Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL081C29729215290.0
KLLA0F27489g29729211511e-160
YER055C (HIS1)29729211311e-157
Scas_715.4729729211291e-157
CAGL0L00759g30630110021e-137
Kwal_23.57792482429201e-126
Scas_519.143574700.67
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL081C
         (292 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL081C [1660] [Homologous to ScYER055C (HIS1) - SH] (540943..54...   593   0.0  
KLLA0F27489g 2544518..2545411 highly similar to sp|P00498 Saccha...   447   e-160
YER055C (HIS1) [1484] chr5 complement(264891..265784) ATP phosph...   440   e-157
Scas_715.47                                                           439   e-157
CAGL0L00759g 93848..94768 highly similar to sp|P00498 Saccharomy...   390   e-137
Kwal_23.5779                                                          358   e-126
Scas_519.1                                                             32   0.67 

>ADL081C [1660] [Homologous to ScYER055C (HIS1) - SH]
           (540943..541836) [894 bp, 297 aa]
          Length = 297

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/292 (100%), Positives = 292/292 (100%)

Query: 1   MDLVRQLNDRLLFAVPKKGRLYEKSVALLNGADILFHRSHRLDIALSTSTPVALIFLPAA 60
           MDLVRQLNDRLLFAVPKKGRLYEKSVALLNGADILFHRSHRLDIALSTSTPVALIFLPAA
Sbjct: 1   MDLVRQLNDRLLFAVPKKGRLYEKSVALLNGADILFHRSHRLDIALSTSTPVALIFLPAA 60

Query: 61  DIPTFVGEGRCDLGITGVDQVRESGVNVELLQDLDFGRCQLQVQVPAGGPYSQPEQLIGK 120
           DIPTFVGEGRCDLGITGVDQVRESGVNVELLQDLDFGRCQLQVQVPAGGPYSQPEQLIGK
Sbjct: 61  DIPTFVGEGRCDLGITGVDQVRESGVNVELLQDLDFGRCQLQVQVPAGGPYSQPEQLIGK 120

Query: 121 TIVTSFTRLAREYFARLEGVDEAAMTTRVKYVGGSVEAACALGVADAIVDLVESGETMRA 180
           TIVTSFTRLAREYFARLEGVDEAAMTTRVKYVGGSVEAACALGVADAIVDLVESGETMRA
Sbjct: 121 TIVTSFTRLAREYFARLEGVDEAAMTTRVKYVGGSVEAACALGVADAIVDLVESGETMRA 180

Query: 181 AGLTPIGTVLSTSAHLICSPNPKSSLALLDTVRARIEGVLAAQHYVYCTYNAHADALPAL 240
           AGLTPIGTVLSTSAHLICSPNPKSSLALLDTVRARIEGVLAAQHYVYCTYNAHADALPAL
Sbjct: 181 AGLTPIGTVLSTSAHLICSPNPKSSLALLDTVRARIEGVLAAQHYVYCTYNAHADALPAL 240

Query: 241 LRITPGRRAPTISKLDDDNWYAVSSMIIRREKGRILDDLKASGAEDIMVFEI 292
           LRITPGRRAPTISKLDDDNWYAVSSMIIRREKGRILDDLKASGAEDIMVFEI
Sbjct: 241 LRITPGRRAPTISKLDDDNWYAVSSMIIRREKGRILDDLKASGAEDIMVFEI 292

>KLLA0F27489g 2544518..2545411 highly similar to sp|P00498
           Saccharomyces cerevisiae YER055c HIS1 ATP
           phosphoribosyltransferase singleton, start by similarity
          Length = 297

 Score =  447 bits (1151), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 216/292 (73%), Positives = 246/292 (84%)

Query: 1   MDLVRQLNDRLLFAVPKKGRLYEKSVALLNGADILFHRSHRLDIALSTSTPVALIFLPAA 60
           MDLV  LND+LLFA+PKKGRLYEKSV++L G+DI FHRS RLDIA+ST+ PVALIFLPAA
Sbjct: 1   MDLVNHLNDKLLFAIPKKGRLYEKSVSILKGSDIKFHRSARLDIAISTNMPVALIFLPAA 60

Query: 61  DIPTFVGEGRCDLGITGVDQVRESGVNVELLQDLDFGRCQLQVQVPAGGPYSQPEQLIGK 120
           DIP FVGEGRCDLGITGVDQVRES V+V L  DL FG C+LQVQVP  G Y+ PEQLIGK
Sbjct: 61  DIPMFVGEGRCDLGITGVDQVRESEVDVNLPIDLQFGTCKLQVQVPVAGEYTSPEQLIGK 120

Query: 121 TIVTSFTRLAREYFARLEGVDEAAMTTRVKYVGGSVEAACALGVADAIVDLVESGETMRA 180
           TIV+SF  L ++YFA+LEGV E+ M TRVKYVGGSVEA+CALGVADAIVDLVESGETMRA
Sbjct: 121 TIVSSFVNLTKKYFAQLEGVPESEMVTRVKYVGGSVEASCALGVADAIVDLVESGETMRA 180

Query: 181 AGLTPIGTVLSTSAHLICSPNPKSSLALLDTVRARIEGVLAAQHYVYCTYNAHADALPAL 240
           AGLT I TVL TSAHLI S NPK  + LL T+++RIEGV+ AQ YV C+YNA  + LP L
Sbjct: 181 AGLTAIATVLDTSAHLIESKNPKGDVELLRTIKSRIEGVMTAQKYVSCSYNAPENKLPEL 240

Query: 241 LRITPGRRAPTISKLDDDNWYAVSSMIIRREKGRILDDLKASGAEDIMVFEI 292
           L+ITPGRRAPTIS+++D  W AVSSMI R+ KG I+DDLK +GAEDIMVFEI
Sbjct: 241 LKITPGRRAPTISQINDSGWVAVSSMIERKNKGDIMDDLKKNGAEDIMVFEI 292

>YER055C (HIS1) [1484] chr5 complement(264891..265784) ATP
           phosphoribosyltransferase, first step in histidine
           biosynthesis pathway [894 bp, 297 aa]
          Length = 297

 Score =  440 bits (1131), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 212/292 (72%), Positives = 242/292 (82%)

Query: 1   MDLVRQLNDRLLFAVPKKGRLYEKSVALLNGADILFHRSHRLDIALSTSTPVALIFLPAA 60
           MDLV  L DRLLFA+PKKGRLY KSV++LNGADI FHRS RLDIALSTS PVAL+FLPAA
Sbjct: 1   MDLVNHLTDRLLFAIPKKGRLYSKSVSILNGADITFHRSQRLDIALSTSLPVALVFLPAA 60

Query: 61  DIPTFVGEGRCDLGITGVDQVRESGVNVELLQDLDFGRCQLQVQVPAGGPYSQPEQLIGK 120
           DIPTFVGEG+CDLGITGVDQVRES V+V+L  DL FG C+LQVQVP  G Y +PEQLIGK
Sbjct: 61  DIPTFVGEGKCDLGITGVDQVRESNVDVDLAIDLQFGNCKLQVQVPVNGEYKKPEQLIGK 120

Query: 121 TIVTSFTRLAREYFARLEGVDEAAMTTRVKYVGGSVEAACALGVADAIVDLVESGETMRA 180
           TIVTSF +LA +YFA LEG     MTTR+K+V GSVEA+CALG+ DAIVDLVESGETMRA
Sbjct: 121 TIVTSFVKLAEKYFADLEGTTVEKMTTRIKFVSGSVEASCALGIGDAIVDLVESGETMRA 180

Query: 181 AGLTPIGTVLSTSAHLICSPNPKSSLALLDTVRARIEGVLAAQHYVYCTYNAHADALPAL 240
           AGL  I TVLSTSA+LI S NPKS  +L+ T+++RIEGV+ AQ +V C YNA  D LP L
Sbjct: 181 AGLVDIATVLSTSAYLIESKNPKSDKSLIATIKSRIEGVMTAQRFVSCIYNAPEDKLPEL 240

Query: 241 LRITPGRRAPTISKLDDDNWYAVSSMIIRREKGRILDDLKASGAEDIMVFEI 292
           L++TPGRRAPTISK+DD+ W AVSSMI R+ KG +LD+LK  GA DIMVFEI
Sbjct: 241 LKVTPGRRAPTISKIDDEGWVAVSSMIERKTKGVVLDELKRLGASDIMVFEI 292

>Scas_715.47
          Length = 297

 Score =  439 bits (1129), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 212/292 (72%), Positives = 241/292 (82%)

Query: 1   MDLVRQLNDRLLFAVPKKGRLYEKSVALLNGADILFHRSHRLDIALSTSTPVALIFLPAA 60
           MDLV  LNDRLLFA+PKKGRLYEKSV +LNG+DI FHRS RLDIAL T+ P+ALIFLPAA
Sbjct: 1   MDLVNHLNDRLLFAIPKKGRLYEKSVTILNGSDIKFHRSQRLDIALCTTLPIALIFLPAA 60

Query: 61  DIPTFVGEGRCDLGITGVDQVRESGVNVELLQDLDFGRCQLQVQVPAGGPYSQPEQLIGK 120
           DIP FVGEGRCDLGITGVDQVRE+ ++V+L  DL FG C+LQVQVP  GPY++PEQLIGK
Sbjct: 61  DIPMFVGEGRCDLGITGVDQVREAKMDVDLPIDLKFGSCKLQVQVPVNGPYTKPEQLIGK 120

Query: 121 TIVTSFTRLAREYFARLEGVDEAAMTTRVKYVGGSVEAACALGVADAIVDLVESGETMRA 180
           TIV+SFT L  EYFA+LEGV    MTT+VKYVGGSVEA+CALGVADAIVDLVESGETMRA
Sbjct: 121 TIVSSFTNLTEEYFAKLEGVPAEKMTTKVKYVGGSVEASCALGVADAIVDLVESGETMRA 180

Query: 181 AGLTPIGTVLSTSAHLICSPNPKSSLALLDTVRARIEGVLAAQHYVYCTYNAHADALPAL 240
           AGL  I TVL TSAH+I S NP+S   L++T+++RIEGV+ AQ YV C YNA  D L  L
Sbjct: 181 AGLIDIATVLETSAHVIESKNPRSDKDLIETIKSRIEGVITAQRYVCCNYNAPEDKLSQL 240

Query: 241 LRITPGRRAPTISKLDDDNWYAVSSMIIRREKGRILDDLKASGAEDIMVFEI 292
           L ITPGRR PTISK+D D W AV+SMI R +KG I+D+LK  GA DIMVFEI
Sbjct: 241 LTITPGRRGPTISKIDSDGWVAVNSMIERSKKGEIMDELKKKGAADIMVFEI 292

>CAGL0L00759g 93848..94768 highly similar to sp|P00498 Saccharomyces
           cerevisiae YER055c HIS1, start by similarity
          Length = 306

 Score =  390 bits (1002), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 196/301 (65%), Positives = 237/301 (78%), Gaps = 9/301 (2%)

Query: 1   MDLVRQLNDRLLFAVPKKGRLYEKSVALLNGADILFHRSHRLDIALSTSTPVALIFLPAA 60
           MD V  LNDRLLFAVPKKGRLYEK+  LLNG+DI F+RS+RLDIAL T+ P+ALIFLPAA
Sbjct: 1   MDFVNHLNDRLLFAVPKKGRLYEKTKQLLNGSDIKFNRSNRLDIALCTTLPIALIFLPAA 60

Query: 61  DIPTFVGEGRCDLGITGVDQVRESGV-NVELLQDLDFGRCQLQVQVPAGG-PYSQPEQLI 118
           DIPTFVGEG+CDLGITG+DQV+ESG+  ++LL DL FG C+LQVQVP     Y+ P+QL+
Sbjct: 61  DIPTFVGEGKCDLGITGLDQVKESGIEEIDLLMDLGFGGCKLQVQVPEKDRKYTDPKQLV 120

Query: 119 GKTIVTSFTRLAREYFARLE----GVDEAAMTTRVKYVGGSVEAACALGVADAIVDLVES 174
           GKTIV+SF +L+R+YF +LE    G     ++T++KYVGGSVEA+CALGV DAIVDLVES
Sbjct: 121 GKTIVSSFVKLSRDYFQQLEEEVLGKPVDKLSTKIKYVGGSVEASCALGVGDAIVDLVES 180

Query: 175 GETMRAAGLTPIGTVLSTSAHLICSPNP---KSSLALLDTVRARIEGVLAAQHYVYCTYN 231
           GETMRAAGL  I TVL TSA+LI +  P   KS   L++ +++RI+GVL AQ YV C+YN
Sbjct: 181 GETMRAAGLIDIATVLETSAYLIQARRPQQDKSREELIEVIKSRIQGVLTAQRYVCCSYN 240

Query: 232 AHADALPALLRITPGRRAPTISKLDDDNWYAVSSMIIRREKGRILDDLKASGAEDIMVFE 291
                L  LL++TPGRRAPTISKLDDD W AV+SMI R+ K  I+D+LK  GA DIMVFE
Sbjct: 241 TPEGNLKELLKVTPGRRAPTISKLDDDGWVAVNSMIERKRKADIMDELKRKGASDIMVFE 300

Query: 292 I 292
           I
Sbjct: 301 I 301

>Kwal_23.5779
          Length = 248

 Score =  358 bits (920), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 171/242 (70%), Positives = 201/242 (83%)

Query: 51  PVALIFLPAADIPTFVGEGRCDLGITGVDQVRESGVNVELLQDLDFGRCQLQVQVPAGGP 110
           P+ALIFLPAADIP FVGEG+CDLGITGVDQV+ES V+V L  DL+FG C+LQVQVP  GP
Sbjct: 2   PIALIFLPAADIPMFVGEGKCDLGITGVDQVQESDVDVLLPMDLNFGSCKLQVQVPNAGP 61

Query: 111 YSQPEQLIGKTIVTSFTRLAREYFARLEGVDEAAMTTRVKYVGGSVEAACALGVADAIVD 170
           Y +PEQLIGKTIV+SFT L ++YFA+LEGV    +TT+++YVGGSVEA+CALG+ADAIVD
Sbjct: 62  YEKPEQLIGKTIVSSFTNLTKQYFAKLEGVPVEKITTKIRYVGGSVEASCALGIADAIVD 121

Query: 171 LVESGETMRAAGLTPIGTVLSTSAHLICSPNPKSSLALLDTVRARIEGVLAAQHYVYCTY 230
           LVESGETMRAAGL  I TVL TSAHLI S NPK    LL T+++RIEGV+ AQ YV C Y
Sbjct: 122 LVESGETMRAAGLKDIATVLETSAHLIESKNPKGDPELLQTIKSRIEGVMTAQKYVNCNY 181

Query: 231 NAHADALPALLRITPGRRAPTISKLDDDNWYAVSSMIIRREKGRILDDLKASGAEDIMVF 290
           NA   AL  +L+ITPGRRAPTISK+DD+ W AVS+MI R++KG I+DDLK +GA DIMVF
Sbjct: 182 NAPVTALEKVLKITPGRRAPTISKIDDEGWVAVSAMIDRKQKGTIMDDLKKNGAADIMVF 241

Query: 291 EI 292
           EI
Sbjct: 242 EI 243

>Scas_519.1
          Length = 435

 Score = 31.6 bits (70), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 17/74 (22%), Positives = 35/74 (47%)

Query: 219 VLAAQHYVYCTYNAHADALPALLRITPGRRAPTISKLDDDNWYAVSSMIIRREKGRILDD 278
           ++  Q + YC +     ++P+ +R+T  R    + KL  DN     +  I+  + +    
Sbjct: 167 IVYDQSFAYCLFGYQDSSVPSTIRLTYDRSDDNLLKLQVDNRVCFQTRKIQLPESKYKIG 226

Query: 279 LKASGAEDIMVFEI 292
           + A+  +D+  FEI
Sbjct: 227 VSATVGKDLESFEI 240

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.137    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,364,924
Number of extensions: 316350
Number of successful extensions: 743
Number of sequences better than 10.0: 8
Number of HSP's gapped: 739
Number of HSP's successfully gapped: 8
Length of query: 292
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 191
Effective length of database: 13,099,691
Effective search space: 2502040981
Effective search space used: 2502040981
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)