDKHIHFWNT 436

Query: 327 VTGACV-STYRGHQDSVL------SVDSFRKLIVS--GSADKTVKVWHVES--RTCYTLR 375
            TGA   S   G Q S L      + ++ ++ IV+  G  +  V +++ ++  +    + 
Sbjct: 437 TTGARTGSINTGSQVSSLHWGQSYNSNAIQREIVATGGIPENAVSIYNYDTKFKVAEIVH 496

Query: 376 GHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDI 407
            H   +   +L P      +   D  ++ + +
Sbjct: 497 AHEARICSSQLSPDGTVLATVGGDENLKFYKV 528

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 36/157 (22%), Positives = 68/157 (43%), Gaps = 6/157 (3%)

Query: 276 SYDSTVAIWDLATGKLIRRLSGHTDG-VKALRF--DDQKLITGSLDKTIRVWNYVTGACV 332
           + DS + +W+ A+G +   +     G + ++ +  DD  +  G ++    +W+  + + V
Sbjct: 254 ALDSALYLWNGASGDVSLLVDFEQPGAITSVTWSDDDCHISIGKVEGNTEIWDVDSMSHV 313

Query: 333 STYR-GHQDSVLSVDSFRKLIVSGSADKTVKVWHV--ESRTCYTLRGHTGWVNCVKLHPK 389
            T R G    + S      LI +GS    + +  V  ++    T   H G V  +   P 
Sbjct: 314 RTMRSGLGVRIGSQSWLETLIATGSKSGEIHINDVRIKNHIVSTWEEHKGEVCGIAYRPD 373

Query: 390 SFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKV 426
                SGS+D T+ +WD RT+    +   H   V+ +
Sbjct: 374 GLQLASGSNDNTVAIWDTRTSLPQHIKRQHTAAVKAL 410

>CAGL0D05588g 533235..534668 highly similar to sp|P33750
           Saccharomyces cerevisiae YLL011w SOF1, start by
           similarity
          Length = 477

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 46/85 (54%), Gaps = 15/85 (17%)

Query: 297 GHTDGVKAL--RFDD-QKLITGSLDKTIRVWNYVTGACVSTYRGHQDSV--------LSV 345
           GH DGV  L   ++D  K+ +GS D  I+ W+  +   +++++ H  ++        +++
Sbjct: 65  GHQDGVYVLAKHYNDLNKIASGSGDGVIKYWDMSSREQIASFKAHYGTITGLCITPKVNI 124

Query: 346 DSF----RKLIVSGSADKTVKVWHV 366
           DS     +  ++S S DKTVK+W V
Sbjct: 125 DSASSGNQNFVLSSSDDKTVKLWSV 149

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 40/86 (46%), Gaps = 16/86 (18%)

Query: 337 GHQDSVLSV-DSFRKL--IVSGSADKTVKVWHVESRT-CYTLRGHTGWVNCVKLHPK--- 389
           GHQD V  +   +  L  I SGS D  +K W + SR    + + H G +  + + PK   
Sbjct: 65  GHQDGVYVLAKHYNDLNKIASGSGDGVIKYWDMSSREQIASFKAHYGTITGLCITPKVNI 124

Query: 390 --------SFTCFSGSDDMTIRMWDI 407
                   +F   S SDD T+++W +
Sbjct: 125 DSASSGNQNF-VLSSSDDKTVKLWSV 149

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 31/144 (21%), Positives = 56/144 (38%), Gaps = 7/144 (4%)

Query: 281 VAIWDLATGKLIRRLSGHTDGVKALRF---DDQKLITGSLDKTIRVW----NYVTGACVS 333
           + +WD+   K +  LS   D +  ++F   D   L +   D +I ++    N  T   V 
Sbjct: 198 INLWDINRSKPLSDLSWGADNINTVKFNQNDANVLGSAGSDNSIVLYDLRTNSATQKIVQ 257

Query: 334 TYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTC 393
           T R +      +++F  ++ S   +         SR     + H   V  V + P     
Sbjct: 258 TMRVNSMCWNPMEAFNFVVASEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDISPTGEEV 317

Query: 394 FSGSDDMTIRMWDIRTNTCVRVFH 417
            + S D TIR++ I       ++H
Sbjct: 318 VTASYDKTIRIFPINKGHSREIYH 341

 Score = 33.9 bits (76), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 69/144 (47%), Gaps = 25/144 (17%)

Query: 278 DSTVAIWDL----ATGKLIRRLSGHT---DGVKALRFDDQKLITGSLDKTIRVWNYVTGA 330
           D+++ ++DL    AT K+++ +  ++   + ++A  F     +  S D     ++    +
Sbjct: 238 DNSIVLYDLRTNSATQKIVQTMRVNSMCWNPMEAFNF-----VVASEDHNAYYYDMRNMS 292

Query: 331 -CVSTYRGHQDSVLSVD--SFRKLIVSGSADKTVKVWHVE---SRTCYTLRGHTGWVNCV 384
             ++ ++ H  +V+ VD     + +V+ S DKT++++ +    SR  Y    HT  +  V
Sbjct: 293 RALNVFKDHVSAVMDVDISPTGEEVVTASYDKTIRIFPINKGHSREIY----HTKRMQHV 348

Query: 385 ---KLHPKSFTCFSGSDDMTIRMW 405
              K    S    SGSDD  +R+W
Sbjct: 349 FQAKFSMDSKYVMSGSDDGNVRLW 372

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 7/64 (10%)

Query: 310 QKLITGSLDKTIRVWNYVTGACVSTYRGHQ-----DSVLSVDSFRKLIVSGSADKTVKVW 364
           ++++T S DKTIR++    G     Y   +      +  S+DS  K ++SGS D  V++W
Sbjct: 315 EEVVTASYDKTIRIFPINKGHSREIYHTKRMQHVFQAKFSMDS--KYVMSGSDDGNVRLW 372

Query: 365 HVES 368
             ++
Sbjct: 373 RAKA 376

>AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH]
           complement(1061522..1063999) [2478 bp, 825 aa]
          Length = 825

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 48/110 (43%), Gaps = 19/110 (17%)

Query: 274 TGSYDSTVAIW---------------DLATGKLIRRLSGHTDGVKAL--RFDDQKLITGS 316
           +GS D  + IW               DL    + RRL  H + ++ +    D   L+T  
Sbjct: 94  SGSDDKILLIWEKEEGAVQPLFDMENDLEHWNVRRRLVAHDNDIQDICWAPDSSILVTVG 153

Query: 317 LDKTIRVWNYVTGACVSTYRGHQDSVLSV--DSFRKLIVSGSADKTVKVW 364
           LD++I VWN  T   +  +  HQ  V  V  D   K   + S D+TVKV+
Sbjct: 154 LDRSIIVWNGSTFEKIKRFDVHQSHVKGVVFDPANKYFATASDDRTVKVF 203

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 83/225 (36%), Gaps = 47/225 (20%)

Query: 308 DDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVE 367
           D Q++ TG LD  IR+W                SV  +  F K  VS  A +        
Sbjct: 28  DGQRVATGGLDGKIRIW----------------SVADILVFAKPKVSWPARE-----EQL 66

Query: 368 SRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVI 427
            +    +  HTG V  +K  P +    SGSDD  + +W+              G VQ + 
Sbjct: 67  RKPLANMSRHTGSVTALKFSPDNKYLASGSDDKILLIWE-----------KEEGAVQPL- 114

Query: 428 PLTLGSDLIEXXXXXXXXXXXXXXXXXXSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVK 487
              + +DL                     +Q   +    P  + L++  LD +I +WN  
Sbjct: 115 -FDMENDL------EHWNVRRRLVAHDNDIQDICW---APDSSILVTVGLDRSIIVWNGS 164

Query: 488 TGACIR---TQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTG 529
           T   I+       HV+GV    A+ +   + S DR+ KV+    G
Sbjct: 165 TFEKIKRFDVHQSHVKGVVFDPANKY-FATASDDRTVKVFRYHKG 208

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 63/174 (36%), Gaps = 44/174 (25%)

Query: 274 TGSYDSTVAIWDLAT------------------GKLIRRLSGHTDGVKALRF--DDQKLI 313
           TG  D  + IW +A                    K +  +S HT  V AL+F  D++ L 
Sbjct: 34  TGGLDGKIRIWSVADILVFAKPKVSWPAREEQLRKPLANMSRHTGSVTALKFSPDNKYLA 93

Query: 314 TGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYT 373
           +GS DK + +W    GA    +    D                    ++ W+V  R    
Sbjct: 94  SGSDDKILLIWEKEEGAVQPLFDMEND--------------------LEHWNVRRR---- 129

Query: 374 LRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVI 427
           L  H   +  +   P S    +   D +I +W+  T   ++ F  H   V+ V+
Sbjct: 130 LVAHDNDIQDICWAPDSSILVTVGLDRSIIVWNGSTFEKIKRFDVHQSHVKGVV 183

>KLLA0E20779g complement(1841092..1842207) similar to sp|P40066
           Saccharomyces cerevisiae YER107c GLE2 required for
           nuclear pore complex structure and function, start by
           similarity
          Length = 371

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 50/102 (49%), Gaps = 10/102 (9%)

Query: 276 SYDSTVAIWDLATGKLIRRLS-GHTDGVKALRF--DDQKLITGSLDKTIRVWNYVTGACV 332
           S+DS V IWD+ +G    R    H   V   R+  D  K+ +G  D  ++V++  TG   
Sbjct: 55  SWDSKVRIWDVQSGSPQGRAQYDHQAPVLTTRWSIDGTKVASGGCDNVLKVFDVTTGQAQ 114

Query: 333 STYRGHQDSVLSV------DSFRKLIVSGSADKTVKVWHVES 368
              + H  +V S+       + ++ I +GS DKTVK W + S
Sbjct: 115 QIGQ-HNSAVQSLRFVSCGPTNQECIATGSWDKTVKYWDLRS 155

 Score = 35.8 bits (81), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 60/137 (43%), Gaps = 16/137 (11%)

Query: 285 DLATGKLIRRLSGHTDGVKALRFDDQK---LITGSLDKTIRVWNYVTGACVSTYR-GHQD 340
           DLA   ++   +   D +  + F  Q        S D  +R+W+  +G+     +  HQ 
Sbjct: 23  DLANDIVLNNAA--EDSISDIAFSPQSDFMFSVSSWDSKVRIWDVQSGSPQGRAQYDHQA 80

Query: 341 SVL----SVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKL---HPKSFTC 393
            VL    S+D  +  + SG  D  +KV+ V +     +  H   V  ++     P +  C
Sbjct: 81  PVLTTRWSIDGTK--VASGGCDNVLKVFDVTTGQAQQIGQHNSAVQSLRFVSCGPTNQEC 138

Query: 394 F-SGSDDMTIRMWDIRT 409
             +GS D T++ WD+R+
Sbjct: 139 IATGSWDKTVKYWDLRS 155

 Score = 32.3 bits (72), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 37/69 (53%), Gaps = 9/69 (13%)

Query: 476 SLDNTIKLWNVKTGACI-RTQFGHVEGV----WDIAADNFRIVSGSHDRSCKVWDLQTGK 530
           S D+ +++W+V++G+   R Q+ H   V    W I  D  ++ SG  D   KV+D+ TG+
Sbjct: 55  SWDSKVRIWDVQSGSPQGRAQYDHQAPVLTTRWSI--DGTKVASGGCDNVLKVFDVTTGQ 112

Query: 531 CMHTFVGIH 539
                +G H
Sbjct: 113 AQQ--IGQH 119

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.135    0.433 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,656,128
Number of extensions: 637418
Number of successful extensions: 6165
Number of sequences better than 10.0: 392
Number of HSP's gapped: 4124
Number of HSP's successfully gapped: 1745
Length of query: 558
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 451
Effective length of database: 12,891,983
Effective search space: 5814284333
Effective search space used: 5814284333
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 64 (29.3 bits)