Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
ADL080W86382841000.0
YIL047C (SYG1)90288317600.0
Kwal_23.578585684217510.0
Scas_700.25*93190616480.0
CAGL0L00737g91188716240.0
Scas_704.3991679515800.0
KLLA0F27467g84485114350.0
AAR127C3811771852e-14
Kwal_47.187213832101702e-12
KLLA0A02057g3843181552e-10
Sklu_2440.133811741542e-10
YDR414C (ERD1)3621861462e-09
CAGL0F02871g3681811221e-06
Scas_570.83531861113e-05
CAGL0I05632g8862561034e-04
YNR013C (PHO91)89483990.001
KLLA0F06160g859169970.002
Kwal_23.612981680860.047
Scas_625.1693242850.064
ADR289C80743830.094
Kwal_33.1361889123731.6
CAGL0J00693g188465731.6
ADR177C839101721.8
ADL143W110283721.9
YFL004W (VTC2)82878712.5
KLLA0E12133g84183712.6
AFR628C86921703.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL080W
         (848 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL080W [1661] [Homologous to ScYIL047C (SYG1) - SH] complement(...  1583   0.0  
YIL047C (SYG1) [2620] chr9 complement(265114..267822) Protein fo...   682   0.0  
Kwal_23.5785                                                          679   0.0  
Scas_700.25*                                                          639   0.0  
CAGL0L00737g complement(90349..93084) similar to sp|P40528 Sacch...   630   0.0  
Scas_704.39                                                           613   0.0  
KLLA0F27467g complement(2541110..2543644) similar to sp|P40528 S...   557   0.0  
AAR127C [314] [Homologous to ScYDR414C (ERD1) - SH] (568957..570...    76   2e-14
Kwal_47.18721                                                          70   2e-12
KLLA0A02057g 186220..187374 gi|1169545|sp|P41771|ERD1_KLULA Kluy...    64   2e-10
Sklu_2440.13 YDR414C, Contig c2440 19959-21104 reverse complement      64   2e-10
YDR414C (ERD1) [1239] chr4 complement(1295586..1296674) Protein ...    61   2e-09
CAGL0F02871g complement(278122..279228) similar to sp|P16151 Sac...    52   1e-06
Scas_570.8                                                             47   3e-05
CAGL0I05632g 531308..533968 similar to sp|P27514 Saccharomyces c...    44   4e-04
YNR013C (PHO91) [4596] chr14 complement(649027..651711) Member o...    43   0.001
KLLA0F06160g 598549..601128 similar to sp|P27514 Saccharomyces c...    42   0.002
Kwal_23.6129                                                           38   0.047
Scas_625.16                                                            37   0.064
ADR289C [2030] [Homologous to ScYNR013C (PHO91) - SH] (1193040.....    37   0.094
Kwal_33.13618                                                          33   1.6  
CAGL0J00693g complement(61246..66900) similar to sp|P08964 Sacch...    33   1.6  
ADR177C [1918] [Homologous to ScYOR270C (VPH1) - SH] (1014058..1...    32   1.8  
ADL143W [1598] [Homologous to ScYGR233C (PHO81) - SH] complement...    32   1.9  
YFL004W (VTC2) [1677] chr6 (131805..134291) Subunit of the vacuo...    32   2.5  
KLLA0E12133g 1076424..1078949 similar to sp|P43585 Saccharomyces...    32   2.6  
AFR628C [3820] [Homologous to ScYJL198W (PHO90) - SH; ScYCR037C ...    32   3.3  

>ADL080W [1661] [Homologous to ScYIL047C (SYG1) - SH]
           complement(542124..544715) [2592 bp, 863 aa]
          Length = 863

 Score = 1583 bits (4100), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 765/828 (92%), Positives = 765/828 (92%)

Query: 1   MKFAERLRESSIPEWRDXXXXXXXXXXXXXXXXXXXXASRALSVRPTQRSRARDEPYTMQ 60
           MKFAERLRESSIPEWRD                    ASRALSVRPTQRSRARDEPYTMQ
Sbjct: 1   MKFAERLRESSIPEWRDKYLDYKLGKKKLKSYKEKLKASRALSVRPTQRSRARDEPYTMQ 60

Query: 61  QEDAVYEFVMGWVIGTELAKCDEFYQWQLDQCERKYQLLKQQIEMYCLQKDENGAGLSYG 120
           QEDAVYEFVMGWVIGTELAKCDEFYQWQLDQCERKYQLLKQQIEMYCLQKDENGAGLSYG
Sbjct: 61  QEDAVYEFVMGWVIGTELAKCDEFYQWQLDQCERKYQLLKQQIEMYCLQKDENGAGLSYG 120

Query: 121 ATYEGQEETGLAAQLSAGRSPSPSRAGRLDRAQEGVKRWLQERDLMPSLPARWSREQGPA 180
           ATYEGQEETGLAAQLSAGRSPSPSRAGRLDRAQEGVKRWLQERDLMPSLPARWSREQGPA
Sbjct: 121 ATYEGQEETGLAAQLSAGRSPSPSRAGRLDRAQEGVKRWLQERDLMPSLPARWSREQGPA 180

Query: 181 RVKKYSANTETFMHICPSKRQAQLQLGHAXXXXXXXXXXXKNYRDLNVTGFRKIVKKFDK 240
           RVKKYSANTETFMHICPSKRQAQLQLGHA           KNYRDLNVTGFRKIVKKFDK
Sbjct: 181 RVKKYSANTETFMHICPSKRQAQLQLGHALLEYYLTLQLLKNYRDLNVTGFRKIVKKFDK 240

Query: 241 TCDTEELSKFMSYANEHSPLFEHMGQNLRLYANSFKASNSLCQPAARMNSSPEKDPVTYW 300
           TCDTEELSKFMSYANEHSPLFEHMGQNLRLYANSFKASNSLCQPAARMNSSPEKDPVTYW
Sbjct: 241 TCDTEELSKFMSYANEHSPLFEHMGQNLRLYANSFKASNSLCQPAARMNSSPEKDPVTYW 300

Query: 301 EDQVFQWYTEALTESTQARKHHVQKLRSLSLQYSMNEQIVHRNNTCVVQMFTXXXXXXXX 360
           EDQVFQWYTEALTESTQARKHHVQKLRSLSLQYSMNEQIVHRNNTCVVQMFT        
Sbjct: 301 EDQVFQWYTEALTESTQARKHHVQKLRSLSLQYSMNEQIVHRNNTCVVQMFTAGSLLGVA 360

Query: 361 XXXXXXXXXXXXRADISSYRHLILFPVWGGWYLVLLMSLLFCLDCYIWFRGKVNYQFIMF 420
                       RADISSYRHLILFPVWGGWYLVLLMSLLFCLDCYIWFRGKVNYQFIMF
Sbjct: 361 VVLVIIALMLGIRADISSYRHLILFPVWGGWYLVLLMSLLFCLDCYIWFRGKVNYQFIMF 420

Query: 421 GEIHSRKGNTVFNNDFSTTKISGHLYMVSLAFITVGAVSLCSMVRATLAPWLWLCALLFA 480
           GEIHSRKGNTVFNNDFSTTKISGHLYMVSLAFITVGAVSLCSMVRATLAPWLWLCALLFA
Sbjct: 421 GEIHSRKGNTVFNNDFSTTKISGHLYMVSLAFITVGAVSLCSMVRATLAPWLWLCALLFA 480

Query: 481 LGFSMSSFILPYWRELRKTRQWLIVTAIRLVFSGAYPVQFGDFFLGDIVCSLTYSMADVA 540
           LGFSMSSFILPYWRELRKTRQWLIVTAIRLVFSGAYPVQFGDFFLGDIVCSLTYSMADVA
Sbjct: 481 LGFSMSSFILPYWRELRKTRQWLIVTAIRLVFSGAYPVQFGDFFLGDIVCSLTYSMADVA 540

Query: 541 SVFCVFSGQKYNMCGSSNLISMGVLSCIPSYWRLMQCLRRYLDSNDRFPHLLNGAKYAVA 600
           SVFCVFSGQKYNMCGSSNLISMGVLSCIPSYWRLMQCLRRYLDSNDRFPHLLNGAKYAVA
Sbjct: 541 SVFCVFSGQKYNMCGSSNLISMGVLSCIPSYWRLMQCLRRYLDSNDRFPHLLNGAKYAVA 600

Query: 601 ILYNACLCAYRINKLHHSYRSWFIAAGIINSVFSSIWDLVMDWSLFQFQSTNFLLRDDLY 660
           ILYNACLCAYRINKLHHSYRSWFIAAGIINSVFSSIWDLVMDWSLFQFQSTNFLLRDDLY
Sbjct: 601 ILYNACLCAYRINKLHHSYRSWFIAAGIINSVFSSIWDLVMDWSLFQFQSTNFLLRDDLY 660

Query: 661 LAGKRNWQTGQYSKRRKAMYYVSMISDVAIRFQWIVYAIAPRVIQQSAVTSFILGILEVV 720
           LAGKRNWQTGQYSKRRKAMYYVSMISDVAIRFQWIVYAIAPRVIQQSAVTSFILGILEVV
Sbjct: 661 LAGKRNWQTGQYSKRRKAMYYVSMISDVAIRFQWIVYAIAPRVIQQSAVTSFILGILEVV 720

Query: 721 RRFIWIIFRVENEHVANVHLFKITGETPLPYPISPSRALSTSTVHDKHALPSTKNSHEDL 780
           RRFIWIIFRVENEHVANVHLFKITGETPLPYPISPSRALSTSTVHDKHALPSTKNSHEDL
Sbjct: 721 RRFIWIIFRVENEHVANVHLFKITGETPLPYPISPSRALSTSTVHDKHALPSTKNSHEDL 780

Query: 781 VLYASVRHPEVLHMRHRAPSILSNIPWAHAKDFQXXXXXXXXXXXXGI 828
           VLYASVRHPEVLHMRHRAPSILSNIPWAHAKDFQ            GI
Sbjct: 781 VLYASVRHPEVLHMRHRAPSILSNIPWAHAKDFQRPSTSSLPRTSSGI 828

>YIL047C (SYG1) [2620] chr9 complement(265114..267822) Protein for
           which truncation and overexpression can suppress
           lethality of Gpa1p deficiency, member of the divalent
           anion:Na+ (DASS) family of membrane transporters [2709
           bp, 902 aa]
          Length = 902

 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/883 (42%), Positives = 514/883 (58%), Gaps = 74/883 (8%)

Query: 1   MKFAERLRESSIPEWRDXXXXXXXXXXXXXXXXXXXXASR------------------AL 42
           MKFA+ L ES+IPEWRD                    A                    A 
Sbjct: 1   MKFADHLTESAIPEWRDKYIDYKVGKKKLRRYKEKLDAEEEQSSSYRSWMPSVSVYQTAF 60

Query: 43  SVRPTQRSRA----RDEP-----YTMQQEDAVYEFVMGWVIGTELAKCDEFYQWQLDQCE 93
             R   +SR+    R  P     Y+  Q + V +F+  W+I  +L+KC+EFY W L +C+
Sbjct: 61  QQREPGKSRSDGDYRSGPAFKKDYSALQREFVADFIEDWLISFQLSKCNEFYLWLLKECD 120

Query: 94  RKYQLLKQQIEMYCLQKDENGAGLSYGATYEGQEETGLAAQLSAGRSPSPSRAGRLDRAQ 153
           +K+++L+ Q+  Y LQK+     L+  ++      +  AA L AGRS S  R   +D   
Sbjct: 121 KKFEVLQSQLHYYSLQKNYERDNLNRSSSNVDMSTSLYAAGL-AGRSDS--RVNSIDSDS 177

Query: 154 EGV----------------------KRWLQERDLMPSLPARWS------REQGPARVKKY 185
             V                      ++ L++  L+PS P R        R+   +R ++ 
Sbjct: 178 RSVMYGSMPCTKEAKKPRLSLLAYCQKVLKDNRLLPSWPKRGFSLLQDLRQDASSRGRET 237

Query: 186 SANTETFMHICPSKRQAQLQLGHAXXXXXXXXXXXKNYRDLNVTGFRKIVKKFDKTCDTE 245
            A   +F+    +  QA+  L +A           K++RD+NVTGFRK+VKKFDKTC T 
Sbjct: 238 FAFGASFLETMTTT-QARNLLSNAIIEYYLYLQLVKSFRDINVTGFRKMVKKFDKTCHTR 296

Query: 246 ELSKFMSYANEHSPLFEHMGQNLRLYANSFKA-SNSLCQPAARMNSSP-EKDPVTYWEDQ 303
           EL+ FMSYA  H  LF+H   N++L A   +  ++S   P + ++S+  +K+P+T+ E Q
Sbjct: 297 ELTTFMSYARTHYTLFKHADANVQLVAQKMQQITSSQPTPTSELSSAQRDKEPITWLETQ 356

Query: 304 VFQWYTEALTESTQARKHHVQKLRSLSLQYSMNEQIVHRNNTCVVQMFTXXXXXXXXXXX 363
           + +W+T ALT S + RKH+  KL+ L++QYS++EQ+VHRNN  +VQM             
Sbjct: 357 ITEWFTTALTNSPKDRKHNTHKLKKLTIQYSISEQMVHRNNRSIVQMLVVGLGIGVSMTL 416

Query: 364 XXXXXXXXXRADISSYRHLILFPVWGGWYLVLLMSLLFCLDCYIWFRGKVNYQFIMFGEI 423
                     ++ +S+ H ILFP+WGGWY+VLL++ LF ++C+IW R  +NY+FIM GEI
Sbjct: 417 ITYTLYLGISSEETSFTHKILFPLWGGWYMVLLIAFLFLVNCFIWHRTGINYRFIMLGEI 476

Query: 424 HSRKGNTVFNNDFSTTKISGHLYMVSLAFITVGAVSLCSMVRATLAPWLWLCALLFALGF 483
            S+ G   FNNDF+T+KI   LY ++   +     S+ S     L P  +L   + +  F
Sbjct: 477 QSKNGTQFFNNDFATSKIPLKLYFLTFFIVPCAVCSMLSFALEKLTPLGFLYIGIVSFLF 536

Query: 484 SMSSFILPYWRELRKTRQWLIVTAIRLVFSGAYPVQFGDFFLGDIVCSLTYSMADVASVF 543
              S ++PYW ++  TR+WL+VT IRL+ SG +PV+FGDFFLGDI+CSLTYS+AD+A  F
Sbjct: 537 LCPSGLIPYWDKVVHTRKWLVVTLIRLMMSGFFPVEFGDFFLGDIICSLTYSIADIAMFF 596

Query: 544 CVFSGQKYNMCGSSNLISMGVLSCIPSYWRLMQCLRRYLDSNDRFPHLLNGAKYAVAILY 603
           CV+S    N+CGSS+  +MGVLSC+PSYWR MQCLRR+ DS D FPHLLN AKY + I Y
Sbjct: 597 CVYSHTPNNLCGSSHSRAMGVLSCLPSYWRFMQCLRRFADSGDWFPHLLNAAKYTLGIAY 656

Query: 604 NACLCAYRINKLHHSYRSWFIAAGIINSVFSSIWDLVMDWSL-FQFQSTNFLLRDDLYLA 662
           NA LCAYR++      R+ FI    +NS+ +S WDLVMDWS      S N+LLRDDLYLA
Sbjct: 657 NATLCAYRLSDRSEQRRTPFIVCATLNSILTSAWDLVMDWSFAHNTTSYNWLLRDDLYLA 716

Query: 663 GKRNWQTGQYSKRRKAMYYVSMISDVAIRFQWIVYAIAPRVIQQSAVTSFILGILEVVRR 722
           GK+NW+ G YS  RK +YY +MI D+ IRF+WIVYAIAP+ IQQSAVTSFIL +LEV+RR
Sbjct: 717 GKKNWENGSYSFSRKLVYYFAMIWDILIRFEWIVYAIAPQTIQQSAVTSFILALLEVLRR 776

Query: 723 FIWIIFRVENEHVANVHLFKITGETPLPYPIS-------PSRALSTSTVHDKHALPSTKN 775
           F+WIIFRVENEHVANVHLF++TG+ PLPYPI+        S  L +      + +P T  
Sbjct: 777 FVWIIFRVENEHVANVHLFRVTGDAPLPYPIAQVGDDSMDSSDLGSKAFSSLNDIPITP- 835

Query: 776 SHEDLVLYASVRHPEVLHMRHRAPSILSN----IPWAHAKDFQ 814
           SH++     +   P       R  S+  N    IPWAHA DFQ
Sbjct: 836 SHDNNPHSFAEPMPAYRGTFRRRSSVFENISRSIPWAHATDFQ 878

>Kwal_23.5785
          Length = 856

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/842 (43%), Positives = 498/842 (59%), Gaps = 39/842 (4%)

Query: 1   MKFAERLRESSIPEWRDXXXXXXXXXXXXXXXXXXXXASRAL--------SVRPTQRSR- 51
           MKFAE LRES++PEW D                    AS  L        SV P++ S  
Sbjct: 1   MKFAEHLRESAVPEWIDKYIDYKAGKKKLKSCRNTIAASEVLINNVSSFASVPPSRESSM 60

Query: 52  ----ARDEPYTMQQEDAVYEFVMGWVIGTELAKCDEFYQWQLDQCERKYQLLKQQIEMYC 107
               +++  YT  Q+  V  FV  WVI  EL KC++FY W+L +C R++ +L++QIE + 
Sbjct: 61  SRYLSQNRSYTPVQQRFVQSFVEKWVIDQELEKCNDFYLWELKRCGRRFAVLQEQIEKFE 120

Query: 108 LQKDENGAGLSYGATYEGQEETGLAAQLSAGRSPSPSRAGRLDRAQEGVKRWLQERDLMP 167
             + +        + Y G  +     Q        P  AG+    +    R +Q+ +L+P
Sbjct: 121 ADQAQQSIA-DTDSKYYGAVDRDETIQ--------PITAGKDSTLRSRFFRVVQDLELVP 171

Query: 168 SLP--ARWSR--EQGPARVKKYSANTETFMHICPSKRQAQLQLGHAXXXXXXXXXXXKNY 223
           S P  A + R  +Q P       ++ ETF     S  Q Q +L  A           K Y
Sbjct: 172 SFPRMAPFKRLLDQSPEDNNLSVSHGETFAPTTLSTNQIQHRLSDALIEFYLLLQLMKGY 231

Query: 224 RDLNVTGFRKIVKKFDKTCDTEELSKFMSYANEHSPLFEHMGQNLRLYANSFKASNSLCQ 283
           R++NVTGFRKIVKKFDKTC T EL  F+ YA    P+F+H   N R+ A+    S  L +
Sbjct: 232 REVNVTGFRKIVKKFDKTCGTRELVPFIEYAKSTYPIFQHAEANARVVAHQMHDSALLGE 291

Query: 284 PAARMNSSPEKDPVTYWEDQVFQWYTEALTESTQARKHHVQKLRSLSLQYSMNEQIVHRN 343
            ++       +DP+  WE Q  +WYT+ L+ S++ RK    +L++LSL+YS+NEQ VHR 
Sbjct: 292 RSSFATELNVEDPLLSWEQQTTKWYTDVLSSSSKDRKRKTARLKNLSLEYSLNEQKVHRF 351

Query: 344 NTCVVQMFTXXXXXXXXXXXXXXXXXXXXRADISSYRHLILFPVWGGWYLVLLMSLLFCL 403
           N  ++QMF                      A  SS  H +L P+WGGWY+V L++ LF L
Sbjct: 352 NRSILQMFVSGVLLGGSLALVGYTLYRGFVASNSSEIHSLLLPLWGGWYMVFLITFLFLL 411

Query: 404 DCYIWFRGKVNYQFIMFGEIHSRKGNTVFNNDFSTTKISGHLYMVSLAFITVGAVSLCSM 463
           +C+IW R  +NY+FIMFGE+HSR+G  +FNNDFSTTKI    Y  S+    +  +S  S 
Sbjct: 412 NCFIWHRSNINYRFIMFGEMHSRRGAVLFNNDFSTTKIPILFYFASVLAFPMALLSSISF 471

Query: 464 VRATLAPW--LWLCALLFALGFS-----MSSFILPYWRELRKTRQWLIVTAIRLVFSGAY 516
               L PW  +W+ AL+  L FS     +    +PYW +L K+ +W++V+ +RL+FSG Y
Sbjct: 472 NEVNLNPWAIIWI-ALVVVLFFSPVLGELPLLSIPYWNKLTKSVRWILVSFVRLIFSGFY 530

Query: 517 PVQFGDFFLGDIVCSLTYSMADVASVFCVFSGQKYNMCGSSNLISMGVLSCIPSYWRLMQ 576
           PVQFGDFFLGDI CSLTYS+AD+A  FC++S      CGSS+  +MG ++C+P++WR MQ
Sbjct: 531 PVQFGDFFLGDIFCSLTYSLADIAMFFCIYSPTPNGRCGSSHSKAMGAMTCLPNFWRFMQ 590

Query: 577 CLRRYLDSNDRFPHLLNGAKYAVAILYNACLCAYRINKLHHSYRSWFIAAGIINSVFSSI 636
           CLRR+ DS D FPHLLNG KY+++++Y A LCAYRI+    S R+ FI    +N V +SI
Sbjct: 591 CLRRFSDSGDWFPHLLNGLKYSLSVVYYASLCAYRISHTR-SRRNVFIIFATLNGVCTSI 649

Query: 637 WDLVMDWSLFQFQSTNFLLRDDLYLAGKRNWQTGQYSKRRKAMYYVSMISDVAIRFQWIV 696
           WD++MDWSL Q  S N+LLRDDLYLAG++NW+TG YSKRRK++YY++MI DVA+RFQW+V
Sbjct: 650 WDIIMDWSLLQSGSRNWLLRDDLYLAGRKNWKTGAYSKRRKSVYYLAMIWDVAMRFQWVV 709

Query: 697 YAIAPRVIQQSAVTSFILGILEVVRRFIWIIFRVENEHVANVHLFKITGETPLPYPISPS 756
           YAIAP  IQQSA+TSFIL  LEV RRF+WIIFRVENEHVANVHLFK++GE  LPYP + +
Sbjct: 710 YAIAPATIQQSAITSFILAALEVTRRFVWIIFRVENEHVANVHLFKVSGEISLPYPTTVN 769

Query: 757 RALSTSTVHDKHALPSTKNSHEDLVLYASVRHPEVLHMRHRAPSIL----SNIPWAHAKD 812
               T      +    ++ S   +     +   E       +  +L    S+IPWAHA+D
Sbjct: 770 EESETEASVSSNHYAMSEMSFPTMAAPTPMYRGESTQKSTGSNGLLRTLSSSIPWAHAQD 829

Query: 813 FQ 814
           FQ
Sbjct: 830 FQ 831

>Scas_700.25*
          Length = 931

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/906 (39%), Positives = 497/906 (54%), Gaps = 93/906 (10%)

Query: 1   MKFAERLRESSIPEWRDXXXXXXX-------------XXXXXXXXXXXXXASRALSVRPT 47
           MKF + L ES IPEW+D                                 AS + S+  T
Sbjct: 1   MKFGDHLNESMIPEWKDKYVEYKVGKKKLKTFKQKLQNDIDETTTDSLLNASVSDSIEST 60

Query: 48  QRSRARDEP------YTMQQE------DAVYEFVMGWVIGTELAKCDEFYQWQLDQCERK 95
              +    P      Y++Q++        V EFV  W+IG +L KC++FY+  ++ C +K
Sbjct: 61  YIDQENSTPVTPSHVYSIQKDYSPVKKKIVQEFVKDWLIGEQLNKCNDFYEELINDCRKK 120

Query: 96  YQLLKQQIEMYCLQK----DENGAGLSYGATYEGQ--EETGLAAQLSAGRSPSPSRAGRL 149
           Y +L+ QI  Y +Q+    ++    L   ++ E    E T + + +    +P+  R   L
Sbjct: 121 YNILENQIRFYNIQRHSIDNKKTRNLLIVSSSESVDVENTPIDSTIQHPYAPNRGRVITL 180

Query: 150 DRAQ----------------EGVKRWLQERDLMPSLPAR----WSREQGPARVKKYSAN- 188
           +  Q                + +K  L+  +++PSLPA+    +  + G     + + N 
Sbjct: 181 NGQQNVANANKNFASHFLYFQKLKTILKNNNVLPSLPAKGITSYFHQNGRGSQGEGNINA 240

Query: 189 TETFMHICPSKRQAQLQLGHAXXXXXXXXXXXKNYRDLNVTGFRKIVKKFDKTCDTEELS 248
           +E  M    +  +AQ  L  A           K YRDLN+TGFRKI KKFDKTC+T+E  
Sbjct: 241 SENDMLSEITVEKAQKLLTEAILEFYLFLQLVKTYRDLNLTGFRKIAKKFDKTCETKECL 300

Query: 249 KFMSYANEHSPLFEHMGQNLRLYANSFKASNSLCQPAARMNSSPEK---DPVTYWEDQVF 305
           KFM+YA E+  +F H+  N+ L  +  K + S  QP    + +PE    DP+ +WE +V 
Sbjct: 301 KFMNYAKENYTIFSHIDPNIALMTDRMKKT-STYQPLVFEDITPENESDDPLLWWESKVR 359

Query: 306 QWYTEALTESTQARKHHVQKLRSLSLQYSMNEQIVHRNNTCVVQMFTXXXXXXXXXXXXX 365
            WY + LT S    K +  KLR   +QYS+NE+I+HR N  ++QM               
Sbjct: 360 GWYIKDLTNSLTEMKRNNDKLRKFGIQYSLNERIIHRINISILQMTISGFFIGAAFSLII 419

Query: 366 XXXXXXXRADISSYRHLILFPVWGGWYLVLLMSLLFCLDCYIWFRGKVNYQFIMFGEIHS 425
                   +D  +Y H ILFP+WGGWY+VLL+S LF  +C+IW R  +NY+FIMFGEI +
Sbjct: 420 YTLYLIFTSDDKAYIHRILFPLWGGWYMVLLISFLFIGNCFIWHRSGINYRFIMFGEIQA 479

Query: 426 RKGNTVFNNDFSTTKISGHLYMVSLAFITVGAVSLCSMVRATLAPWLWLCALLFALGFSM 485
           R G   FNNDF+TTKIS   Y +SL  +    +++ S     L P  ++   +    F  
Sbjct: 480 RSGTQFFNNDFATTKISLKYYFISLFILACSILAIISFQLEKLTPLGFIFPGIVITLFLA 539

Query: 486 SSFILPYWRELRKTRQWLIVTAIRLVFSGAYPVQFGDFFLGDIVCSLTYSMADVASVFCV 545
            S+++P+W +L +TR+WL  + IRL+FSG YPV+FGDFFLGDIVCSLTYS++D+A  FCV
Sbjct: 540 PSWMIPFWDKLVETRKWLFCSGIRLIFSGFYPVEFGDFFLGDIVCSLTYSISDLAMFFCV 599

Query: 546 FSGQKYNMCGSSNLISMGVLSCIPSYWRLMQCLRRYLDSNDRFPHLLNGAKYAVAILYNA 605
           +       C SS+L SMGVL C+PS+WR MQCLRR+ DS D FPHLLN AKY + + YNA
Sbjct: 600 YVRSDNATCSSSHLRSMGVLGCLPSFWRFMQCLRRFADSGDWFPHLLNAAKYTLGVAYNA 659

Query: 606 CLCAYRINKLHHSYRSWFIAAGIINSVFSSIWDLVMDWSLFQFQSTNFLLRDDLYLAGKR 665
            LC YRI+      R  FI    +N+ ++SIWDLVMDWSL Q    N  LRDDLYLAGK+
Sbjct: 660 TLCVYRISPKSFHSRQIFIVFATLNATYTSIWDLVMDWSLLQPSQNNTFLRDDLYLAGKK 719

Query: 666 NWQTGQYSKRRKAMYYVSMISDVAIRFQWIVYAIAPRVIQQSAVTSFILGILEVVRRFIW 725
           NW+TG+YS +RK++YY +MI +V +RF+WIVYAIAP+ IQQSA TSFIL   EV+RRF+W
Sbjct: 720 NWKTGKYSNKRKSIYYFAMIWNVIVRFEWIVYAIAPQTIQQSADTSFILATAEVLRRFVW 779

Query: 726 IIFRVENEHVANVHLFKITGETPLPYPISPSR----------------ALSTSTVHDK-- 767
           IIFRVENEHVANV+LF+++G  PLPYPI+ +                  L +++ +D   
Sbjct: 780 IIFRVENEHVANVNLFRVSGTAPLPYPINITSITPLGSSDSDEATNIIVLESNSGNDNLS 839

Query: 768 ------------------HALPSTKNSHEDLVLYA-SVRHPEVLHMRHRAPSILSNIPWA 808
                              A+P+   + E  +       HP +        SI  +IPWA
Sbjct: 840 VTNEPQQTSNRINRFDTVGAVPNVDITRETRIEEPMPAYHPPLERRTTTFGSISKSIPWA 899

Query: 809 HAKDFQ 814
           H  DFQ
Sbjct: 900 HTSDFQ 905

>CAGL0L00737g complement(90349..93084) similar to sp|P40528
           Saccharomyces cerevisiae YIL047c SYG1, start by
           similarity
          Length = 911

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/887 (40%), Positives = 497/887 (56%), Gaps = 75/887 (8%)

Query: 1   MKFAERLRESSIPEWRDXXXXXXXXXXXXXXXXXXXXASRALSVRPTQRSRARDEPYTMQ 60
           MKFA+ LRES+I EW+                          +V          + Y   
Sbjct: 1   MKFADHLRESTISEWKGKYIDYKYGKKKLKKYKANTAKLNIPAVGYVSGRGTPKKKYNDF 60

Query: 61  QEDAVYEFVMGWVIGTELAKCDEFYQWQLDQCERKYQLLKQQIEMYCLQKDENGAGLSYG 120
           Q + + +F+  W+I  +L KC+EFY W L QC+ KY +L QQ++ Y   K E    +S  
Sbjct: 61  QVECINDFIEDWLIPNQLYKCNEFYLWLLSQCQEKYLILSQQLDCYREHKKE-FREISSR 119

Query: 121 ATYEGQEETGLAAQLSAGRSPSP--------SRAGRLDRAQEGVKRWLQERDLMPSLPAR 172
            TY+    + L A  S   +P          S     +  Q  +K +L E DLMPS P  
Sbjct: 120 VTYQTSSTSVLQAYGSISNAPEEDIEEDPELSFKKHDNMFQMTLKHFLNEHDLMPSWPKM 179

Query: 173 WSREQGPARVKKYSANT---ETFMHIC----------------------PSK--RQAQLQ 205
           +  E  P  +K  S NT   ETF +                        P K  + A+  
Sbjct: 180 FI-ETIPEALKPKSINTKLKETFAYSNKLNLNLNLMRNKDEHGNKILKNPHKELKHARAL 238

Query: 206 LGHAXXXXXXXXXXXKNYRDLNVTGFRKIVKKFDKTCDTEELSKFMSYANEHSPLFEHMG 265
           L  A           K+YRD+NV GFRKIVKKFDKTC T+EL+ FM +   +  +F+H  
Sbjct: 239 LSDALLEFYLFLQLVKSYRDVNVVGFRKIVKKFDKTCKTQELAGFMRFVRANYTIFKHDA 298

Query: 266 QNLRLYANSFKA----SNSLCQPAARMN------SSPEKDPVTYWEDQVFQWYTEALTES 315
            +      + KA     + + + ++ +       +S   DP+  WE ++ +WYT  +  S
Sbjct: 299 VSTEATIKASKAKTLTDDDIGEDSSTITDTNVSLTSTTIDPLRAWEAKLTKWYTVDVVNS 358

Query: 316 TQARKHHVQKLRSLSLQYSMNEQIVHRNNTCVVQMFTXXXXXXXXXXXXXXXXXXXXRAD 375
              +K H++KL+ +S+QYS+NEQ++HRNN  ++QM                       + 
Sbjct: 359 LSEKKRHLEKLKKVSIQYSLNEQMIHRNNRAILQMTVFGVFTGIAVTLIAYTLYLAFLSP 418

Query: 376 ISSYRHLILFPVWGGWYLVLLMSLLFCLDCYIWFRGKVNYQFIMFGEIHSRKGNTVFNND 435
           +++ RH ILFP+WGGWY++LL+SL F +DC+IW R  +NY+FIMFGE+ ++ G   FNND
Sbjct: 419 LNTKRHKILFPIWGGWYMILLISLFFLIDCFIWHRTGINYRFIMFGEVQAKSGTQFFNND 478

Query: 436 FSTTKISGHLYMVSLAFITVGAVSLCSMVRATLAPWLWLCALLFALGFSMSSFILPYWRE 495
           F+TT I   LY ++   I+   +S  S     L P+ ++  ++  L F     ++PYW +
Sbjct: 479 FATTGIPLRLYFLAFFIISCAIISALSFHFDHLTPYGYIYFIVVGLLFITPYDLIPYWDK 538

Query: 496 LRKTRQWLIVTAIRLVFSGAYPVQFGDFFLGDIVCSLTYSMADVASVFCVFSGQK----Y 551
           L +TR++L+ T IRLV SG YPV+F DFFLGDI+CSLTY+++D+A   C ++ +      
Sbjct: 539 LVETRKFLVTTTIRLVLSGLYPVEFKDFFLGDIICSLTYTLSDLAIFACYYAPKTRKDPL 598

Query: 552 NMCGSSNLISMGVLSCIPSYWRLMQCLRRYLDSNDRFPHLLNGAKYAVAILYNACLCAYR 611
            MCGSS+  +MGVLSC+PS+WR MQC+RR+ DSND FPHL N AKY + + YNA LCAYR
Sbjct: 599 GMCGSSHSKAMGVLSCLPSFWRFMQCVRRFFDSNDWFPHLPNAAKYLLGVAYNATLCAYR 658

Query: 612 INKLHHSYRSWFIAAGIINSVFSSIWDLVMDWSLFQ--FQSTNFLLRDDLYLAGKRNWQT 669
           ++    + R+ FI    +NS+ +SIWDLVMDWS+ Q    + N  LR DLYLAGKRNW+T
Sbjct: 659 LSNHSPAKRNPFIIFATLNSISTSIWDLVMDWSVLQSSIGNENLFLRKDLYLAGKRNWET 718

Query: 670 GQYSKRRKAMYYVSMISDVAIRFQWIVYAIAPRVIQQSAVTSFILGILEVVRRFIWIIFR 729
           G+Y   RKA+YY++M+ DV IRFQWIVYA+AP+ IQQSAVTSF L + EV RRFIW+IFR
Sbjct: 719 GKYDWSRKAVYYIAMVLDVVIRFQWIVYAVAPQTIQQSAVTSFALAVTEVCRRFIWVIFR 778

Query: 730 VENEHVANVHLFKITGETPLPYP----ISPSRALSTSTVHDKH------ALPSTKNSH-E 778
           VENEHVANVHLF++TGE  LPYP    +  S   +T    D+H      ++ S++ SH  
Sbjct: 779 VENEHVANVHLFRVTGEALLPYPNQDVVDFSGKATTDLYDDQHFQQGRDSIESSRPSHLH 838

Query: 779 DLVLYAS-----VRHPEVLH--MRHRAPSILSN----IPWAHAKDFQ 814
           DL L  S        P   +  +  R  +I  N    IPWAHAKDFQ
Sbjct: 839 DLDLSLSDINNKFEEPTATYHSIVRRRTAIFDNISRSIPWAHAKDFQ 885

>Scas_704.39
          Length = 916

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/795 (41%), Positives = 479/795 (60%), Gaps = 58/795 (7%)

Query: 63  DAVYEFVMGWVIGTELAKCDEFYQWQLDQCERKYQLLKQQIEMYCLQKDE-NGAGLSYGA 121
           + ++EF+  W+I  +L KC+EFY W L+   +K+++L+ Q+ ++ +QK   N A  S  +
Sbjct: 104 EIIHEFMENWIISIQLTKCNEFYNWLLNDSRKKFKILQNQVHLFNIQKRLFNDAANSISS 163

Query: 122 TYEGQEETGLAAQLSAGRSPSPSRAGRLDRAQEGVKRWLQERDLMPSLPA---------- 171
           +Y         + +++  S S + +       + +K  L    L+PS P           
Sbjct: 164 SY--------GSLMTSATSDSVTTS-----LIQSIKDTLHAHRLLPSYPQYSLKQLIFNN 210

Query: 172 RWSREQGPARVKKYSANTE----TFMHICPSKRQAQLQ-----LGHAXXXXXXXXXXXKN 222
             S  +    +++ + N E      ++   S  ++ L      L  A           K+
Sbjct: 211 TTSDTESQPLMERETFNPEDQLLNNLNNNTSSAKSSLDKSAKLLSDAILEFYLFLQLIKS 270

Query: 223 YRDLNVTGFRKIVKKFDKTCDTEELSKFMSYANEHSPLFEHMGQNLRLYANSFKASNSLC 282
           YRDLNVTGFRKIVKKFDKT  T EL+KFM++A ++  +F+H+  N++L  N  K  +S  
Sbjct: 271 YRDLNVTGFRKIVKKFDKTFQTNELNKFMAFAKQNFTIFKHIDPNIKLMTNKMKQISSY- 329

Query: 283 QPA---ARMNSSPEKDPVTYWEDQVFQWYTEALTESTQARKHHVQKLRSLSLQYSMNEQI 339
           QP      + S+   DP+ +WE +V  WY   LT S ++ K + +KL+ L +QYS+NEQ+
Sbjct: 330 QPIIFDELIPSNEIDDPILWWESKVKDWYVNQLTNSPKSMKKNNKKLKKLIIQYSLNEQM 389

Query: 340 VHRNNTCVVQMFTXXXXXXXXXXXXXXXXXXXXRADISSYRHLILFPVWGGWYLVLLMSL 399
           VHRNN  ++QM                       +  +SY H ILFP+WGGWY+VLL+SL
Sbjct: 390 VHRNNRAIIQMTIAAWILGISSTSIANTIYLSFMSGYTSYTHKILFPIWGGWYMVLLISL 449

Query: 400 LFCLDCYIWFRGKVNYQFIMFGEIHSRKGNTVFNNDFSTTKISGHLYMVSLAFITVGAVS 459
           L   +C+IW + ++NY+FIMFGEI +R G   +NNDF+TT+IS +LY +S   + +   +
Sbjct: 450 LIISNCFIWHKSEINYRFIMFGEIKARSGTQFYNNDFATTRISLNLYFLSFFILPLSICA 509

Query: 460 LCSMVRATLAPWLWLCAL----LFALGFSMSSFILPYWRELRKTRQWLIVTAIRLVFSGA 515
           L S     L P+  +  L    LF    ++S +ILPYW +L++ R W++ T IRL  SG 
Sbjct: 510 LLSFHNENLFPYAIIYPLIATSLFIAPKAISKYILPYWNKLKEIRVWILTTFIRLSLSGL 569

Query: 516 YPVQFGDFFLGDIVCSLTYSMADVASVFCV-FSGQKYNMCGSSNLISMGVLSCIPSYWRL 574
           YPV+FGDFFLGDI+CSLTYSM+D+A  FC+ FS +    CGSS+ I+MG+LSC+P+YWR+
Sbjct: 570 YPVEFGDFFLGDIICSLTYSMSDIAMFFCIYFSDKPSTTCGSSHSITMGILSCLPNYWRM 629

Query: 575 MQCLRRYLDSNDRFPHLLNGAKYAVAILYNACLCAYRI-NKLHHSYRSWFIAAGIINSVF 633
           MQC RR+ DS D FPHLLN  KY + + YN  LCAYR+ N    + R+ FI    +N++ 
Sbjct: 630 MQCFRRWADSADWFPHLLNAIKYGLGVAYNGTLCAYRLSNHERGTTRNTFIIVAALNALI 689

Query: 634 SSIWDLVMDWSLFQFQSTNFLLRDDLYLAGKRNWQTGQYSKRRKAMYYVSMISDVAIRFQ 693
           +S+WDL +DWSL Q  S N+LLR+DLYLAGK++W+TGQYS+ RK+ YY++M+ DV IRFQ
Sbjct: 690 TSVWDLTVDWSLLQPDSNNWLLRNDLYLAGKKDWETGQYSRARKSFYYIAMVWDVLIRFQ 749

Query: 694 WIVYAIAPRVIQQSAVTSFILGILEVVRRFIWIIFRVENEHVANVHLFKITGETPLPYPI 753
           WIVYAIAP+ IQQ+A+TSFIL   E++RR IW+I RVENEHVANVHLF++TG  PLPYP+
Sbjct: 750 WIVYAIAPQTIQQNAITSFILATTEIIRRCIWVIIRVENEHVANVHLFRVTGNAPLPYPV 809

Query: 754 S-PSRALSTSTVH-----------DKHALP--STKNSHEDLVLYASVRHPEVLHMRHRAP 799
           +  + AL+  T             D+ AL   S   S+++  ++   R          A 
Sbjct: 810 NVQTIALTKPTFQIGEEERMAENLDQQALGNLSFNVSYDENAMWPPYRTLARRRTTTFA- 868

Query: 800 SILSNIPWAHAKDFQ 814
            I  +IPW HA DFQ
Sbjct: 869 EISKSIPWVHATDFQ 883

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 12/17 (70%), Positives = 14/17 (82%)

Query: 1  MKFAERLRESSIPEWRD 17
          MKF + LRES IPEW+D
Sbjct: 1  MKFGDHLRESIIPEWKD 17

>KLLA0F27467g complement(2541110..2543644) similar to sp|P40528
           Saccharomyces cerevisiae YIL047c SYG1 member of the
           major facilitator superfamily singleton, start by
           similarity
          Length = 844

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/851 (37%), Positives = 468/851 (54%), Gaps = 68/851 (7%)

Query: 1   MKFAERLRESSIPEWRDXXXXXXXXXXXXXXXXXXXXASRALSVRPTQRSRARDEPYTMQ 60
           MKFAE LRES +PEW D                          ++  Q+ +   +  +M 
Sbjct: 1   MKFAEHLRESVVPEWSDKYVNYKLGKK---------------KIKQFQKLKKVQDVGSMD 45

Query: 61  QEDAVYEFVMGWVIGTELAKCDEFYQWQLDQCERKYQLLKQQIEMYCLQKDENGAGLSYG 120
           +   V EF+  W++  +L  CDEFY+WQL +   KY  L++QI +Y L+ D+        
Sbjct: 46  RT-IVREFIDDWLVRDQLKNCDEFYEWQLSKYRAKYHKLQRQIHLYVLEADKR------- 97

Query: 121 ATYEGQEETGLAAQLSAGRS-----PSPSRAGRLDRAQEGV----KRWLQERDLMPSLPA 171
           +  +  +E  +A+   A  S     P+ S     D  ++ +    KRWL   +L PS+P 
Sbjct: 98  SRLDSLDEYRIASLSRAPDSYGSIFPNFSPIALKDTVKKKIWYDLKRWLVTHNLCPSMPV 157

Query: 172 RWSREQGPARVKK----YSANTETF-MHICP-SKRQAQLQLGHAXXXXXXXXXXXKNYRD 225
            W + + P   KK     S   ETF     P S  Q + QL  A           KNYRD
Sbjct: 158 SW-KNRDPLLAKKDRKRASRGQETFQTETSPLSLSQIRQQLSDAILDFYLYLQLLKNYRD 216

Query: 226 LNVTGFRKIVKKFDKTCDTEELSKFMSYANEHSPLFEHMGQNLRLYANSFKASN----SL 281
           LNV GFRKIVKKFDK    ++L  FM YA ++S +F    + L+L  ++ + +     +L
Sbjct: 217 LNVNGFRKIVKKFDKVLHQDQLKTFMPYAKKYSIMFSQYDEYLKLIKDNVEHAEVINVNL 276

Query: 282 CQPAARMNSSPEKDPVTYWEDQVFQWYTEALTESTQARKHHVQKLRSLSLQYSMNEQIVH 341
              +       +KDP+T+WE    +WYT  LT S++ +KH+++++++LSLQYS+NEQ +H
Sbjct: 277 FLGSDNDVDRLKKDPLTFWEQTAIKWYTMTLTSSSKDKKHNLERIKNLSLQYSVNEQTIH 336

Query: 342 RNNTCVVQMFTXXXXXXXXXXXXXXXXXXXXRADISSYRHLILFPVWGGWYLVLLMSLLF 401
           RNN  + QMF                     +      R  +L P+W  ++ +  M LLF
Sbjct: 337 RNNASMFQMFLGSAQLGISVTLVILMTIILAKNSSDEVRSALL-PIWSSFHYLTFMGLLF 395

Query: 402 CLDCYIWFRGKVNYQFIMFGEIHSRKGNTVFNNDFSTTKISGHLYMVSLAFITVGAVSLC 461
            +DC+IW++ K+NY+FIMFGEIHSR G  +FNNDF  T I    +  +        ++ C
Sbjct: 396 IIDCFIWYKVKINYRFIMFGEIHSRNGPVLFNNDFGMTHIPLQFFHATTFLCICSILAFC 455

Query: 462 SMVRATLAPWL--WLCALLFALGFSMSSFI--LPYWRELRKTRQWLIVTAIRLVFSGAYP 517
           S++   L PW+  WLC +  AL F     I   PYW E  ++R+++  + IRLVFSG +P
Sbjct: 456 SLMLEKLEPWMITWLC-IAVALFFWKFQVIQPWPYWYETFQSRKYIFTSFIRLVFSGFFP 514

Query: 518 VQFGDFFLGDIVCSLTYSMADVASVFCV-FSGQKYNMCGSSNLISMGVLSCIPSYWRLMQ 576
           VQFGDFFLGDIVCSLTYSM+  A++ C+ F+  K + C    L+ +G+LSC+PSYWR +Q
Sbjct: 515 VQFGDFFLGDIVCSLTYSMSQFATLGCLTFNDSKEDKCRYEKLMWIGILSCLPSYWRFVQ 574

Query: 577 CLRRYLDSNDRFPHLLNGAKYAVAILYNACLCAYRINKLHHSYRSWFIAAGIINSVFSSI 636
           C+RRY DS D FPHLLN  KY + I +NA L  Y+       ++   I  G +NS  +SI
Sbjct: 575 CVRRYFDSYDWFPHLLNAFKYLLGISFNASLYWYKSWPQMQKFKVLLIVFGCLNSTLTSI 634

Query: 637 WDLVMDWSLFQFQSTNFLLRDDLYLAGKRNWQTGQYSKRRKAMYYVSMISDVAIRFQWIV 696
           WDL+MDWSL Q +S NFLLRDDLYL GK+NW++G+YS ++K +YY  M+ DV +R++W+ 
Sbjct: 635 WDLIMDWSLLQTKSKNFLLRDDLYLCGKKNWKSGKYSSKKKCIYYFIMVFDVVVRYEWVF 694

Query: 697 YAIAPRV-IQQSAVTSFILGILEVVRRFIWIIFRVENEHVANVHLFKITGET-PLPYPIS 754
           Y +       +  + +  +  LE++RRF+W+I RVENEHVANVHLFK+T +   LP+P  
Sbjct: 695 YMVKNNTDYVRHPLIALAMATLEILRRFVWVILRVENEHVANVHLFKVTDDNWQLPFP-- 752

Query: 755 PSRALSTSTVHDKHALPSTKNSHEDLVLYASV-----------RHPEVLHMRHRAPSILS 803
               +  S +H +    +   + +++ + + +           R    +   +R  S+  
Sbjct: 753 ---TIEDSELHMEEDYSAAAENMDNIAMLSVMKSDLESQQQRPRSTSAVPKLNRKASVFE 809

Query: 804 NIPWAHAKDFQ 814
            IPWAHA DFQ
Sbjct: 810 IIPWAHATDFQ 820

>AAR127C [314] [Homologous to ScYDR414C (ERD1) - SH]
           (568957..570102) [1146 bp, 381 aa]
          Length = 381

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 88/177 (49%), Gaps = 17/177 (9%)

Query: 564 VLSCIPSYWRLMQCLRRYLDSND----RFPHLLNGAKYA--VAILYNACLCAYRINKLHH 617
           V+  IPS  RL+QCLR Y    D    R   L N  KY+  + IL +A L   R    H 
Sbjct: 209 VVGAIPSVIRLVQCLREYRRKEDAWAARRASLFNALKYSSQLPILVHALLS--RSGAAHG 266

Query: 618 SYRSWFIAAGIINSVFSSIWDLVMDWSLFQFQSTNFLLRDDLYLAGKRNWQTGQYSKRRK 677
             R W   A ++NSV+S  WD+ MDW L  F  ++  +  D  L  +R      YS +  
Sbjct: 267 GQR-WVRWAMLLNSVYSFWWDVTMDWKLGLFNFSSAGMERDEVLRHRR-----LYSVK-- 318

Query: 678 AMYYVSMISDVAIRFQWIVYAIAPRVIQQSAVTSFILGILEVVRRFIWIIFRVENEH 734
             YY +++ D  ++F W+      R + +  +    L +LEV+RR+IW  F++E E+
Sbjct: 319 -YYYGAVLYDFVMKFMWLWELHVGRALFRRDLNPVWLHLLEVIRRWIWTFFKIEAEY 374

>Kwal_47.18721
          Length = 383

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 100/210 (47%), Gaps = 20/210 (9%)

Query: 532 LTYSMADVASVFCVFSGQKYNMCGSSNLISMGVLSCIPSYWRLMQCLRRYLDS---NDRF 588
           L + + D  S  C+ S  +  M  + NL  M  +   P   RL+QCLR +  S    D  
Sbjct: 180 LCHLVVDPISENCIIS--RTAMGSAINLDLM--IGTAPVIIRLLQCLREWRRSRTLGDAR 235

Query: 589 PHLLNGAKYAVAILYNACLCAYR--INKLHHSYRSWFIAAGIINSVFSSIWDLVMDWSLF 646
             + N  KY++ +    C    R   +    +Y  WF+   ++NS +S  WDL MDW+L 
Sbjct: 236 SSIFNALKYSLHLPIVMCAVYSRSFPDVKPGNYVYWFM---LLNSFYSFWWDLTMDWNLG 292

Query: 647 QFQSTNFLLRDDLYLAGKRNWQTGQYSKRRKAMYYVSMISDVAIRFQWIVYAIAPRVIQQ 706
            F      +  +  L  +R++ +         MY+++M +D  +RF W+   +A R   +
Sbjct: 293 VFNFGRSGMGRNEVLRARRHFPS--------YMYFLAMSADFTLRFMWLWELLAGRSAFE 344

Query: 707 SAVTSFILGILEVVRRFIWIIFRVENEHVA 736
                F L ILE++RR+IWI  +++ E ++
Sbjct: 345 GEANIFFLQILEILRRWIWIFVKLDAEAIS 374

>KLLA0A02057g 186220..187374 gi|1169545|sp|P41771|ERD1_KLULA
           Kluyveromyces lactis ERD1 PROTEIN, start by similarity
          Length = 384

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 75/318 (23%), Positives = 131/318 (41%), Gaps = 40/318 (12%)

Query: 456 GAVSLCSMVRATLAPWLWLCALLFALGFS--MSSFILPYWRELRKTRQWLIVTAIRLVFS 513
            ++ L   +   + PW  +C +LF   F+  +S+ +L ++  +    +   + A+ L  S
Sbjct: 67  SSLKLFKSISRVIIPWQLVCIILFQYSFTNNVSNKLLWFFLNVSPLLELFYIFAMILRSS 126

Query: 514 GAY----------------PVQFGDFFLGDIVCSLTYSMADVASVFCVF-----SGQKYN 552
                              P +     + D + S +  + D+A ++  F     +  K  
Sbjct: 127 AMVARCFKRILWVADIEPKPYRNNYIIISDTLTSYSKPLVDLA-IYATFLFHDPTNVKCQ 185

Query: 553 MCGSSNLISMGV---LSCIPSYWRLMQCLRRYLDSNDR---FPHLLNGAKYAVAI---LY 603
           +    N IS+ +   +  +PS  R++Q LR +     +      L N  KYA  I   L 
Sbjct: 186 VERYENAISLNIDVLVGVLPSLVRMIQSLREFTRGRSQKKDGSQLFNAFKYAGNIPIMLV 245

Query: 604 NACLCAYRINKLHHSYRSWFIAAGIINSVFSSIWDLVMDW--SLFQFQSTNFLLRDDLYL 661
                 Y +  L   Y  WF+     NS +S  WD+ MDW   LF F + +  + ++   
Sbjct: 246 TVYTRYYNLGPLGMMY--WFM---FWNSAYSFWWDVTMDWKLELFDFVNGDTSVNNNNSS 300

Query: 662 AGKRNWQTGQYSKRRKAMYYVSMISDVAIRFQWIVYAIAPRVIQQSAVTSFILGILEVVR 721
                        R+ A YY +M  D  +RF W    I+   +    +  F L ILE++R
Sbjct: 301 NKADGLLRSILLYRKNAWYYSAMALDFILRFVWFWEYISGHSVFYGELNIFWLQILEIIR 360

Query: 722 RFIWIIFRVENEHVANVH 739
           R+IW+ F+VE E++A   
Sbjct: 361 RWIWLFFKVEVEYIATTE 378

>Sklu_2440.13 YDR414C, Contig c2440 19959-21104 reverse complement
          Length = 381

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 82/174 (47%), Gaps = 18/174 (10%)

Query: 569 PSYWRLMQCLRRY---LDSNDRFPHLLNGAKYAV---AILYNACLCAYRINKLHHSYRSW 622
           P+  RL+QCLR Y     S D    L N  KY+     ++Y     AY   +   +   W
Sbjct: 209 PATIRLIQCLREYKRSTSSADARAALFNALKYSCQFPILVYTVVTRAYP-GETPSANIYW 267

Query: 623 FIAAGIINSVFSSIWDLVMDWSLFQFQSTNFLLRDDLYLAGKRNWQTGQYSKRRKAMYYV 682
            +   ++NS+++  WDL MDW    F  TN  ++ +     +R++             Y 
Sbjct: 268 LL---LLNSMYTFWWDLTMDWKFGFFNFTNSGMKLNEVSRAQRHFSI--------KTCYC 316

Query: 683 SMISDVAIRFQWIVYAIAPRVIQQSAVTSFILGILEVVRRFIWIIFRVENEHVA 736
           ++  D  +RF W+   ++   + +  +  F L  LE+VRR+IWI F+VE E ++
Sbjct: 317 AIFVDFILRFAWLWELVSGVSVFKGEMNVFWLQFLEIVRRWIWIFFKVEAEFLS 370

>YDR414C (ERD1) [1239] chr4 complement(1295586..1296674) Protein
           required for retention of luminal ER proteins [1089 bp,
           362 aa]
          Length = 362

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/186 (27%), Positives = 88/186 (47%), Gaps = 39/186 (20%)

Query: 565 LSCIPSYWRLMQCLRRYLDSNDRFPH----LLNGAKYAVAILYNACLCAYRI-------N 613
           ++ +P   RL+QCLR Y     R  H    L N  KY+  +    C    R+        
Sbjct: 193 VALLPVLVRLLQCLREY-----RLLHEATLLFNALKYSCNLPILFCTWRSRVYEGSINEE 247

Query: 614 KLHHSYRSWFIAAGIINSVFSSIWDLVMDWSLFQFQSTNFLLRDDLYLAGKRNWQTGQYS 673
           +LHH  R WF+   +INS ++  WD+ MDWSL    S    LR           ++    
Sbjct: 248 RLHHVQR-WFM---LINSSYTLFWDVRMDWSLDSLTS----LRS----------RSKSAV 289

Query: 674 KRRKAMYYVSMISDVAIRFQWIVYAIAPRVIQQSAVTSFI-----LGILEVVRRFIWIIF 728
             +K MY+ +++ D  +RF W+   ++  +   +A + +I     +   EV+RR IW++F
Sbjct: 290 TLKKKMYHSAILVDFLLRFWWLWVYLSQNLKLVAADSDYIFFQGEMQYFEVIRRGIWVVF 349

Query: 729 RVENEH 734
           +++ E+
Sbjct: 350 KLDAEY 355

>CAGL0F02871g complement(278122..279228) similar to sp|P16151
           Saccharomyces cerevisiae YDR414c ERD1 required for
           retention of luminal ER proteins, hypothetical start
          Length = 368

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 78/181 (43%), Gaps = 31/181 (17%)

Query: 565 LSCIPSYWRLMQCLRRYLDSNDRFPHLLNGAKYAVAILYNACLCAYRI---NKLHHSYRS 621
           L+ IP   RL QCL+ Y  +   F  L N  KY+  +    CL   R+   + L     +
Sbjct: 193 LAVIPPLIRLCQCLKEY-KTTKEFTLLANALKYSCHLPVVLCLWYSRVYGDDSLTIRDYN 251

Query: 622 WFIAAGIINSVFSSIWDLVMDWSLFQFQSTNFLLRDDLYLAGKRNWQTGQYSKRR----K 677
                  I S +S IWD+  DW++    S                    +Y K R    K
Sbjct: 252 ILKVMMFIQSTYSYIWDVRKDWTITSISSI-------------------RYQKSRVLFPK 292

Query: 678 AMYYVSMISDVAIRFQWI-VYAIAPRVIQQSAVTSFI---LGILEVVRRFIWIIFRVENE 733
             Y+++++ D  +R+ W+ +  +AP  +       F       +E++RR  W++F++E+E
Sbjct: 293 FYYHIAIVMDGIMRYWWLWIIILAPYDVSGKPTALFFEKEAQFIELIRRAGWVVFKLESE 352

Query: 734 H 734
           +
Sbjct: 353 Y 353

>Scas_570.8
          Length = 353

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 81/186 (43%), Gaps = 39/186 (20%)

Query: 565 LSCIPSYWRLMQCLRRYLDSNDRFPHLLNGAKYAVAILYNACLCAYRI----NKLHHSYR 620
           ++ +P   R+ QCL+ Y    D+   L N  KY   +   AC+   R+    ++ + +  
Sbjct: 192 VASLPVLIRIFQCLKEYRAVGDK-SMLGNTVKYCSNLPILACVWYSRVHGGSSEWNQTLT 250

Query: 621 SWFIAAGIINSVFSSIWDLVMDWSLFQFQSTNFLLRDDLYLAGKRNWQTGQYSKRRKAMY 680
            W     + +S +S  WD+ MDW  F   S+  L    L L                 +Y
Sbjct: 251 MWL---RLFHSSYSLFWDVKMDW--FIDISSRRLRSTKLALPT--------------TIY 291

Query: 681 YVSMISDVAIRFQWIVYAIAPRVIQQSAVTSFI--------LGILEVVRRFIWIIFRVEN 732
           YV ++ D  IR+ W+        +Q    +S+         L  LEV RR IW++F++E+
Sbjct: 292 YVGILIDFIIRYWWVW-------VQWYGASSYFNFIFFDSELQYLEVFRRAIWVVFKLES 344

Query: 733 EHVANV 738
           E+V  +
Sbjct: 345 EYVLKL 350

>CAGL0I05632g 531308..533968 similar to sp|P27514 Saccharomyces
           cerevisiae YNR013c, start by similarity
          Length = 886

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 62/256 (24%), Positives = 96/256 (37%), Gaps = 21/256 (8%)

Query: 1   MKFAERLRESSIPEWRDXXXXXXXXXXXXXXXXXXXXASRALSVRPTQRSRARDEPYTMQ 60
           MKF+  L+ +S+PEW                       S    +       +  +P    
Sbjct: 1   MKFSHSLQFNSVPEWSSKYIAYSQLKKLIYSLQKEKLYSSTPDLSTAASESSELQPLLDV 60

Query: 61  QEDAVYEFVMGWV--IGTELAKCDEFYQWQLDQCERKYQLLKQQIEMYCLQKDENGAGLS 118
            ED    +V  +V  +  E+ K ++FY  Q       Y  LK  +  Y  +++   A   
Sbjct: 61  PEDENSSYVRRFVQALDHEVKKIEKFYLSQETGLIANYNELKDDVHEY--EQELTSANFL 118

Query: 119 YGA-TYEGQEETGLAAQ---------LSAGRSPSPSRAGRLDRAQEGVKRWLQERDLMPS 168
           Y + +  G   TG  A+          S+  S +      +D A   +      R   PS
Sbjct: 119 YPSQSLTGAVPTGGNAKKLRRRRLSSTSSMESNNSGLPLSVDSAPGAIVPPEHHR---PS 175

Query: 169 LPARWSREQGPARVKKYSANTETFMHICPSKRQAQLQLGHAXXXXXXXXXXXKNYRDLNV 228
           + A+ SR    + V   S N   F  + P + Q ++ L              K++ DLN 
Sbjct: 176 IEAQKSRS---STVNNNSLNLSNFEPLNP-QLQHKVTLKKRLVMVYTQLSELKDFIDLNK 231

Query: 229 TGFRKIVKKFDKTCDT 244
           TGF KI KKFDK+ DT
Sbjct: 232 TGFTKICKKFDKSLDT 247

>YNR013C (PHO91) [4596] chr14 complement(649027..651711) Member of
           the phosphate permease family of membrane transporters,
           has similarity to Pho87p and Pho90p [2685 bp, 894 aa]
          Length = 894

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 43/83 (51%), Gaps = 13/83 (15%)

Query: 221 KNYRDLNVTGFRKIVKKFDKTCDTEELSKFMSYANEHSPLFE---------HMGQNLRLY 271
           K++ +LN TGF KI KKFDK+ +T     +++Y   HS +F          H+ + +  Y
Sbjct: 225 KDFIELNQTGFSKICKKFDKSLNTNLKQNYLNYIKFHSHVFNPATINRIQHHITETILTY 284

Query: 272 ANSFKA----SNSLCQPAARMNS 290
           A+  K     SN+    A R+N+
Sbjct: 285 ASLNKGTRRPSNTFNLDADRINN 307

>KLLA0F06160g 598549..601128 similar to sp|P27514 Saccharomyces
           cerevisiae YNR013c, start by similarity
          Length = 859

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 78/169 (46%), Gaps = 33/169 (19%)

Query: 102 QIEMYCLQKDENGAGLSYGATYEGQEET-GLAAQLSAGRSPSPSRAGRLDRAQEGVKRWL 160
           ++++Y  ++D++  G S G     QE++ G   Q+ A R+ + S   RL  +        
Sbjct: 137 EMDLYS-EEDDDEDGFSIG----NQEQSDGQNKQIQARRARTGSVGSRLMHSITS----- 186

Query: 161 QERDLMPSLPARWSREQGPARVKKYSANTETFMHICPSKRQAQLQLGHAXXXXXXXXXXX 220
              +++P+L          +RV  ++  T+  M       + Q+ L              
Sbjct: 187 ---EILPTL----------SRVTDFTT-TDPIM-------EQQITLKKRIVACFTQLSEL 225

Query: 221 KNYRDLNVTGFRKIVKKFDKTCDTEELSKFMSYANEHSPLF-EHMGQNL 268
           K++ +LN TGF KI KKFDK+ D+   + ++   ++ S +F EH  +NL
Sbjct: 226 KSFIELNQTGFAKICKKFDKSLDSNIKTDYLKSLSKKSHVFNEHTIENL 274

>Kwal_23.6129
          Length = 816

 Score = 37.7 bits (86), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 9/80 (11%)

Query: 221 KNYRDLNVTGFRKIVKKFDKTCD----TEELSKFMSYANEHSP-----LFEHMGQNLRLY 271
           K++ +LN TGF KI KKFDK+ D    +E ++K  S     SP     +  ++   + +Y
Sbjct: 189 KSFIELNQTGFSKICKKFDKSLDANIKSEYMAKLSSRVRVFSPEILSTIDSYINDTVAMY 248

Query: 272 ANSFKASNSLCQPAARMNSS 291
           ++    SN   Q  A +  +
Sbjct: 249 SHLLGLSNESSQDPADLEEA 268

>Scas_625.16
          Length = 932

 Score = 37.4 bits (85), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 26/42 (61%)

Query: 221 KNYRDLNVTGFRKIVKKFDKTCDTEELSKFMSYANEHSPLFE 262
           K + +LN TGF KI KKFDK+ +T   S ++    + S +F+
Sbjct: 292 KEFIELNQTGFSKICKKFDKSLNTSIKSSYLETIKKKSSVFK 333

>ADR289C [2030] [Homologous to ScYNR013C (PHO91) - SH]
           (1193040..1195463) [2424 bp, 807 aa]
          Length = 807

 Score = 36.6 bits (83), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 25/43 (58%)

Query: 221 KNYRDLNVTGFRKIVKKFDKTCDTEELSKFMSYANEHSPLFEH 263
           K+Y +LN TGF KI KKFDK+ +T     +M    + + +F  
Sbjct: 187 KSYFELNHTGFSKICKKFDKSLETNIRGNYMQSLPKKTHMFSQ 229

>Kwal_33.13618
          Length = 891

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/23 (60%), Positives = 17/23 (73%)

Query: 221 KNYRDLNVTGFRKIVKKFDKTCD 243
           K++ +LN  GF KI KKFDKT D
Sbjct: 270 KSFIELNRIGFLKITKKFDKTLD 292

>CAGL0J00693g complement(61246..66900) similar to sp|P08964
            Saccharomyces cerevisiae YHR023w MYO1, hypothetical start
          Length = 1884

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 37/65 (56%), Gaps = 6/65 (9%)

Query: 224  RDLNVTGFRKIVKKFDKTCDTEELSKFMSYANEHSPLFEHMGQNLRLYANSFKASNSLCQ 283
            +DL++      ++  +K C+   L+K  S  NE++ L E +G+N +L+AN+ +  +S  +
Sbjct: 1014 KDLDIK-----LQTLEKNCNVA-LTKLKSLLNENAELREEVGKNKKLHANTIQQVSSKEK 1067

Query: 284  PAARM 288
               R+
Sbjct: 1068 EIERL 1072

>ADR177C [1918] [Homologous to ScYOR270C (VPH1) - SH]
           (1014058..1016577) [2520 bp, 839 aa]
          Length = 839

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 41/101 (40%), Gaps = 10/101 (9%)

Query: 88  QLDQCERKYQLLKQQIEMYCLQKDENGAGLSYGATYEGQEETGLAAQLSAGRSP-SPSRA 146
           +LD  ER+Y+     ++ Y +   E+G        YEG E+  L A  SA  SP  P   
Sbjct: 61  RLDNVERQYRFFHSLLQKYGVPLYEDG-------RYEGGEQQSLQALFSANVSPRGPPST 113

Query: 147 GRLDRAQEGVKRWLQERDLMPSLPARWSREQGPARVKKYSA 187
             +D   E     L E      + A    E   A +++Y A
Sbjct: 114 SMIDDHVENAN--LLEERFQQMVEASEKLEAQRANLEEYRA 152

>ADL143W [1598] [Homologous to ScYGR233C (PHO81) - SH]
           complement(440265..443573) [3309 bp, 1102 aa]
          Length = 1102

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 38/83 (45%), Gaps = 11/83 (13%)

Query: 181 RVKKYSANTETFMHICPSKRQAQLQLGHAXXXXXXXXXXXKNYRDLNVTGFRKIVKKFDK 240
           R K  S  T ++ HI  + ++ +  L H            ++Y +LN TGF K++KK+D 
Sbjct: 111 RGKLISKKTSSYRHIRDAVKKVERDLTH-----------LEHYVELNRTGFSKVLKKWDN 159

Query: 241 TCDTEELSKFMSYANEHSPLFEH 263
              +     +++      P+F H
Sbjct: 160 RSHSHTRDFYLATVVSVQPVFTH 182

>YFL004W (VTC2) [1677] chr6 (131805..134291) Subunit of the vacuolar
           transporter chaperone (Vtc) complex (Vtc1p, Vtc2p,
           Vtc3p, Vtc4p), involved in vacuolar polyphosphate
           accumulation [2487 bp, 828 aa]
          Length = 828

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 9/78 (11%)

Query: 222 NYRDLNVTGFRKIVKKFD---------KTCDTEELSKFMSYANEHSPLFEHMGQNLRLYA 272
           N++ LN TGF KIVKK D         K+     L +  S++ E+SPL   +     +  
Sbjct: 116 NFKRLNFTGFAKIVKKHDKLYPKYPSVKSLLEVRLKELPSHSEEYSPLLYRISFLYNILR 175

Query: 273 NSFKASNSLCQPAARMNS 290
           ++F  ++     A++ +S
Sbjct: 176 SNFNTASEPLASASKFSS 193

>KLLA0E12133g 1076424..1078949 similar to sp|P43585 Saccharomyces
           cerevisiae YFL004w VTC2 putative polyphosphate
           synthetase, start by similarity
          Length = 841

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 9/83 (10%)

Query: 222 NYRDLNVTGFRKIVKKFD---------KTCDTEELSKFMSYANEHSPLFEHMGQNLRLYA 272
           N++ LN TGF KIVKK D         K+     L     ++ E+SPL   +     +  
Sbjct: 133 NFQRLNFTGFTKIVKKHDKLHPGYPSVKSLLQVRLKSLPFHSEEYSPLLYKISYLYNILR 192

Query: 273 NSFKASNSLCQPAARMNSSPEKD 295
           N+F + +     +++++S P+ +
Sbjct: 193 NNFSSVSKSLANSSKLSSMPKNE 215

>AFR628C [3820] [Homologous to ScYJL198W (PHO90) - SH; ScYCR037C
           (PHO87) - SH] (1576713..1579322) [2610 bp, 869 aa]
          Length = 869

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/21 (66%), Positives = 16/21 (76%)

Query: 221 KNYRDLNVTGFRKIVKKFDKT 241
           K+Y +LN  GF KI KKFDKT
Sbjct: 248 KSYIELNRIGFFKITKKFDKT 268

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.135    0.428 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 24,273,747
Number of extensions: 979422
Number of successful extensions: 3213
Number of sequences better than 10.0: 36
Number of HSP's gapped: 3237
Number of HSP's successfully gapped: 40
Length of query: 848
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 738
Effective length of database: 12,788,129
Effective search space: 9437639202
Effective search space used: 9437639202
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 66 (30.0 bits)